Citrus Sinensis ID: 046556

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630---
MWRCVSRGLGLSSYRSKRSVSNDSLRSHFSRLFSTNSTGGYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLKVGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNAGERTVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTLDDEIESFPPKARVY
ccccccccccccccccccEEEcccccccccccccccccccEEEEEEEEcEEEEcccHHHHHHHHHHHHccccEEEEEccccccccHHHHHccccccccccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHcccEEEEEHHHHHHHHcccccEEEEEEEEcccccEEEEEcccEEEEcccccEEcccccccccccHHHHHHHHHHccccccccccccccccccccccEEEEcEEEccccEEEccccccccccccccccccccHHHHHHHHHHHHHccccccccccEEEEEcccccHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccEEEEcccccccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEccEEEEEEcccccccccccccccccccccc
cHHHHHHHHHHHHHHccccEEcccccHHHHHccccccccccEEEEcEEcEEEEcccHHHHHHHHHHHcccccEEEEccccHHHcHHHHccccEEccccccHHHccEEHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccEcccEEEEEEccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccEEEEEEEEHHHcEEEEEEccEEEEcccccHHHcccEccccccccHHHHHHHHccccEEccccEEEEEEEEccccEcEccccccccccEEEcccccEcHHHHccccHHHccHHHHHHHHHHHHHccccEcccccEEEEEcccccHHHHHHHccccHHHHHHHccccccccccccccEEEEccccccccccEEEEEccccccccEcccEEEcHHHEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccEcHHHHHHHHHHHHHHHccccEcHHHHHHHHHHHHHHHHHHccEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEccEcEcccccEEcccccEEEEEEccccccccEEcccEccccccHccccccccccc
mwrcvsrglglssyrskrsvsndslrSHFSRLfstnstggytivdhTYDAVVVGAGGAGLRAAIGlsehgfntacitklfptrshtvAAQGGINaalgnmteddwrwhmydtvkgsdwlgdQDAIQYMCREAPKAVIELEnyglpfsrtedgkiyqrafggqsldfgkggqayrcacaadrTGHALLHTLYGQAMKHNTQFFVEYFALDLimnsdgtcQGVIALNMEDGTLHRFRAASTILatggygrayfsatsahtctgdgnamvsraglpledlefvqfhptgiygAGCLLLkvgsrgeggilrnsegerfmeryaptakdlasrdvvsRSMTMEIregrgvgplkdhiylhlnhlppdvlkerlpgiseTAAIFagvdvtkepipvlptvhynmggiptnhhgevvtikgddpdevvpgLMAAGEAACASVHganrlgansLLDIVVFGRACANRVAeiqrpgekqkplennageRTVAWLDKIrnsngsiptskIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHdvkltdrsliwntdLIETIELENLLINACITMHSAEARkesrgaharedftkrddenwmkhtlgywenekvrldyrpvhmntlddeiesfppkarvy
mwrcvsrglglssyrskrsvsndslrshFSRLFSTNSTGGYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLKVGSRGEGGIlrnsegerfmeryaptakdlasrdvvsRSMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAeiqrpgekqkplennageRTVAWldkirnsngsiptskirlNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIELENLLINACITMHSAearkesrgaharedftkrddenwmkhtlgywenekvrLDYRPVHMntlddeiesfppkarvy
MWRCVSRGLGLSSYRSKRSVSNDSLRSHFSRLFSTNSTGGYTIVDHTYDavvvgaggaglraaigLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLKVGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNAGERTVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDlietielenllinACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTLDDEIESFPPKARVY
*****************************SRLFSTNSTGGYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLKVGSRGEGGIL***********************************GRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEI*****************TVAWLDKIR*********KIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIELENLLINACITMH***********************NWMKHTLGYWENEKVRLDYRPVHMN****************
*****************************************TIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLKVGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAE******************TVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTLDDEIESFPPKARVY
********LGLS*************RSHFSRLFSTNSTGGYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLKVGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNAGERTVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIELENLLINACITMHSAE***********EDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTLDDEIESFPPKARVY
MWR*VSRGLGLSSY***********************TGGYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLKVGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNAGERTVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTLDDEIESFPPKAR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWRCVSRGLGLSSYRSKRSVSNDSLRSHFSRLFSTNSTGGYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLKVGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNAGERTVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTLDDEIESFPPKARVY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query633 2.2.26 [Sep-21-2011]
Q6ZDY8630 Succinate dehydrogenase [ yes no 0.993 0.998 0.899 0.0
O82663634 Succinate dehydrogenase [ yes no 0.996 0.995 0.889 0.0
Q9ZPX5632 Succinate dehydrogenase [ no no 0.990 0.992 0.860 0.0
Q9UTJ7641 Probable succinate dehydr yes no 0.965 0.953 0.697 0.0
Q7ZVF3661 Succinate dehydrogenase [ yes no 0.987 0.945 0.681 0.0
Q94523661 Succinate dehydrogenase [ yes no 0.933 0.894 0.692 0.0
Q9U3X4626 Succinate dehydrogenase [ yes no 0.947 0.958 0.703 0.0
P47052634 Succinate dehydrogenase [ yes no 0.977 0.976 0.686 0.0
Q00711640 Succinate dehydrogenase [ no no 0.943 0.932 0.699 0.0
Q801S2665 Succinate dehydrogenase [ N/A no 0.990 0.942 0.659 0.0
>sp|Q6ZDY8|DHSA_ORYSJ Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Oryza sativa subsp. japonica GN=SDH1 PE=2 SV=1 Back     alignment and function desciption
 Score = 1154 bits (2984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/634 (89%), Positives = 605/634 (95%), Gaps = 5/634 (0%)

Query: 1   MWR-CVSRGLGLSSYRSKRSVSNDSLRSHFSRLFSTNSTGGYTIVDHTYDAVVVGAGGAG 59
           MWR CVSRGL   S    +  S+ +  S  +RLFST S+  YT+VDH+YDAVVVGAGGAG
Sbjct: 1   MWRGCVSRGL--RSLSKGKGSSSSAPVSAAARLFSTASSS-YTVVDHSYDAVVVGAGGAG 57

Query: 60  LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL 119
           LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
Sbjct: 58  LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL 117

Query: 120 GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAA 179
           GDQD+IQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAA
Sbjct: 118 GDQDSIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAA 177

Query: 180 DRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAAST 239
           DRTGHA+LHTLYGQAMKHNTQFFVEYFALDLIM+S+GTCQGVIALNMEDGTLHRFRA +T
Sbjct: 178 DRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDSEGTCQGVIALNMEDGTLHRFRATNT 237

Query: 240 ILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLKVGS 299
           ILATGGYGRAYFSATSAHTCTGDGNAMV+RAGLPL+DLEFVQFHPTGIYGAGCL+ + GS
Sbjct: 238 ILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITE-GS 296

Query: 300 RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHL 359
           RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHL
Sbjct: 297 RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHL 356

Query: 360 PPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDE 419
           PP+VLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTN+HGEVVT+KGD+PD 
Sbjct: 357 PPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTMKGDNPDS 416

Query: 420 VVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNAGE 479
           VVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAE  +PGEKQKPL+ +AGE
Sbjct: 417 VVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAETAKPGEKQKPLQKSAGE 476

Query: 480 RTVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVK 539
           +T+AWLDK+RN+NGS+PTSKIRLNMQRVMQNNAAVFRTQETLEEGC+LI KAWES+HDVK
Sbjct: 477 KTIAWLDKLRNANGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCKLITKAWESYHDVK 536

Query: 540 LTDRSLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTL 599
           ++DRSLIWN+DLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDE WMKH+L
Sbjct: 537 ISDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEQWMKHSL 596

Query: 600 GYWENEKVRLDYRPVHMNTLDDEIESFPPKARVY 633
           GYWENEKVRL YRPVHMNTLD E+ESFPPKARVY
Sbjct: 597 GYWENEKVRLAYRPVHMNTLDSEVESFPPKARVY 630
Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Oryza sativa subsp. japonica (taxid: 39947)
EC: 1EC: .EC: 3EC: .EC: 5EC: .EC: 1
>sp|O82663|DHSA1_ARATH Succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial OS=Arabidopsis thaliana GN=SDH1-1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPX5|DHSA2_ARATH Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial OS=Arabidopsis thaliana GN=SDH1-2 PE=1 SV=1 Back     alignment and function description
>sp|Q9UTJ7|DHSA_SCHPO Probable succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh1 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZVF3|DHSA_DANRE Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Danio rerio GN=sdha PE=2 SV=2 Back     alignment and function description
>sp|Q94523|DHSA_DROME Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Drosophila melanogaster GN=SdhA PE=2 SV=3 Back     alignment and function description
>sp|Q9U3X4|DHSA_DICDI Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Dictyostelium discoideum GN=sdhA PE=3 SV=1 Back     alignment and function description
>sp|P47052|DHSX_YEAST Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL045W PE=1 SV=1 Back     alignment and function description
>sp|Q00711|DHSA_YEAST Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH1 PE=1 SV=1 Back     alignment and function description
>sp|Q801S2|DHSAB_XENLA Succinate dehydrogenase [ubiquinone] flavoprotein subunit B, mitochondrial OS=Xenopus laevis GN=sdha-b PE=2 SV=1 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query633
TAIR|locus:2173654634 SDH1-1 "succinate dehydrogenas 0.995 0.993 0.849 1e-297
TAIR|locus:2062146632 SDH1-2 "succinate dehydrogenas 0.990 0.992 0.821 5.6e-290
POMBASE|SPAC1556.02c641 sdh1 "succinate dehydrogenase 0.965 0.953 0.665 1.4e-222
UNIPROTKB|G4NE44646 MGG_00168 "Uncharacterized pro 0.974 0.955 0.662 1.8e-220
DICTYBASE|DDB_G0280535626 sdhA "succinate dehydrogenase 0.947 0.958 0.671 2.4e-218
FB|FBgn0261439661 SdhA "Succinate dehydrogenase 0.868 0.832 0.692 4.8e-218
SGD|S000003581634 YJL045W "Minor succinate dehyd 0.987 0.985 0.645 1.7e-217
SGD|S000001631640 SDH1 "Flavoprotein subunit of 0.943 0.932 0.664 1.2e-216
UNIPROTKB|Q28ED0665 sdha "Succinate dehydrogenase 0.954 0.908 0.649 4.6e-215
UNIPROTKB|Q0BX75595 sdhA "Succinate dehydrogenase, 0.933 0.993 0.659 9.6e-215
TAIR|locus:2173654 SDH1-1 "succinate dehydrogenase 1-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2858 (1011.1 bits), Expect = 1.0e-297, P = 1.0e-297
 Identities = 541/637 (84%), Positives = 573/637 (89%)

Query:     1 MWRCVSRGLGLSSYRSKRSVSNDSLR-SHFSRLFSTNST---GGYTIVDHTYDXXXXXXX 56
             MWRCVSRG    +  SK S   D +  S FSR FST ST     YTIVDHTYD       
Sbjct:     1 MWRCVSRGFRAPA--SKTSSLFDGVSGSRFSRFFSTGSTDTRSSYTIVDHTYDAVVVGAG 58

Query:    57 XXXXXXXXXLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS 116
                      LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM+EDDWRWHMYDTVKGS
Sbjct:    59 GAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGS 118

Query:   117 DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCA 176
             DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTE+GKIYQRAFGGQSLDFGKGGQAYRCA
Sbjct:   119 DWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCA 178

Query:   177 CAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRA 236
             CAADRTGHALLHTLYGQAMKHNTQFFVEYFALDL+M SDG+CQGVIALNMEDGTLHRFR+
Sbjct:   179 CAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMASDGSCQGVIALNMEDGTLHRFRS 238

Query:   237 ASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLK 296
             + TILATGGYGRAYFSATSAHTCTGDGNAMV+RAGLPL+DLEFVQFHPTGIYGAGCL+ +
Sbjct:   239 SQTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITE 298

Query:   297 VGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHL 356
              GSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGP KDHIYLHL
Sbjct:   299 -GSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPHKDHIYLHL 357

Query:   357 NHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDD 416
             NHLPP+VLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTN+HGEVVTIKGDD
Sbjct:   358 NHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDD 417

Query:   417 PDEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENN 476
             PD V+PGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEI +PGEKQKPLE +
Sbjct:   418 PDAVIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKD 477

Query:   477 AGERTVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFH 536
             AGE+T+AWLD++RNSNGS+PTS IRLNMQR+MQNNAAVFRTQETLEEGCQLIDKAWESF 
Sbjct:   478 AGEKTIAWLDRLRNSNGSLPTSTIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFG 537

Query:   537 DVKLTDRSLIWNTDXXXXXXXXXXXXXACITMHSAEARKESRGAHAREDFTKRDDENWMK 596
             DV++ DRS+IWN+D             A ITMHSAEARKESRGAHAREDFTKR+D  WMK
Sbjct:   538 DVQVKDRSMIWNSDLIETLELENLLINASITMHSAEARKESRGAHAREDFTKREDGEWMK 597

Query:   597 HTLGYWENEKVRLDYRPVHMNTLDDEIESFPPKARVY 633
             HTLGYWE+EKVRLDYRPVHM+TLDDEI++FPPKARVY
Sbjct:   598 HTLGYWEDEKVRLDYRPVHMDTLDDEIDTFPPKARVY 634
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006099 "tricarboxylic acid cycle" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016627 "oxidoreductase activity, acting on the CH-CH group of donors" evidence=IEA
GO:0022900 "electron transport chain" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000104 "succinate dehydrogenase activity" evidence=TAS
GO:0005749 "mitochondrial respiratory chain complex II" evidence=ISS;IDA
GO:0006121 "mitochondrial electron transport, succinate to ubiquinone" evidence=TAS
GO:0005618 "cell wall" evidence=IDA
GO:0005524 "ATP binding" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
TAIR|locus:2062146 SDH1-2 "succinate dehydrogenase 1-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC1556.02c sdh1 "succinate dehydrogenase Sdh1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|G4NE44 MGG_00168 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280535 sdhA "succinate dehydrogenase (ubiquinone)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0261439 SdhA "Succinate dehydrogenase A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
SGD|S000003581 YJL045W "Minor succinate dehydrogenase isozyme" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
SGD|S000001631 SDH1 "Flavoprotein subunit of succinate dehydrogenase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|Q28ED0 sdha "Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BX75 sdhA "Succinate dehydrogenase, flavoprotein subunit" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q92J97DHSA_RICCN1, ., 3, ., 9, 9, ., 10.67000.93830.9966yesno
Q5R616DHSA_PONAB1, ., 3, ., 5, ., 10.67950.94150.8975yesno
Q801S2DHSAB_XENLA1, ., 3, ., 5, ., 10.65900.99050.9428N/Ano
Q9UTJ7DHSA_SCHPO1, ., 3, ., 5, ., 10.69720.96520.9531yesno
Q8HXW3DHSA_MACFA1, ., 3, ., 5, ., 10.67630.94150.8975N/Ano
Q68XN9DHSA_RICTY1, ., 3, ., 9, 9, ., 10.65990.93830.9966yesno
Q9ZPX5DHSA2_ARATH1, ., 3, ., 5, ., 10.86050.99050.9920nono
Q7ZVF3DHSA_DANRE1, ., 3, ., 5, ., 10.68180.98730.9455yesno
Q6PA58DHSAA_XENLA1, ., 3, ., 5, ., 10.65900.99050.9428N/Ano
Q0QF17DHSA_MESAU1, ., 3, ., 5, ., 10.71580.85930.9872N/Ano
Q1RHB9DHSA_RICBR1, ., 3, ., 9, 9, ., 10.66660.93830.9966yesno
P0AC42DHSA_ECOL61, ., 3, ., 9, 9, ., 10.54480.90990.9795yesno
P0AC43DHSA_ECO571, ., 3, ., 9, 9, ., 10.54480.90990.9795N/Ano
P0AC41DHSA_ECOLI1, ., 3, ., 9, 9, ., 10.54480.90990.9795N/Ano
P08065DHSA_BACSU1, ., 3, ., 9, 9, ., 10.30880.87990.9505yesno
O82663DHSA1_ARATH1, ., 3, ., 5, ., 10.88990.99680.9952yesno
Q59661DHSA_PARDE1, ., 3, ., 9, 9, ., 10.65390.93040.9816yesno
P31040DHSA_HUMAN1, ., 3, ., 5, ., 10.67950.94150.8975yesno
Q920L2DHSA_RAT1, ., 3, ., 5, ., 10.68240.93040.8978yesno
Q6ZDY8DHSA_ORYSJ1, ., 3, ., 5, ., 10.89900.99360.9984yesno
Q8K2B3DHSA_MOUSE1, ., 3, ., 5, ., 10.68560.93040.8870yesno
Q94523DHSA_DROME1, ., 3, ., 5, ., 10.69280.93360.8940yesno
Q4UJM1DHSA_RICFE1, ., 3, ., 9, 9, ., 10.67000.93830.9966yesno
P31039DHSA_BOVIN1, ., 3, ., 5, ., 10.68240.93040.8857yesno
P47052DHSX_YEAST1, ., 3, ., 5, ., 10.68690.97780.9763yesno
P31038DHSA_RICPR1, ., 3, ., 9, 9, ., 10.65820.93830.9966yesno
Q09508DHSA_CAEEL1, ., 3, ., 5, ., 10.63120.97940.9597yesno
Q8ZQU3DHSA_SALTY1, ., 3, ., 9, 9, ., 10.53910.91460.9846yesno
P51054DHSA_COXBU1, ., 3, ., 9, 9, ., 10.52470.91150.9829yesno
Q28ED0DHSA_XENTR1, ., 3, ., 5, ., 10.68420.95410.9082yesno
P44894FRDA_HAEIN1, ., 3, ., 9, 9, ., 10.38100.84200.8898yesno
Q9U3X4DHSA_DICDI1, ., 3, ., 5, ., 10.70390.94780.9584yesno
Q0QF01DHSA_PIG1, ., 3, ., 5, ., 10.68560.93040.8870yesno
Q9YHT1DHSA_CHICK1, ., 3, ., 5, ., 10.69050.93040.8857yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.3LOW CONFIDENCE prediction!
3rd Layer1.3.99LOW CONFIDENCE prediction!
3rd Layer1.3.5.10.994
3rd Layer1.3.5LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query633
PLN00128635 PLN00128, PLN00128, Succinate dehydrogenase [ubiqu 0.0
PRK09078598 PRK09078, sdhA, succinate dehydrogenase flavoprote 0.0
PTZ00139617 PTZ00139, PTZ00139, Succinate dehydrogenase [ubiqu 0.0
TIGR01816565 TIGR01816, sdhA_forward, succinate dehydrogenase, 0.0
TIGR01812541 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase 0.0
PRK08205583 PRK08205, sdhA, succinate dehydrogenase flavoprote 0.0
PRK07057591 PRK07057, sdhA, succinate dehydrogenase flavoprote 0.0
PRK08958588 PRK08958, sdhA, succinate dehydrogenase flavoprote 0.0
PRK05675570 PRK05675, sdhA, succinate dehydrogenase flavoprote 0.0
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 0.0
PRK05945575 PRK05945, sdhA, succinate dehydrogenase flavoprote 0.0
PRK06069577 PRK06069, sdhA, succinate dehydrogenase flavoprote 0.0
PRK09231582 PRK09231, PRK09231, fumarate reductase flavoprotei 1e-173
PRK06452566 PRK06452, sdhA, succinate dehydrogenase flavoprote 1e-165
TIGR01176580 TIGR01176, fum_red_Fp, fumarate reductase, flavopr 1e-156
PRK08626657 PRK08626, PRK08626, fumarate reductase flavoprotei 1e-146
PRK06263543 PRK06263, sdhA, succinate dehydrogenase flavoprote 1e-135
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 1e-131
COG0029518 COG0029, NadB, Aspartate oxidase [Coenzyme metabol 1e-119
PRK07803626 PRK07803, sdhA, succinate dehydrogenase flavoprote 1e-116
PLN02815594 PLN02815, PLN02815, L-aspartate oxidase 1e-106
PRK08641589 PRK08641, sdhA, succinate dehydrogenase flavoprote 1e-102
PRK07395553 PRK07395, PRK07395, L-aspartate oxidase; Provision 4e-99
PRK08071510 PRK08071, PRK08071, L-aspartate oxidase; Provision 5e-99
PRK09077536 PRK09077, PRK09077, L-aspartate oxidase; Provision 5e-91
TIGR00551488 TIGR00551, nadB, L-aspartate oxidase 9e-91
TIGR01811603 TIGR01811, sdhA_Bsu, succinate dehydrogenase or fu 2e-89
PRK07804541 PRK07804, PRK07804, L-aspartate oxidase; Provision 5e-83
PRK07512513 PRK07512, PRK07512, L-aspartate oxidase; Provision 2e-79
PRK06175433 PRK06175, PRK06175, L-aspartate oxidase; Provision 2e-69
PRK07573640 PRK07573, sdhA, succinate dehydrogenase flavoprote 2e-61
pfam02910127 pfam02910, Succ_DH_flav_C, Fumarate reductase flav 8e-58
PRK08401466 PRK08401, PRK08401, L-aspartate oxidase; Provision 1e-56
TIGR01813439 TIGR01813, flavo_cyto_c, flavocytochrome c 8e-45
PRK06481506 PRK06481, PRK06481, fumarate reductase flavoprotei 1e-35
PRK06854608 PRK06854, PRK06854, adenylylsulfate reductase subu 7e-21
PRK08275554 PRK08275, PRK08275, putative oxidoreductase; Provi 2e-18
PRK13800 897 PRK13800, PRK13800, putative oxidoreductase/HEAT r 1e-13
TIGR02061614 TIGR02061, aprA, adenosine phosphosulphate reducta 2e-12
PTZ003061167 PTZ00306, PTZ00306, NADH-dependent fumarate reduct 5e-10
PTZ00306 1167 PTZ00306, PTZ00306, NADH-dependent fumarate reduct 6e-09
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 4e-05
PRK07494388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl h 8e-04
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 0.001
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 0.001
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 0.002
PRK12844557 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrog 0.003
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase 0.004
>gnl|CDD|177739 PLN00128, PLN00128, Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information 
 Score = 1349 bits (3494), Expect = 0.0
 Identities = 578/636 (90%), Positives = 607/636 (95%), Gaps = 4/636 (0%)

Query: 1   MWR-CVSRGLGLSSYRSKRS-VSNDSLRSHFSRLFSTNS-TGGYTIVDHTYDAVVVGAGG 57
           MWR CV+RGL L +  S  S +++ SLR+  SR FST      YTIVDHTYDAVVVGAGG
Sbjct: 1   MWRRCVARGLRLLASSSASSSLASASLRTALSRFFSTGGGRSSYTIVDHTYDAVVVGAGG 60

Query: 58  AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD 117
           AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
Sbjct: 61  AGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD 120

Query: 118 WLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCAC 177
           WLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCAC
Sbjct: 121 WLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCAC 180

Query: 178 AADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAA 237
           AADRTGHA+LHTLYGQAMKHNTQFFVEYFALDLIM+SDG CQGVIALNMEDGTLHRFRA 
Sbjct: 181 AADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDSDGACQGVIALNMEDGTLHRFRAH 240

Query: 238 STILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLKV 297
           STILATGGYGRAYFSATSAHTCTGDGNAMV+RAGLPL+DLEFVQFHPTGIYGAGCL+ + 
Sbjct: 241 STILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITE- 299

Query: 298 GSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLN 357
           GSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGP KDHIYLHLN
Sbjct: 300 GSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLHLN 359

Query: 358 HLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDP 417
           HLPP+VLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTN+HGEVVTIKGDDP
Sbjct: 360 HLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDP 419

Query: 418 DEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNA 477
           D VVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEI +PGEKQKPL  +A
Sbjct: 420 DAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIAKPGEKQKPLPKDA 479

Query: 478 GERTVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHD 537
           GE+T+AWLDK+RN+NGS+PTSKIRLNMQRVMQNNAAVFRTQETLEEGC+LID+AW+SFHD
Sbjct: 480 GEKTIAWLDKLRNANGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCKLIDEAWDSFHD 539

Query: 538 VKLTDRSLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKH 597
           VK+TDRSLIWN+DLIET+ELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKH
Sbjct: 540 VKVTDRSLIWNSDLIETLELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKH 599

Query: 598 TLGYWENEKVRLDYRPVHMNTLDDEIESFPPKARVY 633
           TLGYWE  KVRLDYRPVHMNTLDDE+E+FPPKARVY
Sbjct: 600 TLGYWEEGKVRLDYRPVHMNTLDDEVETFPPKARVY 635

Length = 635
>gnl|CDD|236375 PRK09078, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|240286 PTZ00139, PTZ00139, Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>gnl|CDD|130875 TIGR01816, sdhA_forward, succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>gnl|CDD|233582 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>gnl|CDD|236185 PRK08205, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180814 PRK07057, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181594 PRK08958, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180193 PRK05675, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180319 PRK05945, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|235689 PRK06069, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236421 PRK09231, PRK09231, fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>gnl|CDD|180567 PRK06452, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|233302 TIGR01176, fum_red_Fp, fumarate reductase, flavoprotein subunit Back     alignment and domain information
>gnl|CDD|181507 PRK08626, PRK08626, fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>gnl|CDD|235758 PRK06263, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|223108 COG0029, NadB, Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|236101 PRK07803, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|215436 PLN02815, PLN02815, L-aspartate oxidase Back     alignment and domain information
>gnl|CDD|236319 PRK08641, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236010 PRK07395, PRK07395, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236147 PRK08071, PRK08071, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236374 PRK09077, PRK09077, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|233018 TIGR00551, nadB, L-aspartate oxidase Back     alignment and domain information
>gnl|CDD|130870 TIGR01811, sdhA_Bsu, succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>gnl|CDD|236102 PRK07804, PRK07804, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236036 PRK07512, PRK07512, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|180442 PRK06175, PRK06175, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236054 PRK07573, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|217281 pfam02910, Succ_DH_flav_C, Fumarate reductase flavoprotein C-term Back     alignment and domain information
>gnl|CDD|236259 PRK08401, PRK08401, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|233583 TIGR01813, flavo_cyto_c, flavocytochrome c Back     alignment and domain information
>gnl|CDD|180584 PRK06481, PRK06481, fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>gnl|CDD|235879 PRK06854, PRK06854, adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|181346 PRK08275, PRK08275, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|237512 PRK13800, PRK13800, putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|233702 TIGR02061, aprA, adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>gnl|CDD|140327 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>gnl|CDD|140327 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|183787 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235779 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 633
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 100.0
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 100.0
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK08626657 fumarate reductase flavoprotein subunit; Provision 100.0
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 100.0
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 100.0
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 100.0
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK09231582 fumarate reductase flavoprotein subunit; Validated 100.0
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 100.0
KOG2403642 consensus Succinate dehydrogenase, flavoprotein su 100.0
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 100.0
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 100.0
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PLN02815594 L-aspartate oxidase 100.0
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK07395553 L-aspartate oxidase; Provisional 100.0
PRK07804541 L-aspartate oxidase; Provisional 100.0
PRK09077536 L-aspartate oxidase; Provisional 100.0
PRK08071510 L-aspartate oxidase; Provisional 100.0
PRK07512513 L-aspartate oxidase; Provisional 100.0
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 100.0
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 100.0
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 100.0
PRK08275554 putative oxidoreductase; Provisional 100.0
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 100.0
PRK08401466 L-aspartate oxidase; Provisional 100.0
PRK06175433 L-aspartate oxidase; Provisional 100.0
PRK06481506 fumarate reductase flavoprotein subunit; Validated 100.0
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 100.0
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 100.0
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 100.0
PTZ003061167 NADH-dependent fumarate reductase; Provisional 100.0
PRK07121492 hypothetical protein; Validated 100.0
PRK08274466 tricarballylate dehydrogenase; Validated 100.0
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 100.0
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 100.0
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 100.0
PRK12839572 hypothetical protein; Provisional 100.0
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 100.0
PRK12842574 putative succinate dehydrogenase; Reviewed 100.0
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 100.0
PF02910129 Succ_DH_flav_C: Fumarate reductase flavoprotein C- 99.97
COG2081408 Predicted flavoproteins [General function predicti 99.96
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.94
COG3573552 Predicted oxidoreductase [General function predict 99.94
TIGR00275400 flavoprotein, HI0933 family. The model when search 99.91
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 99.74
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.71
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.6
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.6
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.56
PLN02546558 glutathione reductase 99.56
PTZ00058561 glutathione reductase; Provisional 99.55
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.54
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.54
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 99.54
PLN02507499 glutathione reductase 99.53
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.52
PRK06116450 glutathione reductase; Validated 99.52
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.52
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.51
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.5
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.49
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.49
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.49
PRK06370463 mercuric reductase; Validated 99.49
PLN02661357 Putative thiazole synthesis 99.49
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 99.45
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.44
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 99.43
PTZ00052499 thioredoxin reductase; Provisional 99.43
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.43
PRK10015429 oxidoreductase; Provisional 99.43
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.42
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 99.42
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.41
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.41
PTZ00153659 lipoamide dehydrogenase; Provisional 99.41
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.41
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.4
PRK14694468 putative mercuric reductase; Provisional 99.4
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.4
PRK14727479 putative mercuric reductase; Provisional 99.37
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.36
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.36
PRK07846451 mycothione reductase; Reviewed 99.36
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.34
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.34
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.34
PRK13748561 putative mercuric reductase; Provisional 99.34
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.33
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.31
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.31
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.31
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.3
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.3
TIGR02053463 MerA mercuric reductase. This model represents the 99.3
PLN02464627 glycerol-3-phosphate dehydrogenase 99.3
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.29
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.28
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 99.26
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.23
PLN02697529 lycopene epsilon cyclase 99.23
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 99.23
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.22
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.21
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.2
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.2
PRK12831464 putative oxidoreductase; Provisional 99.2
PRK10262321 thioredoxin reductase; Provisional 99.2
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.19
PRK10157428 putative oxidoreductase FixC; Provisional 99.19
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.19
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 99.18
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 99.16
COG0579429 Predicted dehydrogenase [General function predicti 99.15
PF01134392 GIDA: Glucose inhibited division protein A; InterP 99.15
PLN02463447 lycopene beta cyclase 99.14
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 99.13
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.12
PRK11728393 hydroxyglutarate oxidase; Provisional 99.11
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 99.11
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 99.09
PRK05257494 malate:quinone oxidoreductase; Validated 99.09
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.08
PRK06126545 hypothetical protein; Provisional 99.07
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.07
PRK06185407 hypothetical protein; Provisional 99.07
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.07
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.06
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 99.04
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.03
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.03
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.03
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.03
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 99.03
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.02
PLN02985514 squalene monooxygenase 99.02
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.02
PRK12779944 putative bifunctional glutamate synthase subunit b 99.02
PRK13512438 coenzyme A disulfide reductase; Provisional 99.01
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.01
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.0
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.99
PRK02106560 choline dehydrogenase; Validated 98.99
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.98
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.98
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.97
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.97
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.95
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.93
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.93
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.93
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.92
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.91
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.9
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.9
PRK06834488 hypothetical protein; Provisional 98.89
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.89
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.89
PRK13977576 myosin-cross-reactive antigen; Provisional 98.88
PRK08244493 hypothetical protein; Provisional 98.88
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.87
PRK07045388 putative monooxygenase; Reviewed 98.87
PRK06184502 hypothetical protein; Provisional 98.87
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.86
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.84
PRK09126392 hypothetical protein; Provisional 98.84
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.84
KOG1298509 consensus Squalene monooxygenase [Lipid transport 98.84
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.83
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.83
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.83
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.83
PRK07190487 hypothetical protein; Provisional 98.83
PRK11445351 putative oxidoreductase; Provisional 98.82
PRK06847375 hypothetical protein; Provisional 98.81
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.81
PRK13984604 putative oxidoreductase; Provisional 98.81
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.81
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 98.8
PLN02785587 Protein HOTHEAD 98.8
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.8
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 98.8
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.79
PRK08163396 salicylate hydroxylase; Provisional 98.78
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.78
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.78
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.77
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.76
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.76
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.75
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.74
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.73
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.73
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.73
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 98.73
PRK08013400 oxidoreductase; Provisional 98.72
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.69
PRK12814652 putative NADPH-dependent glutamate synthase small 98.69
PRK12770352 putative glutamate synthase subunit beta; Provisio 98.69
KOG2853509 consensus Possible oxidoreductase [General functio 98.69
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.68
PRK09897534 hypothetical protein; Provisional 98.68
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.68
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.67
PRK07538413 hypothetical protein; Provisional 98.67
PRK07236386 hypothetical protein; Provisional 98.66
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.64
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.63
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.63
PRK07208479 hypothetical protein; Provisional 98.62
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.62
PTZ00367567 squalene epoxidase; Provisional 98.62
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.62
PRK12771564 putative glutamate synthase (NADPH) small subunit; 98.62
PRK07588391 hypothetical protein; Provisional 98.59
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.58
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.56
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.56
PRK06996398 hypothetical protein; Provisional 98.55
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.55
PRK08294634 phenol 2-monooxygenase; Provisional 98.55
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.54
COG2303542 BetA Choline dehydrogenase and related flavoprotei 98.54
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.52
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.52
PRK05868372 hypothetical protein; Validated 98.51
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.5
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.45
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 98.44
KOG2311679 consensus NAD/FAD-utilizing protein possibly invol 98.44
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.42
PRK06475400 salicylate hydroxylase; Provisional 98.39
PRK06753373 hypothetical protein; Provisional 98.39
PRK07233434 hypothetical protein; Provisional 98.37
PLN02612567 phytoene desaturase 98.36
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.3
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 98.3
KOG2852380 consensus Possible oxidoreductase [General functio 98.3
KOG2960328 consensus Protein involved in thiamine biosynthesi 98.27
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.25
KOG1238623 consensus Glucose dehydrogenase/choline dehydrogen 98.24
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.22
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.19
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 98.16
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.15
PLN02487569 zeta-carotene desaturase 98.09
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.07
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.05
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.01
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.97
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.94
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.92
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 97.91
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.83
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.73
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.69
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.66
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.64
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.63
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.58
PLN02576496 protoporphyrinogen oxidase 97.55
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.5
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.48
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 97.48
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 97.48
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.47
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.47
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.46
PLN02268435 probable polyamine oxidase 97.46
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.45
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.44
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.44
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.42
KOG2403642 consensus Succinate dehydrogenase, flavoprotein su 97.42
PRK06370463 mercuric reductase; Validated 97.41
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.4
PLN02568539 polyamine oxidase 97.39
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.38
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.36
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.34
TIGR02053463 MerA mercuric reductase. This model represents the 97.32
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 97.3
PRK06116450 glutathione reductase; Validated 97.3
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.28
COG4529474 Uncharacterized protein conserved in bacteria [Fun 97.27
PRK10262321 thioredoxin reductase; Provisional 97.25
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.24
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.23
COG3349485 Uncharacterized conserved protein [Function unknow 97.23
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.23
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.19
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.16
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.16
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.14
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.12
PLN02852491 ferredoxin-NADP+ reductase 97.11
PLN02676487 polyamine oxidase 97.11
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.1
PRK12416463 protoporphyrinogen oxidase; Provisional 97.08
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.08
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.06
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.05
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.02
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.01
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.0
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.98
PLN02507499 glutathione reductase 96.98
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.97
PRK14694468 putative mercuric reductase; Provisional 96.97
PLN02529738 lysine-specific histone demethylase 1 96.96
PTZ00058561 glutathione reductase; Provisional 96.94
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.93
PLN02328808 lysine-specific histone demethylase 1 homolog 96.92
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 96.88
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 96.86
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.85
PRK14727479 putative mercuric reductase; Provisional 96.8
PRK13512438 coenzyme A disulfide reductase; Provisional 96.72
PRK13748561 putative mercuric reductase; Provisional 96.72
PTZ00052499 thioredoxin reductase; Provisional 96.72
PTZ00153659 lipoamide dehydrogenase; Provisional 96.71
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 96.69
PRK07846451 mycothione reductase; Reviewed 96.68
PRK12779944 putative bifunctional glutamate synthase subunit b 96.66
PRK065671028 putative bifunctional glutamate synthase subunit b 96.61
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.6
PLN02546558 glutathione reductase 96.54
COG2907447 Predicted NAD/FAD-binding protein [General functio 96.53
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 96.45
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 96.41
PTZ00188506 adrenodoxin reductase; Provisional 96.38
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 96.37
PTZ00318424 NADH dehydrogenase-like protein; Provisional 96.35
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.31
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.28
PLN03000 881 amine oxidase 96.26
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 96.23
PLN02976 1713 amine oxidase 96.21
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 95.79
PRK065671028 putative bifunctional glutamate synthase subunit b 95.65
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 95.64
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 95.6
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 95.4
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 95.37
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 95.23
PRK12814652 putative NADPH-dependent glutamate synthase small 95.03
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 94.56
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 94.56
KOG03992142 consensus Glutamate synthase [Amino acid transport 94.55
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 94.32
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 94.25
PLN02852491 ferredoxin-NADP+ reductase 94.11
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 94.0
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 93.81
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 92.89
PRK098531019 putative selenate reductase subunit YgfK; Provisio 92.85
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 92.52
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 90.66
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 90.49
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 90.47
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 89.98
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.91
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 89.8
PRK04148134 hypothetical protein; Provisional 89.69
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 89.63
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 89.61
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 89.45
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.36
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 89.03
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 88.76
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 88.62
KOG0404322 consensus Thioredoxin reductase [Posttranslational 88.06
KOG2755334 consensus Oxidoreductase [General function predict 87.46
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 87.42
PLN02661357 Putative thiazole synthesis 87.29
KOG1439440 consensus RAB proteins geranylgeranyltransferase c 87.26
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 87.19
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 86.97
PF01134392 GIDA: Glucose inhibited division protein A; InterP 86.78
KOG4405547 consensus GDP dissociation inhibitor [Signal trans 86.78
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 86.7
COG0569225 TrkA K+ transport systems, NAD-binding component [ 86.27
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 86.07
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 85.79
PRK06718202 precorrin-2 dehydrogenase; Reviewed 85.79
PRK06719157 precorrin-2 dehydrogenase; Validated 85.78
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.65
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 85.42
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 84.85
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 84.59
KOG4716503 consensus Thioredoxin reductase [Posttranslational 84.21
PRK05708305 2-dehydropantoate 2-reductase; Provisional 83.58
PRK15116268 sulfur acceptor protein CsdL; Provisional 82.92
PRK06249313 2-dehydropantoate 2-reductase; Provisional 82.77
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 82.68
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 82.63
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 82.61
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 82.45
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 82.1
PRK12921305 2-dehydropantoate 2-reductase; Provisional 81.91
PRK12831464 putative oxidoreductase; Provisional 81.74
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 81.46
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 81.38
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 80.97
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 80.91
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 80.9
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 80.61
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information 
Probab=100.00  E-value=3.5e-107  Score=904.88  Aligned_cols=632  Identities=91%  Similarity=1.436  Sum_probs=541.3

Q ss_pred             Cc-ccccccccCCCCCC-CcccccccccchhhhccccC-CCCCcccccccccEEEECCchHHHHHHHHHHhCCCcEEEEe
Q 046556            1 MW-RCVSRGLGLSSYRS-KRSVSNDSLRSHFSRLFSTN-STGGYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACIT   77 (633)
Q Consensus         1 ~~-~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~DVlIIGgG~AGl~AA~~aa~~G~~V~vlE   77 (633)
                      || ||+++|+.+-.--+ ..++...|++-.+.+.+++- -+.+++.++.++||||||+|+|||+||++|+++|++|+|||
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DVlVIG~G~AGl~AAl~Aae~G~~Vilve   80 (635)
T PLN00128          1 MWRRCVARGLRLLASSSASSSLASASLRTALSRFFSTGGGRSSYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACIT   80 (635)
T ss_pred             CcccchhhHHHHHhhhhcCCCCCccccccchhhhcccccccccCcceeeecCEEEECccHHHHHHHHHHHhcCCcEEEEE
Confidence            67 59999986642112 22244444444444444432 23455566778999999999999999999999999999999


Q ss_pred             ecCCCCCcccccccceeeecCCCCcCCHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHHHHHHCCCcccccCCCccccc
Q 046556           78 KLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQR  157 (633)
Q Consensus        78 k~~~~~g~t~~~~Gg~~~~~~~~~~d~~~~~~~d~~~~~~~~~~~~~v~~~~~~~~~~~~~l~~~Gv~f~~~~~g~~~~~  157 (633)
                      |....+|++..++||+++..+...+|+++.|+.|+++.+.+++|+++++.+++++++.++||+++|++|.+..+|.+...
T Consensus        81 K~~~~~g~s~~a~Ggi~a~~~~~~~Ds~e~~~~Dt~~~g~~~~d~~lv~~l~~~s~~~i~~L~~~Gv~F~~~~~g~~~~~  160 (635)
T PLN00128         81 KLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQR  160 (635)
T ss_pred             cCCCCCCchHHhhcCceeecCCCCCCCHHHHHHHHHHhhCCCCCHHHHHHHHHhHHHHHHHHHhCCCccccCCCCceeec
Confidence            99888899999999998877655678999999999999999999999999999999999999999999999888877777


Q ss_pred             ccCCcccccCCCCccceeEEccCCchHHHHHHHHHHHHhCCCEEEEEEEEEEEEEccCCcEEEEEEEEcCCCeEEEEEcC
Q 046556          158 AFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAA  237 (633)
Q Consensus       158 ~~gg~~~~~~~g~~~~r~~~~~~~~g~~l~~~l~~~a~~~gv~i~~~~~v~~L~~d~~g~v~Gv~~~~~~~G~~~~i~A~  237 (633)
                      .+++++..+..++..+|+++..+.+|..++..|.+.+.+.||+++.++.+++|+.+++++|+||++.+..+|+...|.|+
T Consensus       161 ~~gg~s~~~~~~g~~~r~~~~~d~tG~~i~~~L~~~a~~~gv~i~~~~~~~~Li~~~~g~v~Gv~~~~~~~g~~~~i~Ak  240 (635)
T PLN00128        161 AFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDSDGACQGVIALNMEDGTLHRFRAH  240 (635)
T ss_pred             cccccccccCCCcceeeeeccCCCCHHHHHHHHHHHHHhCCCEEEEeeEEEEEEEcCCCEEEEEEEEEcCCCeEEEEEcC
Confidence            77888765544445668888888999999999999999999999999999999984478999999987678988899999


Q ss_pred             eEEEccCCcCCCCCCCCCCCCCchHHHHHHHHcCCCccCccccccccccccCCcceeeeccccCCCcEEECCCCCccccc
Q 046556          238 STILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPTGIYGAGCLLLKVGSRGEGGILRNSEGERFMER  317 (633)
Q Consensus       238 ~VVlAtGg~~~~~~~~~~~~~~tGdg~~~a~~aGa~l~~~e~~~~~p~~~~~~~~~~~~~~~~g~g~~~vn~~G~rf~~~  317 (633)
                      +|||||||++++|..++++..+||||++||+++||.+.||||+||||+.+++.++++ ++++++.|++++|.+|+|||++
T Consensus       241 aVILATGG~g~~~~~tt~~~~~tGDG~~mA~~aGA~l~~mefvqfhPt~~~~~~~l~-~ea~rg~g~~lvN~~GeRF~~~  319 (635)
T PLN00128        241 STILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLI-TEGSRGEGGILRNSEGERFMER  319 (635)
T ss_pred             eEEECCCCCccccccccCCCCCCCHHHHHHHHcCCCCcCCcceEEecccccCCCeEE-eeeccCCCcEEECCCCCCcccc
Confidence            999999999999999899999999999999999999999999999999887777777 8899999999999999999999


Q ss_pred             cCCccccccchhHHhHHHHHHHHhcCCCCCCCCeEEEecCCCChhHHHHHhHHHHHHHHHHcCCCCCCCCeecccccccc
Q 046556          318 YAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYN  397 (633)
Q Consensus       318 ~~~~~~~l~~r~~~~~~i~~e~~~g~g~~~~~~~v~~d~~~~~~~~l~~~~~~~~~~~~~~~G~d~~~~~i~v~p~~~~~  397 (633)
                      |+|...++.+||++++++..++.+++|+.+..+.+|+|+++++++.++++++.+++.+..+.|+|+.++|+||.|++||+
T Consensus       320 y~~~~~el~~rd~v~~ai~~e~~~~~g~~~~~~~v~ld~~~l~~e~l~~~~~~~~~~~~~~~G~D~~~~pi~v~P~~hyt  399 (635)
T PLN00128        320 YAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYN  399 (635)
T ss_pred             cCcccccccchhHHHHHHHHHHHhcCCCCCCCCEEEEEcCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCceEeeccceEe
Confidence            99987899999999999999998887764434569999999999999999999999887778999999999999999999


Q ss_pred             ccCcccCCCCceeeecCCCCCCcccCeeeecccccccccCCCCCChhhHHHHHHHHHHHHHHHHHHhCCCCCCCCCccch
Q 046556          398 MGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNA  477 (633)
Q Consensus       398 ~GGi~vd~~~~vl~~d~~~~~T~ipGLyAaGe~a~~g~~Ga~rlgg~~l~~a~~~G~~Ag~~aa~~~~~~~~~~~~~~~~  477 (633)
                      ||||.||.+++|++.+.++.+|+||||||||||+|+++||+||||||+|++|+|||++||++|+++++............
T Consensus       400 ~GGi~vd~~g~vl~~~g~~~~t~IpGLYAaGE~a~~g~hGanRlggnsL~~a~vfGr~Ag~~aa~~~~~~~~~~~~~~~~  479 (635)
T PLN00128        400 MGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIAKPGEKQKPLPKDA  479 (635)
T ss_pred             cCCcccCCCCeEecccCcccCCccCceEeeeccccccCCCCCCCchhhHHHHHHHHHHHHHHHHHhhcccccccccchhh
Confidence            99999999999998755445689999999999998899999999999999999999999999998865321111111111


Q ss_pred             hhhHHHHHHHhhhcCCCCChHHHHHHHHHHhhccceEeeCHHHHHHHHHHHHHHHHHhccccccccccccchhhHHHHHH
Q 046556          478 GERTVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIEL  557 (633)
Q Consensus       478 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~m~~~~~~~r~~~~l~~~l~~l~~l~~~~~~~~~~~~~~~~~~~l~~~~e~  557 (633)
                      .+...+.+..+...+++.+|.+++++||++||+++|++|++++|++++++|++|+++++++.+.+....+|++|.+++|+
T Consensus       480 ~~~~~~~~~~~~~~~~~~~~~~~~~~Lq~~m~~~~gi~R~~~~L~~al~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~e~  559 (635)
T PLN00128        480 GEKTIAWLDKLRNANGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCKLIDEAWDSFHDVKVTDRSLIWNSDLIETLEL  559 (635)
T ss_pred             HHHHHHHHHHhhcccCCCChHHHHHHHHHHHhCceeEEECHHHHHHHHHHHHHHHHHHHhccccccccccchhHHHHHHH
Confidence            12222334444343445678899999999999999999999999999999999999998887777667789999999999


Q ss_pred             HHHHHHHHHHHHHHHhCcCCccccccCCCCCCCcccccceEEEEeeCCeeEEeeeeccccccCCcccccCCCCCCC
Q 046556          558 ENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWENEKVRLDYRPVHMNTLDDEIESFPPKARVY  633 (633)
Q Consensus       558 ~~~l~~a~~~~~~al~R~ESRG~h~R~D~P~~d~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~  633 (633)
                      +|||++|+++++|||+|+||||+|||+|||++||++|+|+++..+.++++++.++||...+....+..++|..|.|
T Consensus       560 ~n~l~~a~~~~~aal~R~ESRG~H~R~D~P~~~d~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~  635 (635)
T PLN00128        560 ENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWEEGKVRLDYRPVHMNTLDDEVETFPPKARVY  635 (635)
T ss_pred             HHHHHHHHHHHHHHHhCcCcccccccCCCCCCCccccccEEEEEecCCcceEEecccccccccccccccCCCCCCC
Confidence            9999999999999999999999999999999999999999988777788999999998765543356799999987

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>KOG2403 consensus Succinate dehydrogenase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF02910 Succ_DH_flav_C: Fumarate reductase flavoprotein C-term; InterPro: IPR004112 In bacteria two distinct, membrane-bound, enzyme complexes are responsible for the interconversion of fumarate and succinate (1 Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>KOG2403 consensus Succinate dehydrogenase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query633
1yq3_A621 Avian Respiratory Complex Ii With Oxaloacetate And 0.0
1zoy_A622 Crystal Structure Of Mitochondrial Respiratory Comp 0.0
3vr8_A645 Mitochondrial Rhodoquinol-Fumarate Reductase From T 0.0
1nek_A588 Complex Ii (Succinate Dehydrogenase) From E. Coli W 1e-153
2b76_A602 E. Coli Quinol Fumarate Reductase Frda E49q Mutatio 1e-103
1kf6_A602 E. Coli Quinol-Fumarate Reductase With Bound Inhibi 1e-102
3cir_A602 E. Coli Quinol Fumarate Reductase Frda T234a Mutati 1e-102
3p4r_A577 Crystal Structure Of Menaquinol:fumarate Oxidoreduc 1e-101
1e7p_A656 Quinol:fumarate Reductase From Wolinella Succinogen 5e-88
1qlb_A656 Respiratory Complex Ii-Like Fumarate Reductase From 6e-88
2bs2_A660 Quinol:fumarate Reductase From Wolinella Succinogen 6e-88
1chu_A540 Structure Of L-Aspartate Oxidase: Implications For 4e-43
1knp_A540 E. Coli L-aspartate Oxidase: Mutant R386l In Comple 3e-42
2e5v_A472 Crystal Structure Of L-Aspartate Oxidase From Hyper 4e-35
1ksu_A571 Crystal Structure Of His505tyr Mutant Flavocytochro 6e-27
1jry_A571 Crystal Structure Of Arg402lys Mutant Flavocytochro 1e-26
1p2h_A571 H61m Mutant Of Flavocytochrome C3 Length = 571 2e-26
1qjd_A571 Flavocytochrome C3 From Shewanella Frigidimarina Le 2e-26
1p2e_A571 H61a Mutant Of Flavocytochrome C3 Length = 571 3e-26
2b7r_A571 Structure Of E378d Mutant Flavocytochrome C3 Length 3e-26
1jrx_A571 Crystal Structure Of Arg402ala Mutant Flavocytochro 4e-26
1jrz_A571 Crystal Structure Of Arg402tyr Mutant Flavocytochro 5e-26
1kss_A571 Crystal Structure Of His505ala Mutant Flavocytochro 6e-26
2b7s_A571 R381k Mutant Of Flavocytochrome C3 Length = 571 7e-26
1q9i_A571 The A251c:s430c Double Mutant Of Flavocytochrome C3 2e-25
1m64_A571 Crystal Structure Of Q363f Mutant Flavocytochrome C 3e-25
1e39_A571 Flavocytochrome C3 From Shewanella Frigidimarina Hi 3e-25
1lj1_A571 Crystal Structure Of Q363fR402A MUTANT FLAVOCYTOCHR 5e-25
1d4c_A572 Crystal Structure Of The Uncomplexed Form Of The Fl 8e-23
1d4d_A572 Crystal Structure Of The Succinate Complexed Form O 2e-22
1qo8_A566 The Structure Of The Open Conformation Of A Flavocy 3e-21
2fja_A643 Adenosine 5'-Phosphosulfate Reductase In Complex Wi 3e-06
1jnr_A643 Structure Of Adenylylsulfate Reductase From The Hyp 4e-06
>pdb|1YQ3|A Chain A, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 621 Back     alignment and structure 
Iteration: 1

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/614 (65%), Positives = 471/614 (76%), Gaps = 25/614 (4%)
Query: 41  YTIVDHTYDXXXXXXXXXXXXXXXXLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNM 100
           Y +VDH +D                LSE GFNTAC+TKLFPTRSHTVAAQGGINAALGNM
Sbjct: 12  YPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNM 71
Query: 101 TEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFG 160
            +D+WRWH YDTVKGSDWLGDQDAI YM  +AP AVIELENYG+PFSRTE+GKIYQRAFG
Sbjct: 72  EDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFG 131
Query: 161 GQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQG 220
           GQSL FGKGGQA+RC C ADRTGH+LLHTLYG++++++T +FVEYFALDL+M  +G C+G
Sbjct: 132 GQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLME-NGECRG 190
Query: 221 VIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFV 280
           VIAL +EDGT+HRFRA +T++ATGGYGR YFS TSAHT TGDG AMV+RAGLP +DLEFV
Sbjct: 191 VIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFV 250
Query: 281 QFHPTGIYGAGCLLLKVGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIR 340
           QFHPTGIYGAGCL+ + G RGEGGIL NS+GERFMERYAP AKDLASRDVVSRSMT+EIR
Sbjct: 251 QFHPTGIYGAGCLITE-GCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIR 309
Query: 341 EGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGG 400
           EGRG GP KDH+YL L+HLPP  L  RLPGISETA IFAGVDVTKEPIPVLPTVHYNMGG
Sbjct: 310 EGRGCGPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGG 369
Query: 401 IPTNHHGEVVT-IKGDDPDEVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANR 459
           IPTN+ G+V+T + G+  D+VVPGL A GEAA ASVHGANRLGANSLLD+VVFGRACA  
Sbjct: 370 IPTNYKGQVITHVNGE--DKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALT 427
Query: 460 VAEIQRPGEKQKPLENNAGERTVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQE 519
           +AE  +PGE    ++ NAGE +VA LDK+R ++G+I TS+ RLNMQ+ MQ++AAVFRT  
Sbjct: 428 IAETCKPGEPVPSIKPNAGEESVANLDKLRFADGTIRTSEARLNMQKTMQSHAAVFRTGS 487
Query: 520 TLEEGCQLIDKAWESFHDVKLTDRSLIWNTDXXXXXXXXXXXXXACITMHSAEARKESRG 579
            L+EGC+ + + +     +K  DR ++WNTD             A  T++ AEARKESRG
Sbjct: 488 ILQEGCEKLSQIYRDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRG 547
Query: 580 AHAREDFTKRDD-----------------ENWMKHTLGYWENE--KVRLDYRPVHMNTLD 620
           AHARED+  R D                 E+W KHTL Y + +  KV L YRPV   TL+
Sbjct: 548 AHAREDYKLRIDEFDYSKPLQGQQKRPFEEHWRKHTLSYVDVKSGKVTLKYRPVIDRTLN 607
Query: 621 DE-IESFPPKARVY 633
           +E   S PP  R Y
Sbjct: 608 EEDCSSVPPAIRSY 621
>pdb|1ZOY|A Chain A, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 622 Back     alignment and structure
>pdb|3VR8|A Chain A, Mitochondrial Rhodoquinol-Fumarate Reductase From The Parasitic Nematode Ascaris Suum Length = 645 Back     alignment and structure
>pdb|1NEK|A Chain A, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 588 Back     alignment and structure
>pdb|2B76|A Chain A, E. Coli Quinol Fumarate Reductase Frda E49q Mutation Length = 602 Back     alignment and structure
>pdb|1KF6|A Chain A, E. Coli Quinol-Fumarate Reductase With Bound Inhibitor Hqno Length = 602 Back     alignment and structure
>pdb|3CIR|A Chain A, E. Coli Quinol Fumarate Reductase Frda T234a Mutation Length = 602 Back     alignment and structure
>pdb|3P4R|A Chain A, Crystal Structure Of Menaquinol:fumarate Oxidoreductase In Complex With Glutarate Length = 577 Back     alignment and structure
>pdb|1E7P|A Chain A, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 656 Back     alignment and structure
>pdb|1QLB|A Chain A, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes Length = 656 Back     alignment and structure
>pdb|2BS2|A Chain A, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 660 Back     alignment and structure
>pdb|1CHU|A Chain A, Structure Of L-Aspartate Oxidase: Implications For The Succinate Dehydrogenase FUMARATE REDUCATSE FAMILY Length = 540 Back     alignment and structure
>pdb|1KNP|A Chain A, E. Coli L-aspartate Oxidase: Mutant R386l In Complex With Succinate Length = 540 Back     alignment and structure
>pdb|2E5V|A Chain A, Crystal Structure Of L-Aspartate Oxidase From Hyperthermophilic Archaeon Sulfolobus Tokodaii Length = 472 Back     alignment and structure
>pdb|1KSU|A Chain A, Crystal Structure Of His505tyr Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1JRY|A Chain A, Crystal Structure Of Arg402lys Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1P2H|A Chain A, H61m Mutant Of Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1QJD|A Chain A, Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1P2E|A Chain A, H61a Mutant Of Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|2B7R|A Chain A, Structure Of E378d Mutant Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1JRX|A Chain A, Crystal Structure Of Arg402ala Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1JRZ|A Chain A, Crystal Structure Of Arg402tyr Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1KSS|A Chain A, Crystal Structure Of His505ala Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|2B7S|A Chain A, R381k Mutant Of Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1Q9I|A Chain A, The A251c:s430c Double Mutant Of Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1M64|A Chain A, Crystal Structure Of Q363f Mutant Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1E39|A Chain A, Flavocytochrome C3 From Shewanella Frigidimarina Histidine 365 Mutated To Alanine Length = 571 Back     alignment and structure
>pdb|1LJ1|A Chain A, Crystal Structure Of Q363fR402A MUTANT FLAVOCYTOCHROME C3 Length = 571 Back     alignment and structure
>pdb|1D4C|A Chain A, Crystal Structure Of The Uncomplexed Form Of The Flavocytochrome C Fumarate Reductase Of Shewanella Putrefaciens Strain Mr-1 Length = 572 Back     alignment and structure
>pdb|1D4D|A Chain A, Crystal Structure Of The Succinate Complexed Form Of The Flavocytochrome C Fumarate Reductase Of Shewanella Putrefaciens Strain Mr-1 Length = 572 Back     alignment and structure
>pdb|1QO8|A Chain A, The Structure Of The Open Conformation Of A Flavocytochrome C3 Fumarate Reductase Length = 566 Back     alignment and structure
>pdb|2FJA|A Chain A, Adenosine 5'-Phosphosulfate Reductase In Complex With Substrate Length = 643 Back     alignment and structure
>pdb|1JNR|A Chain A, Structure Of Adenylylsulfate Reductase From The Hyperthermophilic Archaeoglobus Fulgidus At 1.6 Resolution Length = 643 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query633
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 0.0
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 0.0
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 0.0
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 0.0
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 0.0
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 0.0
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 1e-171
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 1e-149
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 1e-140
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 1e-137
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 5e-79
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 9e-52
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 7e-05
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 9e-05
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 2e-04
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 3e-04
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 5e-04
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 8e-04
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 9e-04
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Length = 621 Back     alignment and structure
 Score = 1084 bits (2805), Expect = 0.0
 Identities = 424/624 (67%), Positives = 500/624 (80%), Gaps = 23/624 (3%)

Query: 30  SRLFSTNSTGGYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAA 89
           S   S + +  Y +VDH +DAVVVGAGGAGLRAA GLSE GFNTAC+TKLFPTRSHTVAA
Sbjct: 1   STKVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAA 60

Query: 90  QGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT 149
           QGGINAALGNM +D+WRWH YDTVKGSDWLGDQDAI YM  +AP AVIELENYG+PFSRT
Sbjct: 61  QGGINAALGNMEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRT 120

Query: 150 EDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALD 209
           E+GKIYQRAFGGQSL FGKGGQA+RC C ADRTGH+LLHTLYG++++++T +FVEYFALD
Sbjct: 121 EEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALD 180

Query: 210 LIMNSDGTCQGVIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSR 269
           L+M  +G C+GVIAL +EDGT+HRFRA +T++ATGGYGR YFS TSAHT TGDG AMV+R
Sbjct: 181 LLME-NGECRGVIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTR 239

Query: 270 AGLPLEDLEFVQFHPTGIYGAGCLLLKVGSRGEGGILRNSEGERFMERYAPTAKDLASRD 329
           AGLP +DLEFVQFHPTGIYGAGCL+ + G RGEGGIL NS+GERFMERYAP AKDLASRD
Sbjct: 240 AGLPCQDLEFVQFHPTGIYGAGCLITE-GCRGEGGILINSQGERFMERYAPVAKDLASRD 298

Query: 330 VVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPIP 389
           VVSRSMT+EIREGRG GP KDH+YL L+HLPP  L  RLPGISETA IFAGVDVTKEPIP
Sbjct: 299 VVSRSMTIEIREGRGCGPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIP 358

Query: 390 VLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGANRLGANSLLDI 449
           VLPTVHYNMGGIPTN+ G+V+T   +  D+VVPGL A GEAA ASVHGANRLGANSLLD+
Sbjct: 359 VLPTVHYNMGGIPTNYKGQVIT-HVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDL 417

Query: 450 VVFGRACANRVAEIQRPGEKQKPLENNAGERTVAWLDKIRNSNGSIPTSKIRLNMQRVMQ 509
           VVFGRACA  +AE  +PGE    ++ NAGE +VA LDK+R ++G+I TS+ RLNMQ+ MQ
Sbjct: 418 VVFGRACALTIAETCKPGEPVPSIKPNAGEESVANLDKLRFADGTIRTSEARLNMQKTMQ 477

Query: 510 NNAAVFRTQETLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIELENLLINACITMH 569
           ++AAVFRT   L+EGC+ + + +     +K  DR ++WNTDL+ET+EL+NL++ A  T++
Sbjct: 478 SHAAVFRTGSILQEGCEKLSQIYRDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIY 537

Query: 570 SAEARKESRGAHAREDFTKRDD-----------------ENWMKHTLGYW--ENEKVRLD 610
            AEARKESRGAHARED+  R D                 E+W KHTL Y   ++ KV L 
Sbjct: 538 GAEARKESRGAHAREDYKLRIDEFDYSKPLQGQQKRPFEEHWRKHTLSYVDVKSGKVTLK 597

Query: 611 YRPVHMNTLDD-EIESFPPKARVY 633
           YRPV   TL++ +  S PP  R Y
Sbjct: 598 YRPVIDRTLNEEDCSSVPPAIRSY 621
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Length = 588 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Length = 660 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Length = 602 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Length = 643 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 662 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Length = 540 Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Length = 472 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query633
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 100.0
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 100.0
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 100.0
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 100.0
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 100.0
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 100.0
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 100.0
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 100.0
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 100.0
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 100.0
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 100.0
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 100.0
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 100.0
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.91
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.89
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.72
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.65
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.64
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.63
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.61
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.61
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.57
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.54
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.52
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.5
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.49
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.49
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.48
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.47
3dme_A369 Conserved exported protein; structural genomics, P 99.42
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.42
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.41
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.41
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.41
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.4
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.4
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.4
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.4
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.38
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.38
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.38
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.38
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.38
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.36
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.35
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.34
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.34
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.34
4dna_A463 Probable glutathione reductase; structural genomic 99.34
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.33
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.33
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.33
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.31
3atr_A453 Conserved archaeal protein; saturating double bond 99.29
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 99.29
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.28
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.28
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.28
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.28
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.27
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.27
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.27
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.27
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.27
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.26
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.26
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.26
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.26
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.26
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.25
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.24
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 99.23
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.22
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.22
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.22
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.22
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.2
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.19
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.19
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.18
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.18
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.17
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.17
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.16
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 99.16
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.16
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.16
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.15
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.15
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.15
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.14
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.14
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.13
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.11
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.11
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.1
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.1
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.07
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.06
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.06
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.06
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.05
2cul_A232 Glucose-inhibited division protein A-related PROT 99.05
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.02
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.01
2bry_A497 NEDD9 interacting protein with calponin homology a 99.01
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.0
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.99
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.98
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.98
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.98
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.97
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.96
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.96
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.95
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.95
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.93
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.91
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 98.91
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.9
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.9
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.9
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.89
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.89
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 98.88
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.88
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.87
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.86
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.84
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.83
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.81
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.81
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.81
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.8
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.8
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.8
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.78
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.77
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.76
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 98.76
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.74
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 98.74
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.72
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.72
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.71
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.71
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.71
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.71
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.71
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.69
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.68
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.66
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.64
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 98.63
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.63
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.61
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.61
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.59
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.57
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.55
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 98.54
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.53
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.52
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.5
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.5
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.48
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.47
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.44
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.44
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.43
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.4
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.4
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.38
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.37
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.31
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 98.3
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.28
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.27
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.27
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.26
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.19
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 98.18
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.17
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.1
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.09
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.08
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.05
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.93
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.87
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.87
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.84
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.84
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.82
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.79
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.78
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.78
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.75
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.74
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.74
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.74
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.73
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.7
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.7
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.7
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.69
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.68
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.67
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.66
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.65
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.63
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.63
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.62
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.62
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.62
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.61
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.61
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.6
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.6
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.59
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.59
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.57
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.57
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.56
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.51
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.51
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.49
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.49
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.48
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.48
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.47
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.46
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.45
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.45
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.43
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.42
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.42
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.42
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.41
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 97.41
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.41
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.4
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.4
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.38
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.38
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.37
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.34
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.34
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.32
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.31
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.31
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.31
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.29
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.28
4dna_A463 Probable glutathione reductase; structural genomic 97.28
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.25
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.24
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.22
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.19
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.17
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.11
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.09
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.05
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.04
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.03
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.03
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.02
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.02
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.97
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 96.93
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.93
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 96.92
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.8
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.8
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.79
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.78
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 96.76
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.58
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 96.57
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 96.52
1vg0_A650 RAB proteins geranylgeranyltransferase component A 96.52
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.51
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 96.44
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 96.0
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 95.96
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 95.88
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 95.75
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 95.6
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 95.55
2lfc_A160 Fumarate reductase, flavoprotein subunit; structur 95.31
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 95.21
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 94.94
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 94.83
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 94.74
4fk1_A304 Putative thioredoxin reductase; structural genomic 93.72
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 93.32
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 92.64
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 92.55
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 92.49
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 92.24
2cul_A232 Glucose-inhibited division protein A-related PROT 91.95
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 91.82
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 91.71
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 91.57
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.78
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 90.59
1lss_A140 TRK system potassium uptake protein TRKA homolog; 89.99
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 88.69
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 88.34
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 88.14
1id1_A153 Putative potassium channel protein; RCK domain, E. 88.04
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 87.67
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 87.12
1vg0_A650 RAB proteins geranylgeranyltransferase component A 86.94
3c85_A183 Putative glutathione-regulated potassium-efflux S 86.74
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 86.21
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 85.76
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 84.57
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 84.01
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 83.87
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 83.23
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 83.19
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 83.05
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 82.89
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 82.81
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 82.49
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 82.44
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 81.94
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 81.68
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 81.51
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 81.36
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 81.35
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 81.34
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 80.68
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 80.51
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 80.49
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 80.3
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
Probab=100.00  E-value=1.1e-104  Score=888.17  Aligned_cols=591  Identities=71%  Similarity=1.169  Sum_probs=531.8

Q ss_pred             CcccccccccEEEECCchHHHHHHHHHHhCCCcEEEEeecCCCCCcccccccceeeecCCCCcCCHHHHHHHHHhcCCCC
Q 046556           40 GYTIVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL  119 (633)
Q Consensus        40 ~~~~~~~~~DVlIIGgG~AGl~AA~~aa~~G~~V~vlEk~~~~~g~t~~~~Gg~~~~~~~~~~d~~~~~~~d~~~~~~~~  119 (633)
                      +++.++.++||||||||+|||+||+.|+++|++|+||||....++++..++||+++..+....|+++.++.|+++.+.++
T Consensus        11 ~~~~~~~~~DVvVVG~G~AGl~AAl~aa~~G~~V~vlEK~~~~~g~s~~a~GGi~a~~~~~~~ds~~~~~~dtl~~g~~l   90 (621)
T 2h88_A           11 QYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHFYDTVKGSDWL   90 (621)
T ss_dssp             CSCEEEEEEEEEEECCSHHHHHHHHHHHHTTCCEEEEESSCGGGSGGGGCCSCEECCCCSSSCCCHHHHHHHHHHHTTTC
T ss_pred             CCccccccCCEEEECccHHHHHHHHHHHHCCCcEEEEeccCCCCCCchhhCCCcEecCCCCCCCCHHHHHHHHHHhcCCC
Confidence            35566788999999999999999999999999999999998888888889999988776656788999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCcccccCCCcccccccCCcccccCCCCccceeEEccCCchHHHHHHHHHHHHhCCC
Q 046556          120 GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNT  199 (633)
Q Consensus       120 ~~~~~v~~~~~~~~~~~~~l~~~Gv~f~~~~~g~~~~~~~gg~~~~~~~g~~~~r~~~~~~~~g~~l~~~l~~~a~~~gv  199 (633)
                      ++++.++.+++.+++.++||+++|++|.+..+|.+....+++++.+++.+...+|.++..+.+|..++..|.+++++.|+
T Consensus        91 ~d~~~v~~l~~~s~~~i~~L~~~Gv~f~~~~~g~~~~~~~gg~s~~~g~~~~~~R~~~~~d~tG~~l~~~L~~~~~~~gv  170 (621)
T 2h88_A           91 GDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDT  170 (621)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHHTTCCCCBCTTSSBCEECCTTCBSTTTTSCBCCCEECSTTCHHHHHHHHHHHHHTTSCC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHcCCCcccCCCCceeccccCcccccccCCCcceeEEEecCCCHHHHHHHHHHHHHhCCC
Confidence            99999999999999999999999999999888888877888888776655555688877788899999999999999999


Q ss_pred             EEEEEEEEEEEEEccCCcEEEEEEEEcCCCeEEEEEcCeEEEccCCcCCCCCCCCCCCCCchHHHHHHHHcCCCccCccc
Q 046556          200 QFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEF  279 (633)
Q Consensus       200 ~i~~~~~v~~L~~d~~g~v~Gv~~~~~~~G~~~~i~A~~VVlAtGg~~~~~~~~~~~~~~tGdg~~~a~~aGa~l~~~e~  279 (633)
                      +|++++.|++|+. ++++|+||.+.+..+|+...|.|+.||+||||++.+|..+++++.+||||+.||+++|+.+.+|||
T Consensus       171 ~i~~~~~v~~Li~-~~g~v~Gv~~~~~~~G~~~~i~A~~VVlATGG~~~~y~~~t~~~~~tGdG~~mA~raGa~l~~me~  249 (621)
T 2h88_A          171 SYFVEYFALDLLM-ENGECRGVIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEF  249 (621)
T ss_dssp             EEEETEEEEEEEE-ETTEEEEEEEEETTTCCEEEEEEEEEEECCCCCGGGSSSBSSCTTCCCHHHHHHHHTTCCEECTTC
T ss_pred             EEEEceEEEEEEE-ECCEEEEEEEEEcCCCcEEEEEcCeEEECCCccccccCCcCCCCCCChHHHHHHHHcCCCcccCcc
Confidence            9999999999998 678999999987668888889999999999999999999999999999999999999999999999


Q ss_pred             cccccccccCCcceeeeccccCCCcEEECCCCCccccccCCccccccchhHHhHHHHHHHHhcCCCCCCCCeEEEecCCC
Q 046556          280 VQFHPTGIYGAGCLLLKVGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHL  359 (633)
Q Consensus       280 ~~~~p~~~~~~~~~~~~~~~~g~g~~~vn~~G~rf~~~~~~~~~~l~~r~~~~~~i~~e~~~g~g~~~~~~~v~~d~~~~  359 (633)
                      +||||+++++.++++ +++++++|++++|.+|+|||++|.|...++.+||+++++|..++.++++..+..+.||+|++++
T Consensus       250 ~q~hPt~~~~~~~l~-se~~rg~g~ilvn~~G~RF~~~y~p~~~ela~rdvv~rai~~e~~~g~g~~~~~~~v~ld~~~l  328 (621)
T 2h88_A          250 VQFHPTGIYGAGCLI-TEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHVYLQLHHL  328 (621)
T ss_dssp             EEEEEEEETTTCCBC-CTHHHHTTCEEECTTCCCTHHHHSTTTGGGSCHHHHHHHHHHHHHTTCCBTTTTCBEEEECTTS
T ss_pred             eeeecccccCCccee-cccccCCccEEECCCCCCcccccCcccccccchHHHHHHHHHHHHhcCCcccCCCeEEEEcccC
Confidence            999999998888877 8999999999999999999999999888999999999999999999888655556799999999


Q ss_pred             ChhHHHHHhHHHHHHHHHHcCCCCCCCCeeccccccccccCcccCCCCceeeecCCCCCCcccCeeeecccccccccCCC
Q 046556          360 PPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGAN  439 (633)
Q Consensus       360 ~~~~l~~~~~~~~~~~~~~~G~d~~~~~i~v~p~~~~~~GGi~vd~~~~vl~~d~~~~~T~ipGLyAaGe~a~~g~~Ga~  439 (633)
                      +++.++++++.+++.+..+.|+||.++|+||.|++||+||||.||.++|||+.+.. ++|+||||||||||+|+++||+|
T Consensus       329 ~~~~l~~~~~~i~~~~~~~~G~D~~~~pi~v~p~~h~tmGGi~~d~~~~Vl~~~~~-~~t~IpGLyAaGE~a~~g~hGan  407 (621)
T 2h88_A          329 PPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVNG-EDKVVPGLYACGEAASASVHGAN  407 (621)
T ss_dssp             CHHHHHHHCHHHHHHHHHHHCCCTTTSCEEEEEEEEEESCBEEBCTTSEEEEEETT-EEEEEEEEEECGGGEECSSSTTS
T ss_pred             CHHHHHHHHHHHHHHHHHhcCCCCCCCCEEEEeecccccCcEeECCCCeEeecccC-CCcccCceEEccccccccccCCC
Confidence            99999999999999888767999999999999999999999999999999973221 45899999999999878999999


Q ss_pred             CCChhhHHHHHHHHHHHHHHHHHHhCCCCCCCCCccchhhhHHHHHHHhhhcCCCCChHHHHHHHHHHhhccceEeeCHH
Q 046556          440 RLGANSLLDIVVFGRACANRVAEIQRPGEKQKPLENNAGERTVAWLDKIRNSNGSIPTSKIRLNMQRVMQNNAAVFRTQE  519 (633)
Q Consensus       440 rlgg~~l~~a~~~G~~Ag~~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~m~~~~~~~r~~~  519 (633)
                      |||||||++|+|||++||++|+++++........+....+...+.+..++..++..++.+++.+||++||+|+|++|+++
T Consensus       408 rlggnsL~~~~vfGr~Ag~~aa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~m~~~~gi~R~~~  487 (621)
T 2h88_A          408 RLGANSLLDLVVFGRACALTIAETCKPGEPVPSIKPNAGEESVANLDKLRFADGTIRTSEARLNMQKTMQSHAAVFRTGS  487 (621)
T ss_dssp             CCTTSHHHHHHHHHHHHHHHHHHHCCTTCCCCCCCTTTTHHHHHHHHHHHTCBSSEEHHHHHHHHHHHHHHHSSSSBCHH
T ss_pred             CCchHhHHHHHHHHHHHHHHHHHhhhccccccccchhHHHHHHHHHHHhhccCCCCCHHHHHHHHHHHhhhceeEecCHH
Confidence            99999999999999999999999875322222223233344556677777666677899999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhccccccccccccchhhHHHHHHHHHHHHHHHHHHHHHhCcCCccccccCCCCCCCcc-------
Q 046556          520 TLEEGCQLIDKAWESFHDVKLTDRSLIWNTDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDE-------  592 (633)
Q Consensus       520 ~l~~~l~~l~~l~~~~~~~~~~~~~~~~~~~l~~~~e~~~~l~~a~~~~~~al~R~ESRG~h~R~D~P~~d~~-------  592 (633)
                      +|++++++|++|+++++++.+.|.+..||++|++++|++|||++|+++++|||+|+||||+|||+|||++||+       
T Consensus       488 ~L~~a~~~l~~l~~~~~~~~~~~~~~~~n~~l~~~~e~~~~l~~a~~~~~~al~R~ESRG~H~R~D~p~~dd~~~~~~~~  567 (621)
T 2h88_A          488 ILQEGCEKLSQIYRDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKLRIDEFDYSKPL  567 (621)
T ss_dssp             HHHHHHHHHHHHHHGGGGEECCCCCSTTCHHHHHHHHHHHHHHHHHHHHHHHHHCCSCBTTBCBTTBCSCCCSSCTTSCC
T ss_pred             HHHHHHHHHHHHHHHHhhccccccccccchhHHHHHHHHHHHHHHHHHHHHHHhCcccccceecccCcccCccccccCCc
Confidence            9999999999999999999999888889999999999999999999999999999999999999999999999       


Q ss_pred             ----------cccceEEEEee--CCeeEEeeeeccccccC-CcccccCCCCCCC
Q 046556          593 ----------NWMKHTLGYWE--NEKVRLDYRPVHMNTLD-DEIESFPPKARVY  633 (633)
Q Consensus       593 ----------~~~~~~~~~~~--~g~~~~~~~~~~~~~~~-~~~~~~~~~~~~~  633 (633)
                                ||+||++++++  ++++++.++||...+++ .++..++|+.|.|
T Consensus       568 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~r~y  621 (621)
T 2h88_A          568 QGQQKRPFEEHWRKHTLSYVDVKSGKVTLKYRPVIDRTLNEEDCSSVPPAIRSY  621 (621)
T ss_dssp             TTCCCCCGGGCCCEEEEEEEETTTTEEEEEEEECCCCCSCTTTSCCCCCCCCCC
T ss_pred             ccccCCcchhccceeEEEEEcCCCCceEEEecccccccccccccceeCCcCCCC
Confidence                      99999998875  47899999999988876 3477899999998
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2lfc_A Fumarate reductase, flavoprotein subunit; structural genomics, northeast structural genomics consortiu PSI-biology; NMR {Lactobacillus plantarum} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 633
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 6e-79
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 1e-22
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 1e-61
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 5e-08
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 6e-58
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 9e-06
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 1e-52
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 2e-06
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 5e-48
d1neka3120 d.168.1.1 (A:236-355) Succinate dehydogenase {Esch 2e-46
d2bs2a1198 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella 1e-39
d1neka1138 a.7.3.1 (A:451-588) Succinate dehydogenase {Escher 2e-37
d2bs2a3121 d.168.1.1 (A:251-371) Fumarate reductase {Wolinell 3e-36
d1kf6a3132 d.168.1.1 (A:226-357) Fumarate reductase {Escheric 8e-36
d1kf6a1134 a.7.3.1 (A:443-576) Fumarate reductase {Escherichi 2e-35
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 6e-35
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 4e-11
d1chua3116 d.168.1.1 (A:238-353) L-aspartate oxidase {Escheri 9e-31
d1jnra1141 a.7.3.1 (A:503-643) Adenylylsulfate reductase A su 5e-28
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 1e-27
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 1e-14
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 5e-27
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 7e-17
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 3e-20
d1chua1111 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherich 2e-19
d1qo8a3146 d.168.1.1 (A:360-505) Flavocytochrome c3 (respirat 1e-13
d1d4ca3146 d.168.1.1 (A:360-505) Flavocytochrome c3 (respirat 8e-13
d1y0pa3143 d.168.1.1 (A:362-504) Flavocytochrome c3 (respirat 1e-12
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 2e-10
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 4e-08
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 5e-07
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 2e-06
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 2e-05
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 3e-05
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 4e-05
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 4e-05
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 6e-05
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 7e-05
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 9e-05
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 1e-04
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 1e-04
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 1e-04
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 2e-04
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-04
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 2e-04
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 4e-04
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 5e-04
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 7e-04
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 0.002
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 0.002
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 0.003
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 0.003
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain
domain: Succinate dehydogenase
species: Escherichia coli [TaxId: 562]

 Score =  251 bits (642), Expect = 6e-79
 Identities = 148/288 (51%), Positives = 191/288 (66%), Gaps = 5/288 (1%)

Query: 46  HTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDW 105
             +DAVV+GAGGAG+RAA+ +S+ G   A ++K+FPTRSHTV+AQGGI  ALGN  ED+W
Sbjct: 6   REFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNTHEDNW 65

Query: 106 RWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLD 165
            WHMYDTVKGSD++GDQDAI+YMC+  P+A++ELE+ GLPFSR +DG+IYQR FGGQS +
Sbjct: 66  EWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFGGQSKN 125

Query: 166 FGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALN 225
           F  G QA R A AADRTGHALLHTLY Q +K++T  F E++ALDL+ N DG   G  AL 
Sbjct: 126 F-GGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGCTALC 184

Query: 226 MEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFHPT 285
           +E G +  F+A +T+LATGG GR Y S T+AH  TGDG  M  RAG+P    + +   PT
Sbjct: 185 IETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVP--VQDMMGGIPT 242

Query: 286 GIYGAGCLLLKVGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSR 333
            + G    + + G          + GE         A  L    ++  
Sbjct: 243 KVTGQALTVNEKG-EDVVVPGLFAVGEIACVSVHG-ANRLGGNSLLDL 288
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1neka3 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d2bs2a1 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 198 Back     information, alignment and structure
>d1neka1 a.7.3.1 (A:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d2bs2a3 d.168.1.1 (A:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 121 Back     information, alignment and structure
>d1kf6a3 d.168.1.1 (A:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1kf6a1 a.7.3.1 (A:443-576) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 134 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1chua3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1jnra1 a.7.3.1 (A:503-643) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 141 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1chua1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 111 Back     information, alignment and structure
>d1qo8a3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 146 Back     information, alignment and structure
>d1d4ca3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 146 Back     information, alignment and structure
>d1y0pa3 d.168.1.1 (A:362-504) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 143 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query633
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 100.0
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 100.0
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 100.0
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 100.0
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 100.0
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 100.0
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 100.0
d2bs2a1198 Fumarate reductase {Wolinella succinogenes [TaxId: 100.0
d1kf6a1134 Fumarate reductase {Escherichia coli [TaxId: 562]} 100.0
d1neka1138 Succinate dehydogenase {Escherichia coli [TaxId: 5 100.0
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.97
d1jnra1141 Adenylylsulfate reductase A subunit {Archaeon Arch 99.96
d2bs2a3121 Fumarate reductase {Wolinella succinogenes [TaxId: 99.93
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.91
d1neka3120 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.91
d1chua1111 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.9
d1kf6a3132 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.89
d1chua3116 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.89
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.88
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.62
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.54
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.53
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.48
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.47
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.47
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.47
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.44
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.42
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.41
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.39
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.37
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.34
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.34
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.34
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.25
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.24
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.17
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.14
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.06
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 99.06
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 99.05
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 99.04
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 99.01
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.94
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.9
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.9
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.9
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.89
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.86
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.83
d1qo8a3146 Flavocytochrome c3 (respiratory fumarate reductase 98.82
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 98.82
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.79
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.77
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.75
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.74
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.72
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.69
d1d4ca3146 Flavocytochrome c3 (respiratory fumarate reductase 98.69
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.68
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.67
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.65
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.63
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.6
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.56
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.55
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.53
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.49
d1y0pa3143 Flavocytochrome c3 (respiratory fumarate reductase 98.48
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.47
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.47
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.43
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.43
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.42
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.42
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.4
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.31
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.29
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.29
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.28
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.23
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.22
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.21
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.18
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.17
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.05
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.04
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.95
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.89
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.86
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.83
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.82
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.75
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.7
d1jnra3145 Adenylylsulfate reductase A subunit {Archaeon Arch 97.68
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.68
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.61
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.55
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.48
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.27
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.11
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 96.94
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 96.93
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 96.84
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.56
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.96
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.88
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.84
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 95.76
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 95.54
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.21
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.97
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.95
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.63
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.63
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 94.27
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 94.21
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 94.2
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.15
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 93.84
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 93.59
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 92.83
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 92.69
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 91.96
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 91.77
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 91.4
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 90.89
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.98
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.44
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.28
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 89.27
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.2
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 89.02
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 88.86
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 88.65
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 88.07
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.88
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.49
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 87.38
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 86.21
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 85.7
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 85.37
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 85.07
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 84.88
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 84.59
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 84.18
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 83.78
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 83.51
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 83.11
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 82.59
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 82.31
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 81.58
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 81.56
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 81.42
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 81.23
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 81.0
d1id1a_153 Rck domain from putative potassium channel Kch {Es 80.98
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 80.97
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain
domain: Succinate dehydogenase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.4e-47  Score=396.83  Aligned_cols=302  Identities=60%  Similarity=0.977  Sum_probs=262.5

Q ss_pred             ccccccEEEECCchHHHHHHHHHHhCCCcEEEEeecCCCCCcccccccceeeecCCCCcCCHHHHHHHHHhcCCCCCCHH
Q 046556           44 VDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQD  123 (633)
Q Consensus        44 ~~~~~DVlIIGgG~AGl~AA~~aa~~G~~V~vlEk~~~~~g~t~~~~Gg~~~~~~~~~~d~~~~~~~d~~~~~~~~~~~~  123 (633)
                      ..++|||||||+|+|||+||++|+++|.+|+|+||....+|++.+++||+++......+|+++.|+.|+++.+.+++|++
T Consensus         4 ~~~~~DVlVVG~G~AGl~AAl~aa~~G~~V~lleK~~~~gg~s~~A~GGi~a~~~~~~~Ds~e~~~~Dtl~aG~~l~d~~   83 (330)
T d1neka2           4 PVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQD   83 (330)
T ss_dssp             CEEEESCEEECCSHHHHHHHHHHHHTTCCCEEECSSCGGGSGGGGCCSCEECCCCSSSCCCHHHHHHHHHHHHTSCSCHH
T ss_pred             CcccCCEEEECcCHHHHHHHHHHHHcCCeEEEEeCCCCCCCcHHHHhhhHheEcCCCCCCCHHHHHHHHHHhhhhccCHH
Confidence            34789999999999999999999999999999999988889999999999988877778999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCcccccCCCcccccccCCcccccCCCCccceeEEccCCchHHHHHHHHHHHHhCCCEEEE
Q 046556          124 AIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFV  203 (633)
Q Consensus       124 ~v~~~~~~~~~~~~~l~~~Gv~f~~~~~g~~~~~~~gg~~~~~~~g~~~~r~~~~~~~~g~~l~~~l~~~a~~~gv~i~~  203 (633)
                      +++.+++++++.++||+++|++|.+.++|.+....+++++.... +....+..+..+.+|..++..|.+++++.+++++.
T Consensus        84 ~v~~l~~~~~~~i~~L~~~Gv~f~~~~~g~~~~~~~g~~s~~~~-~~~~~~~~~~~d~~G~~i~~~L~~~~~~~~v~~~~  162 (330)
T d1neka2          84 AIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFGGQSKNFG-GEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFS  162 (330)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCCCCBCSCBTTBCCCSSBCEEECT-TSSSEEEECCTTCHHHHHHHHHHHHHHHTTCEEEC
T ss_pred             HHHHHHHHhHHHHHHHhhccccccccCCCceehhccCccccccc-CcccccccccCCccHHHHHHHHHHHHHhcCCeEEE
Confidence            99999999999999999999999999999888777777765432 33445677788999999999999999999999999


Q ss_pred             EEEEEEEEEccCCcEEEEEEEEcCCCeEEEEEcCeEEEccCCcCCCCCCCCCCCCCchHHHHHHHHcCCCccCccccccc
Q 046556          204 EYFALDLIMNSDGTCQGVIALNMEDGTLHRFRAASTILATGGYGRAYFSATSAHTCTGDGNAMVSRAGLPLEDLEFVQFH  283 (633)
Q Consensus       204 ~~~v~~L~~d~~g~v~Gv~~~~~~~G~~~~i~A~~VVlAtGg~~~~~~~~~~~~~~tGdg~~~a~~aGa~l~~~e~~~~~  283 (633)
                      ++.+++|+++++++++|+.+.+..+|+...|.|+.|||||||++++|..+++++.+||||+.||+++|+.+.||++.  +
T Consensus       163 ~~~~~~l~~~~~~~~~g~~~~~~~~g~~~~~~a~~vIlAtGG~~~ly~~ttn~~~~tGdG~~~a~~aGa~l~d~~~~--~  240 (330)
T d1neka2         163 EWYALDLVKNQDGAVVGCTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMMGG--I  240 (330)
T ss_dssp             SEEEEEEEECTTSCEEEEEEEETTTCCEEEEEESCEEECCCCCGGGSSSBSSCTTCSCHHHHHHHTTTCCEESECCB--E
T ss_pred             EEEEEEeeeeccccceeeeeEEccCCcEEEEeccEEEEcCCCccccccCcCCCCccEeHHHHHHHHcCCCccccccc--c
Confidence            99999999877889999999888899999999999999999999999999999999999999999999999998742  2


Q ss_pred             cccccCCcceeeeccccCCCcEEECCCCCccccccCCccccccchhHHhHHHHHHHHhcCCCCCCCCeEEEecCCCChhH
Q 046556          284 PTGIYGAGCLLLKVGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDV  363 (633)
Q Consensus       284 p~~~~~~~~~~~~~~~~g~g~~~vn~~G~rf~~~~~~~~~~l~~r~~~~~~i~~e~~~g~g~~~~~~~v~~d~~~~~~~~  363 (633)
                      |..+...             +..                                                         
T Consensus       241 ~~~~~~~-------------~~~---------------------------------------------------------  250 (330)
T d1neka2         241 PTKVTGQ-------------ALT---------------------------------------------------------  250 (330)
T ss_dssp             EBCTTCE-------------EEE---------------------------------------------------------
T ss_pred             ccccccc-------------eee---------------------------------------------------------
Confidence            2211000             000                                                         


Q ss_pred             HHHHhHHHHHHHHHHcCCCCCCCCeeccccccccccCcccCCCCceeeecCCCCCCcccCeeeecccccccccCCCCCCh
Q 046556          364 LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDEVVPGLMAAGEAACASVHGANRLGA  443 (633)
Q Consensus       364 l~~~~~~~~~~~~~~~G~d~~~~~i~v~p~~~~~~GGi~vd~~~~vl~~d~~~~~T~ipGLyAaGe~a~~g~~Ga~rlgg  443 (633)
                                                             ++..++         .+.+|||||+|||+|.++||+|||+|
T Consensus       251 ---------------------------------------~~~~g~---------~~v~~gl~a~Ge~a~~g~HganrL~~  282 (330)
T d1neka2         251 ---------------------------------------VNEKGE---------DVVVPGLFAVGEIACVSVHGANRLGG  282 (330)
T ss_dssp             ---------------------------------------ECSSSC---------EEEEEEEEECSSSEECSSSTTSCCTT
T ss_pred             ---------------------------------------cccCCC---------ceecccccccCccccccccccccccc
Confidence                                                   000111         14489999999999889999999999


Q ss_pred             hhHHHHHHHHHHHHHHHHHHhCC
Q 046556          444 NSLLDIVVFGRACANRVAEIQRP  466 (633)
Q Consensus       444 ~~l~~a~~~G~~Ag~~aa~~~~~  466 (633)
                      |+|.+|++||++||+.++++++.
T Consensus       283 nsl~~~~v~g~~ag~~~~~~~~~  305 (330)
T d1neka2         283 NSLLDLVVFGRAAGLHLQESIAE  305 (330)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccHHHHHHHHHHHHHHHHHHhhc
Confidence            99999999999999999988754
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a1 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1kf6a1 a.7.3.1 (A:443-576) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka1 a.7.3.1 (A:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jnra1 a.7.3.1 (A:503-643) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bs2a3 d.168.1.1 (A:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1neka3 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6a3 d.168.1.1 (A:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1qo8a3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1d4ca3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y0pa3 d.168.1.1 (A:362-504) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jnra3 d.168.1.1 (A:257-401) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure