Citrus Sinensis ID: 046701

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MTMNPLSIHGAAQLTITPYTNVFLFYKGRVYLPPRLEFGCFVTSAISVCTVFVLLPKNGPHKASSVGKPVRREMAIPDENGVDQKANVNGKMCIREGPMVQRINNPEANKTAFQFGWFLSGDLGYFDSQRCLNMWKISPTEVDAVKEFCKRNVASFKVPKKVFIADSLSGKPLTGKIQRRIVAELRK
cccccEEEEEcccccccccHHHHHHHHcccccccccccccccccccccccEEccccccccccccccccccccEEEEEccccccccccccccEEEEccccccccccHHHHHHHHHcccccccccEEEccccEEEEEEcccHHHHHHHHHHHHcccccccccEEEEEcccccccccccccHHHHHHHHc
cccccccEEEcccccccccccEEEEEEccccccHHHHccccEEEEEccccccccccccccccccccccccccEEEEEcccccEcccccEEEEEEEccccccccccHHHHHHHHHccccEcccccEEccccEEEEEEEcHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHcc
mtmnplsihgaaqltitpyTNVFLFYkgrvylpprlefgcfvtsaISVCTVFVllpkngphkassvgkpvrremaipdengvdqkanvngkmciregpmvqrinnpeanktAFQFGWflsgdlgyfdsqrclnmwkisptEVDAVKEFCKRnvasfkvpkkvfiadslsgkpltgKIQRRIVAELRK
MTMNPLSIHGAAQLTITPYTNVFLFYKGRVYLPPRLEFGCFVTSAISVCTVFvllpkngphkassvgkpvrremaipdengvdqkanvNGKMCIREGPMVQRINNPEANKTAFQFGWFLSGDLGYFDSQRCLNMWKISPTEVDAVKEFCKRnvasfkvpkkvfiadslsgkpltgkiqRRIVAELRK
MTMNPLSIHGAAQLTITPYTNVFLFYKGRVYLPPRLEFGCFVTSAISVCTVFVLLPKNGPHKASSVGKPVRREMAIPDENGVDQKANVNGKMCIREGPMVQRINNPEANKTAFQFGWFLSGDLGYFDSQRCLNMWKISPTEVDAVKEFCKRNVASFKVPKKVFIADSLSGKPLTGKIQRRIVAELRK
*******IHGAAQLTITPYTNVFLFYKGRVYLPPRLEFGCFVTSAISVCTVFVLLP***********************************MCIREGPMVQRINNPEANKTAFQFGWFLSGDLGYFDSQRCLNMWKISPTEVDAVKEFCKRNVASFKVPKKVFIADSLSGKPLT*************
***NPLSIHGAAQLTITPYTNVFLFYKGRVYLPPRLEFGCFVTSAISVCTVFVLLPKNGPHKASSVGKPVRREMAIPDENGVDQKANVNGKMCIREGPMVQRINNPEANKTAFQFGWFLSGDLGYFDSQRCLNMWKISPTEVDAVKEFCKRNVASFKVPKKVFIADSLSGKPLTGKIQRRIVAE***
MTMNPLSIHGAAQLTITPYTNVFLFYKGRVYLPPRLEFGCFVTSAISVCTVFVLLPKNG*********PVRREMAIPDENGVDQKANVNGKMCIREGPMVQRINNPEANKTAFQFGWFLSGDLGYFDSQRCLNMWKISPTEVDAVKEFCKRNVASFKVPKKVFIADSLSGKPLTGKIQRRIVAELRK
MTMNPLSIHGAAQLTITPYTNVFLFYKGRVYLPPRLEFGCFVTSAISVCTVFVLLPKNGPHKASSVGKPVRREMAIPDENGVDQKANVNGKMCIREGPMVQRINNPEANKTAFQFGWFLSGDLGYFDSQRCLNMWKISPTEVDAVKEFCKRNVASFKVPKKVFIADSLSGKPLTGKIQRRIVAEL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTMNPLSIHGAAQLTITPYTNVFLFYKGRVYLPPRLEFGCFVTSAISVCTVFVLLPKNGPHKASSVGKPVRREMAIPDENGVDQKANVNGKMCIREGPMVQRINNPEANKTAFQFGWFLSGDLGYFDSQRCLNMWKISPTEVDAVKEFCKRNVASFKVPKKVFIADSLSGKPLTGKIQRRIVAELRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query187 2.2.26 [Sep-21-2011]
Q9SMT7514 4-coumarate--CoA ligase-l yes no 0.791 0.287 0.419 7e-31
O74976512 Putative peroxisomal-coen yes no 0.652 0.238 0.288 1e-09
P38137543 Peroxisomal-coenzyme A sy yes no 0.668 0.230 0.296 2e-09
Q65FT5478 2-succinylbenzoate--CoA l yes no 0.625 0.244 0.269 2e-08
Q92AY8467 2-succinylbenzoate--CoA l yes no 0.673 0.269 0.255 2e-06
P58730467 2-succinylbenzoate--CoA l yes no 0.673 0.269 0.255 5e-06
O53306503 Long-chain-fatty-acid--Co yes no 0.695 0.258 0.231 9e-06
Q42982569 Probable 4-coumarate--CoA no no 0.545 0.179 0.336 9e-06
P23971486 2-succinylbenzoate--CoA l yes no 0.737 0.283 0.237 5e-05
Q71YZ5467 2-succinylbenzoate--CoA l yes no 0.673 0.269 0.244 6e-05
>sp|Q9SMT7|4CLLA_ARATH 4-coumarate--CoA ligase-like 10 OS=Arabidopsis thaliana GN=4CLL10 PE=2 SV=1 Back     alignment and function desciption
 Score =  133 bits (334), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 89/212 (41%), Positives = 111/212 (52%), Gaps = 64/212 (30%)

Query: 35  RLE--FGCFVTSAISVCTVFVL-----LPKNGPHKASSVGKPVRREMAIPDENGVDQKAN 87
           RLE  FG  V  A ++     L     LP+ GPHK  SVGKPV +EMAI +E G  Q+ N
Sbjct: 299 RLEEAFGAPVLEAYAMTEATHLMSSNPLPEEGPHKPGSVGKPVGQEMAILNEKGEIQEPN 358

Query: 88  VNGKMCIREGPMVQR--INNPEANKTAFQFGWFLSGDLGYFDSQRCLNM----------- 134
             G++CIR GP V +   NNPEANK  F+FGWF +GD+GYFD+   L++           
Sbjct: 359 NKGEVCIR-GPNVTKGYKNNPEANKAGFEFGWFHTGDIGYFDTDGYLHLVGRIKELINRG 417

Query: 135 -WKISPTEVDAV-----------------------------------------KEFCKRN 152
             KISP EVDAV                                         K FCK+N
Sbjct: 418 GEKISPIEVDAVLLTHPDVSQGVAFGVPDEKYGEEINCAVIPREGTTVTEEDIKAFCKKN 477

Query: 153 VASFKVPKKVFIADSLSGKPLTGKIQRRIVAE 184
           +A+FKVPK+VFI D+L  K  +GKIQRRIVA+
Sbjct: 478 LAAFKVPKRVFITDNLP-KTASGKIQRRIVAQ 508

Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: -
>sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 Back     alignment and function description
>sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 Back     alignment and function description
>sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=menE PE=3 SV=1 Back     alignment and function description
>sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 Back     alignment and function description
>sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 Back     alignment and function description
>sp|O53306|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis GN=fadD13 PE=1 SV=1 Back     alignment and function description
>sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 Back     alignment and function description
>sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=3 SV=2 Back     alignment and function description
>sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
302143864 523 unnamed protein product [Vitis vinifera] 0.791 0.282 0.466 2e-35
225470747 524 PREDICTED: putative peroxisomal-coenzyme 0.791 0.282 0.466 2e-35
255539437 521 AMP dependent CoA ligase, putative [Rici 0.791 0.284 0.457 5e-34
224137016 524 acyl:coa ligase [Populus trichocarpa] gi 0.684 0.244 0.470 7e-33
399630432 529 4-hydroxycinnamoyl-CoA ligase 2 [Coffea 0.791 0.279 0.452 3e-32
380042376 526 acyl-activating enzyme 8 [Cannabis sativ 0.791 0.281 0.448 1e-31
225426389 525 PREDICTED: putative peroxisomal-coenzyme 0.791 0.281 0.438 8e-31
255537431 522 AMP dependent CoA ligase, putative [Rici 0.796 0.285 0.431 8e-31
297819514 514 AMP-dependent synthetase and ligase fami 0.791 0.287 0.429 9e-30
449469351 518 PREDICTED: 4-coumarate--CoA ligase-like 0.684 0.247 0.437 9e-30
>gi|302143864|emb|CBI22725.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/212 (46%), Positives = 117/212 (55%), Gaps = 64/212 (30%)

Query: 35  RLE--FGCFVTSAISVCTVFVL-----LPKNGPHKASSVGKPVRREMAIPDENGVDQKAN 87
           RLE  FG  V  A ++     L     LP+NGPHK  SVG+PV +EMAI DENGV Q+AN
Sbjct: 298 RLEEAFGAPVLEAYAMTEATHLMASNPLPENGPHKPGSVGRPVGQEMAILDENGVQQEAN 357

Query: 88  VNGKMCIREGPMVQR--INNPEANKTAFQFGWFLSGDLGYFDSQRCLNM----------- 134
           V+G++CIR GP V +   NNPEANK+AFQFGWF +GDLG+FD    L++           
Sbjct: 358 VSGEVCIR-GPNVTKGYKNNPEANKSAFQFGWFHTGDLGFFDPDGYLHLVGRIKELINRG 416

Query: 135 -WKISPTEVDA-----------------------------------------VKEFCKRN 152
             KISP EVDA                                         V  FCK+N
Sbjct: 417 GEKISPIEVDAVLLSHPDIAQAVAFGVPDDKYGEEINCAIIPREGSDIDEAEVTRFCKKN 476

Query: 153 VASFKVPKKVFIADSLSGKPLTGKIQRRIVAE 184
           +A+FKVPKKVFI DSL  K  TGKIQRRIVAE
Sbjct: 477 LAAFKVPKKVFITDSLP-KTATGKIQRRIVAE 507

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225470747|ref|XP_002267459.1| PREDICTED: putative peroxisomal-coenzyme A synthetase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255539437|ref|XP_002510783.1| AMP dependent CoA ligase, putative [Ricinus communis] gi|223549898|gb|EEF51385.1| AMP dependent CoA ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224137016|ref|XP_002322473.1| acyl:coa ligase [Populus trichocarpa] gi|222869469|gb|EEF06600.1| acyl:coa ligase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|399630432|gb|AFP49809.1| 4-hydroxycinnamoyl-CoA ligase 2 [Coffea arabica] Back     alignment and taxonomy information
>gi|380042376|gb|AFD33352.1| acyl-activating enzyme 8 [Cannabis sativa] Back     alignment and taxonomy information
>gi|225426389|ref|XP_002272145.1| PREDICTED: putative peroxisomal-coenzyme A synthetase [Vitis vinifera] gi|297742535|emb|CBI34684.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537431|ref|XP_002509782.1| AMP dependent CoA ligase, putative [Ricinus communis] gi|223549681|gb|EEF51169.1| AMP dependent CoA ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297819514|ref|XP_002877640.1| AMP-dependent synthetase and ligase family protein [Arabidopsis lyrata subsp. lyrata] gi|297323478|gb|EFH53899.1| AMP-dependent synthetase and ligase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449469351|ref|XP_004152384.1| PREDICTED: 4-coumarate--CoA ligase-like 10-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
TAIR|locus:2101368514 AAE3 "ACYL-ACTIVATING ENZYME 3 0.481 0.175 0.523 9.2e-32
POMBASE|SPCC1827.03c512 SPCC1827.03c "acetyl-CoA ligas 0.449 0.164 0.37 3.5e-11
DICTYBASE|DDB_G0279561542 DDB_G0279561 "AMP-dependent sy 0.582 0.201 0.376 2.1e-10
SGD|S000000426543 PCS60 "Peroxisomal protein tha 0.192 0.066 0.567 1.6e-09
UNIPROTKB|O53306503 fadD13 "Long-chain-fatty-acid- 0.406 0.151 0.303 6.9e-08
UNIPROTKB|Q4K7V0562 fadD_3 "Long-chain-fatty-acid- 0.449 0.149 0.319 1.1e-07
UNIPROTKB|Q81RV9496 BAS1789 "Putative feruloyl-CoA 0.411 0.155 0.358 2.7e-07
TIGR_CMR|BA_1928496 BA_1928 "feruloyl-CoA syntheta 0.411 0.155 0.358 2.7e-07
UNIPROTKB|P08659550 P08659 "Luciferin 4-monooxygen 0.411 0.14 0.373 1.8e-05
TAIR|locus:2015499542 ACOS5 "acyl-CoA synthetase 5" 0.368 0.127 0.328 3.6e-05
TAIR|locus:2101368 AAE3 "ACYL-ACTIVATING ENZYME 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 240 (89.5 bits), Expect = 9.2e-32, Sum P(2) = 9.2e-32
 Identities = 55/105 (52%), Positives = 68/105 (64%)

Query:    55 LPKNGPHKASSVGKPVRREMAIPDENGVDQKANVNGKMCIREGPMVQR--INNPEANKTA 112
             LP+ GPHK  SVGKPV +EMAI +E G  Q+ N  G++CIR GP V +   NNPEANK  
Sbjct:   326 LPEEGPHKPGSVGKPVGQEMAILNEKGEIQEPNNKGEVCIR-GPNVTKGYKNNPEANKAG 384

Query:   113 FQFGWFLSGDLGYFDSQRCLNMW------------KISPTEVDAV 145
             F+FGWF +GD+GYFD+   L++             KISP EVDAV
Sbjct:   385 FEFGWFHTGDIGYFDTDGYLHLVGRIKELINRGGEKISPIEVDAV 429
GO:0005739 "mitochondrion" evidence=ISM
GO:0016208 "AMP binding" evidence=ISS
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0009507 "chloroplast" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0010030 "positive regulation of seed germination" evidence=IMP
GO:0010214 "seed coat development" evidence=IMP
GO:0033611 "oxalate catabolic process" evidence=IDA
GO:0050203 "oxalate-CoA ligase activity" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IMP
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
GO:0046482 "para-aminobenzoic acid metabolic process" evidence=RCA
POMBASE|SPCC1827.03c SPCC1827.03c "acetyl-CoA ligase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279561 DDB_G0279561 "AMP-dependent synthetase and ligase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000000426 PCS60 "Peroxisomal protein that binds AMP and mRNA" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|O53306 fadD13 "Long-chain-fatty-acid--CoA ligase FadD13" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q4K7V0 fadD_3 "Long-chain-fatty-acid--CoA ligase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q81RV9 BAS1789 "Putative feruloyl-CoA synthetase" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1928 BA_1928 "feruloyl-CoA synthetase, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P08659 P08659 "Luciferin 4-monooxygenase" [Photinus pyralis (taxid:7054)] Back     alignment and assigned GO terms
TAIR|locus:2015499 ACOS5 "acyl-CoA synthetase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00009148001
SubName- Full=Chromosome undetermined scaffold_222, whole genome shotgun sequence; (523 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
cd05926345 cd05926, FACL_fum10p_like, Subfamily of fatty acid 8e-30
cd05929342 cd05929, BACL_like, Bacterial Bile acid CoA ligase 4e-19
cd05917347 cd05917, FACL_like_2, Uncharacterized subfamily of 5e-18
PRK03640483 PRK03640, PRK03640, O-succinylbenzoic acid--CoA li 3e-17
cd05936468 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain 5e-16
cd04433338 cd04433, AFD_class_I, Adenylate forming domain, Cl 9e-15
COG0318534 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ 9e-15
PRK07470528 PRK07470, PRK07470, acyl-CoA synthetase; Validated 3e-13
cd05934421 cd05934, FACL_DitJ_like, Uncharacterized subfamily 4e-13
PRK06145497 PRK06145, PRK06145, acyl-CoA synthetase; Validated 1e-12
cd05912407 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase 2e-12
cd05911487 cd05911, Firefly_Luc_like, Firefly luciferase of l 3e-11
pfam00501412 pfam00501, AMP-binding, AMP-binding enzyme 1e-10
PRK06839496 PRK06839, PRK06839, acyl-CoA synthetase; Validated 1e-10
PRK08316523 PRK08316, PRK08316, acyl-CoA synthetase; Validated 2e-10
cd05971439 cd05971, MACS_like_3, Uncharacterized subfamily of 6e-10
cd05959506 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 1e-09
cd05941430 cd05941, MCS, Malonyl-CoA synthetase (MCS) 2e-09
cd05903437 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li 4e-09
PRK06187521 PRK06187, PRK06187, long-chain-fatty-acid--CoA lig 7e-09
cd05904504 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) 9e-09
PRK05605573 PRK05605, PRK05605, long-chain-fatty-acid--CoA lig 9e-09
PRK08008517 PRK08008, caiC, putative crotonobetaine/carnitine- 7e-08
cd05920483 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l 1e-07
TIGR01923436 TIGR01923, menE, O-succinylbenzoate-CoA ligase 5e-07
PRK12492562 PRK12492, PRK12492, long-chain-fatty-acid--CoA lig 6e-07
cd05922350 cd05922, FACL_like_6, Uncharacterized subfamily of 7e-07
cd05972430 cd05972, MACS_like, Medium-chain acyl-CoA syntheta 7e-07
PRK08316523 PRK08316, PRK08316, acyl-CoA synthetase; Validated 2e-06
PRK07786542 PRK07786, PRK07786, long-chain-fatty-acid--CoA lig 2e-06
PRK08974560 PRK08974, PRK08974, long-chain-fatty-acid--CoA lig 3e-06
PRK06178567 PRK06178, PRK06178, acyl-CoA synthetase; Validated 3e-06
PLN02246537 PLN02246, PLN02246, 4-coumarate--CoA ligase 3e-06
cd05919436 cd05919, BCL_like, Benzoate CoA ligase (BCL) and s 4e-06
cd05969443 cd05969, MACS_like_4, Uncharacterized subfamily of 7e-06
cd05906560 cd05906, A_NRPS_TubE_like, The adenylation domain 2e-05
cd05932504 cd05932, LC_FACS_bac, Bacterial long-chain fatty a 2e-05
cd05935430 cd05935, LC_FACS_like, Putative long-chain fatty a 3e-05
COG0365528 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat 4e-05
PRK04319570 PRK04319, PRK04319, acetyl-CoA synthetase; Provisi 4e-05
COG1022613 COG1022, FAA1, Long-chain acyl-CoA synthetases (AM 8e-05
PRK08315559 PRK08315, PRK08315, AMP-binding domain protein; Va 1e-04
PRK08314546 PRK08314, PRK08314, long-chain-fatty-acid--CoA lig 1e-04
cd05907456 cd05907, VL_LC_FACS_like, Long-chain fatty acid Co 1e-04
PRK13391511 PRK13391, PRK13391, acyl-CoA synthetase; Provision 1e-04
PRK12583558 PRK12583, PRK12583, acyl-CoA synthetase; Provision 2e-04
cd05945447 cd05945, DltA, D-alanine:D-alanyl carrier protein 2e-04
PLN02479567 PLN02479, PLN02479, acetate-CoA ligase 3e-04
PRK08276502 PRK08276, PRK08276, long-chain-fatty-acid--CoA lig 3e-04
cd05910455 cd05910, FACL_like_1, Uncharacterized subfamily of 3e-04
PRK07059557 PRK07059, PRK07059, Long-chain-fatty-acid--CoA lig 4e-04
PLN02330546 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 6e-04
cd05944359 cd05944, FACL_like_4, Uncharacterized subfamily of 6e-04
PRK05852534 PRK05852, PRK05852, acyl-CoA synthetase; Validated 0.001
PRK07788549 PRK07788, PRK07788, acyl-CoA synthetase; Validated 0.001
PRK05677562 PRK05677, PRK05677, long-chain-fatty-acid--CoA lig 0.001
cd05908499 cd05908, A_NRPS_MycA_like, The adenylation domain 0.002
cd12118520 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt 0.002
PRK06188524 PRK06188, PRK06188, acyl-CoA synthetase; Validated 0.002
PRK07638487 PRK07638, PRK07638, acyl-CoA synthetase; Validated 0.003
PRK07656513 PRK07656, PRK07656, long-chain-fatty-acid--CoA lig 0.003
PRK09192579 PRK09192, PRK09192, acyl-CoA synthetase; Validated 0.003
>gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis Back     alignment and domain information 
 Score =  111 bits (280), Expect = 8e-30
 Identities = 74/220 (33%), Positives = 95/220 (43%), Gaps = 71/220 (32%)

Query: 32  LPP----RLE--FGCFV------TSAISVCTVFVLLPKNGPHKASSVGKPVRREMAIPDE 79
           LPP    RLE  FG  V      T A        L P     K  SVG+P   E+AI D+
Sbjct: 130 LPPAVLDRLEKRFGVPVLEAYGMTEAAHQIASNPLPP--LVRKPGSVGRPAGVEVAILDD 187

Query: 80  NGVDQKANVNGKMCIREGPMVQR--INNPEANKTAFQFGWFLSGDLGYFDSQRCLNMW-- 135
           +G        G++ IR GP V    +NNPEAN+ AF+ GWF +GDLGY D    L +   
Sbjct: 188 DGRPLPPGQEGEIVIR-GPNVTAGYLNNPEANREAFRDGWFRTGDLGYLDEDGYLFLTGR 246

Query: 136 ----------KISPTEVDAV---------------------------------------- 145
                     KISP EV+ V                                        
Sbjct: 247 IKELINRGGEKISPREVEEVLLRHPAVAEAVVFGVPDELYGEEVAAAVVLRADSKVTIEE 306

Query: 146 -KEFCKRNVASFKVPKKVFIADSLSGKPLTGKIQRRIVAE 184
            ++F ++ +A+FKVPKK+   D+L  K  TGKIQRR +AE
Sbjct: 307 LRDFARKRLAAFKVPKKILFVDALP-KGATGKIQRRKLAE 345

FACL catalyzes the formation of fatty acyl-CoA in a two-step reaction: the formation of a fatty acyl-AMP molecule as an intermediate, followed by the formation of a fatty acyl-CoA. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions. Fum10p is a fatty acid CoA ligase involved in the synthesis of fumonisin, a polyketide mycotoxin, in Gibberella moniliformis. Length = 345
>gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins Back     alignment and domain information
>gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD Back     alignment and domain information
>gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I Back     alignment and domain information
>gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|180988 PRK07470, PRK07470, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) Back     alignment and domain information
>gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
>gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme Back     alignment and domain information
>gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213318 cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|213312 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase) Back     alignment and domain information
>gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) Back     alignment and domain information
>gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) Back     alignment and domain information
>gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
>gnl|CDD|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|181195 PRK08008, caiC, putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase Back     alignment and domain information
>gnl|CDD|171539 PRK12492, PRK12492, long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236359 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase Back     alignment and domain information
>gnl|CDD|213286 cd05919, BCL_like, Benzoate CoA ligase (BCL) and similar adenylate forming enzymes Back     alignment and domain information
>gnl|CDD|213316 cd05969, MACS_like_4, Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS) Back     alignment and domain information
>gnl|CDD|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents Back     alignment and domain information
>gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase Back     alignment and domain information
>gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase Back     alignment and domain information
>gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|235279 PRK04319, PRK04319, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases Back     alignment and domain information
>gnl|CDD|184022 PRK13391, PRK13391, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) Back     alignment and domain information
>gnl|CDD|178097 PLN02479, PLN02479, acetate-CoA ligase Back     alignment and domain information
>gnl|CDD|236215 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213278 cd05910, FACL_like_1, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|235923 PRK07059, PRK07059, Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|215189 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>gnl|CDD|213309 cd05944, FACL_like_4, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236097 PRK07788, PRK07788, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|168170 PRK05677, PRK05677, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213276 cd05908, A_NRPS_MycA_like, The adenylation domain of nonribosomal peptide synthetases (NRPS) similar to mycosubtilin synthase subunit A (MycA) Back     alignment and domain information
>gnl|CDD|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis Back     alignment and domain information
>gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236071 PRK07638, PRK07638, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 187
KOG1176537 consensus Acyl-CoA synthetase [Lipid transport and 100.0
COG0365528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 100.0
COG0318534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 100.0
PTZ00237647 acetyl-CoA synthetase; Provisional 99.98
KOG1177596 consensus Long chain fatty acid acyl-CoA ligase [L 99.97
PLN02654666 acetate-CoA ligase 99.97
COG1021542 EntE Peptide arylation enzymes [Secondary metaboli 99.97
PRK04319570 acetyl-CoA synthetase; Provisional 99.97
PRK07788549 acyl-CoA synthetase; Validated 99.97
PRK06334539 long chain fatty acid--[acyl-carrier-protein] liga 99.97
PLN02574560 4-coumarate--CoA ligase-like 99.97
PRK07529632 AMP-binding domain protein; Validated 99.97
PRK05677562 long-chain-fatty-acid--CoA ligase; Validated 99.97
TIGR02188625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 99.97
PRK07638487 acyl-CoA synthetase; Validated 99.97
PRK05852534 acyl-CoA synthetase; Validated 99.97
PRK00174637 acetyl-CoA synthetase; Provisional 99.97
TIGR02316628 propion_prpE propionate--CoA ligase. This family c 99.97
PRK06839496 acyl-CoA synthetase; Validated 99.97
PRK06060 705 acyl-CoA synthetase; Validated 99.97
PRK09088488 acyl-CoA synthetase; Validated 99.96
PRK086331146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.96
PRK12492562 long-chain-fatty-acid--CoA ligase; Provisional 99.96
PRK07470528 acyl-CoA synthetase; Validated 99.96
PRK05857540 acyl-CoA synthetase; Validated 99.96
PRK10524629 prpE propionyl-CoA synthetase; Provisional 99.96
PRK03640483 O-succinylbenzoic acid--CoA ligase; Provisional 99.96
PRK06145497 acyl-CoA synthetase; Validated 99.96
PRK10946536 entE enterobactin synthase subunit E; Provisional 99.96
PLN03051499 acyl-activating enzyme; Provisional 99.96
TIGR01217652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 99.96
PRK03584655 acetoacetyl-CoA synthetase; Provisional 99.96
PRK08043718 bifunctional acyl-[acyl carrier protein] synthetas 99.96
PLN02246537 4-coumarate--CoA ligase 99.96
PRK13295547 cyclohexanecarboxylate-CoA ligase; Reviewed 99.96
PRK13382537 acyl-CoA synthetase; Provisional 99.96
TIGR02275527 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot 99.96
PRK07787471 acyl-CoA synthetase; Validated 99.96
PRK08751560 putative long-chain fatty acyl CoA ligase; Provisi 99.96
PRK13390501 acyl-CoA synthetase; Provisional 99.96
PRK08314546 long-chain-fatty-acid--CoA ligase; Validated 99.96
PRK08316523 acyl-CoA synthetase; Validated 99.96
PRK09274552 peptide synthase; Provisional 99.96
PLN02860563 o-succinylbenzoate-CoA ligase 99.96
PRK06188524 acyl-CoA synthetase; Validated 99.96
PRK07059557 Long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK07786542 long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK05605573 long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK06155542 crotonobetaine/carnitine-CoA ligase; Provisional 99.95
PLN02330546 4-coumarate--CoA ligase-like 1 99.95
PRK07514504 malonyl-CoA synthase; Validated 99.95
PRK12406509 long-chain-fatty-acid--CoA ligase; Provisional 99.95
KOG1175626 consensus Acyl-CoA synthetase [Lipid transport and 99.95
PRK07656513 long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK07445452 O-succinylbenzoic acid--CoA ligase; Reviewed 99.95
PRK06710563 long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK08974560 long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK08315559 AMP-binding domain protein; Validated 99.95
PRK12583558 acyl-CoA synthetase; Provisional 99.95
PLN02736651 long-chain acyl-CoA synthetase 99.95
TIGR03208538 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. 99.95
PRK13383516 acyl-CoA synthetase; Provisional 99.95
PRK08276502 long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK07008539 long-chain-fatty-acid--CoA ligase; Validated 99.95
TIGR03098515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 99.95
PRK05851525 long-chain-fatty-acid--[acyl-carrier-protein] liga 99.95
PRK06087547 short chain acyl-CoA synthetase; Reviewed 99.95
PRK06187521 long-chain-fatty-acid--CoA ligase; Validated 99.95
PLN02614666 long-chain acyl-CoA synthetase 99.95
TIGR01734502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 99.95
PRK13391511 acyl-CoA synthetase; Provisional 99.95
TIGR02262508 benz_CoA_lig benzoate-CoA ligase family. Character 99.95
TIGR03205541 pimA dicarboxylate--CoA ligase PimA. PimA, a membe 99.94
PRK12476612 putative fatty-acid--CoA ligase; Provisional 99.94
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.94
PRK07867529 acyl-CoA synthetase; Validated 99.94
PRK07769631 long-chain-fatty-acid--CoA ligase; Validated 99.94
PRK12316 5163 peptide synthase; Provisional 99.94
PRK05620576 long-chain-fatty-acid--CoA ligase; Validated 99.94
PRK12467 3956 peptide synthase; Provisional 99.94
PRK09029458 O-succinylbenzoic acid--CoA ligase; Provisional 99.94
PRK12316 5163 peptide synthase; Provisional 99.94
PRK05691 4334 peptide synthase; Validated 99.94
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 99.94
PRK04813503 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.94
PLN03102579 acyl-activating enzyme; Provisional 99.94
PRK08008517 caiC putative crotonobetaine/carnitine-CoA ligase; 99.94
PRK068141140 acylglycerophosphoethanolamine acyltransferase; Pr 99.93
PLN02861660 long-chain-fatty-acid-CoA ligase 99.93
PLN02387696 long-chain-fatty-acid-CoA ligase family protein 99.93
PRK06018542 putative acyl-CoA synthetase; Provisional 99.93
PRK06178567 acyl-CoA synthetase; Validated 99.93
PRK06164540 acyl-CoA synthetase; Validated 99.93
PRK05691 4334 peptide synthase; Validated 99.93
KOG1256691 consensus Long-chain acyl-CoA synthetases (AMP-for 99.93
PRK12467 3956 peptide synthase; Provisional 99.93
PRK13388540 acyl-CoA synthetase; Provisional 99.93
PLN03052728 acetate--CoA ligase; Provisional 99.93
PRK07824358 O-succinylbenzoic acid--CoA ligase; Provisional 99.93
PRK07798533 acyl-CoA synthetase; Validated 99.93
PLN02479567 acetate-CoA ligase 99.92
PTZ00216700 acyl-CoA synthetase; Provisional 99.92
PRK07868994 acyl-CoA synthetase; Validated 99.92
TIGR01923436 menE O-succinylbenzoate-CoA ligase. This model rep 99.92
PLN02430660 long-chain-fatty-acid-CoA ligase 99.92
PTZ00342746 acyl-CoA synthetase; Provisional 99.92
PRK07768545 long-chain-fatty-acid--CoA ligase; Validated 99.91
COG1022613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 99.91
PRK09192579 acyl-CoA synthetase; Validated 99.91
PRK08162545 acyl-CoA synthetase; Validated 99.91
PRK05850578 acyl-CoA synthetase; Validated 99.9
PRK08279600 long-chain-acyl-CoA synthetase; Validated 99.89
PRK08180614 feruloyl-CoA synthase; Reviewed 99.89
KOG1180678 consensus Acyl-CoA synthetase [Lipid transport and 99.89
PRK12582624 acyl-CoA synthetase; Provisional 99.88
PRK08308414 acyl-CoA synthetase; Validated 99.87
PF00501417 AMP-binding: AMP-binding enzyme; InterPro: IPR0008 99.83
TIGR01733408 AA-adenyl-dom amino acid adenylation domain. This 99.81
TIGR02155422 PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet 99.68
PRK09188365 serine/threonine protein kinase; Provisional 99.63
TIGR02372386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 99.62
KOG1179649 consensus Very long-chain acyl-CoA synthetase/fatt 99.57
COG1020642 EntF Non-ribosomal peptide synthetase modules and 99.19
TIGR03335445 F390_ftsA coenzyme F390 synthetase. This enzyme, c 98.95
PTZ00297 1452 pantothenate kinase; Provisional 98.87
COG1541438 PaaK Coenzyme F390 synthetase [Coenzyme metabolism 98.85
KOG1178 1032 consensus Non-ribosomal peptide synthetase/alpha-a 98.73
KOG36281363 consensus Predicted AMP-binding protein [General f 97.71
PF1319373 AMP-binding_C: AMP-binding enzyme C-terminal domai 97.38
TIGR02304430 aden_form_hyp probable adenylate-forming enzyme. M 96.91
KOG3628 1363 consensus Predicted AMP-binding protein [General f 96.68
PF04443365 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR 91.87
PF1453596 AMP-binding_C_2: AMP-binding enzyme C-terminal dom 86.73
>KOG1176 consensus Acyl-CoA synthetase [Lipid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-38  Score=269.32  Aligned_cols=183  Identities=31%  Similarity=0.518  Sum_probs=160.4

Q ss_pred             cccchHhhhhh---cCCCCCCceeEEEEecCCCCCCce------eC-CeEEceecCceeec---cCCCCCCCCCCCcccc
Q 046701            3 MNPLSIHGAAQ---LTITPYTNVFLFYKGRVYLPPRLE------FG-CFVTSAISVCTVFV---LLPKNGPHKASSVGKP   69 (187)
Q Consensus         3 ~~~~~~~~~~~---~~~~~~~~lr~i~~~G~~l~~~~~------~~-~~i~~~YG~~~~~~---~~~~~~~~~~~~~G~~   69 (187)
                      ++|..+..+..   ....+++|+|.+.+||+++++++.      ++ ..+.++|||+++..   ........+.+++|++
T Consensus       279 ~vP~~~~~l~~~p~~~~~~l~sl~~v~~gga~~~~~~~~~~~~~l~~~~v~q~YGmTE~~~~~~~~~~~~e~k~~svG~~  358 (537)
T KOG1176|consen  279 LVPPVLNMLAKSPIVKKYDLSSLRSVLSGGAPLSPATLEKVKERLPNVTVIQGYGMTEAGGLITSNDWGPERKPGSVGRL  358 (537)
T ss_pred             cChHHHHHHhcCCccCcccCCccEEEEecCCCCCHHHHHHHHHhCCCceEEEeeccccccCceeecCCCccCcccccCcc
Confidence            45555555443   345789999999999999998888      66 78999999944331   1111111479999999


Q ss_pred             c-ceeEEEeCCCCCcCCCCCceeEEEEeCCCee--eecChhhhhhcccc-CeeeeCceEEEeCCCeEEE-----------
Q 046701           70 V-RREMAIPDENGVDQKANVNGKMCIREGPMVQ--RINNPEANKTAFQF-GWFLSGDLGYFDSQRCLNM-----------  134 (187)
Q Consensus        70 ~-~~~v~i~~~~g~~~~~g~~Gel~v~~~~~~~--y~~~~~~~~~~~~~-g~~~TgD~~~~d~~g~l~~-----------  134 (187)
                      + +.++++.+++|..+++++.||||++ |+.++  ||+|+++|+..|++ |||+|||+|++|+||+|+|           
T Consensus       359 ~~g~~~~v~~e~g~~l~~~~~GEI~vr-g~~imkGY~~NpeaT~~~~~~~GW~~TGDiGy~D~DG~l~IvdR~KdlIk~~  437 (537)
T KOG1176|consen  359 LPGVRVKVLDETGVSLGPNQTGEICVR-GPQVMKGYLKNPEATKEAFDDDGWFHTGDLGYFDEDGYLYIVDRSKDLIKYG  437 (537)
T ss_pred             ccceEEEeeCCCCCCCCCCCceEEEEE-CcccchhhcCChHHHHhhcccCCccccCceEEEcCCCeEEEecchhhheeeC
Confidence            9 9999999999999999999999999 99999  99999999999987 9999999999999999999           


Q ss_pred             -EEeCcccHHHH-----------------------------------------HHHHHhcCcCCCCccEEEEecCCCCCC
Q 046701          135 -WKISPTEVDAV-----------------------------------------KEFCKRNVASFKVPKKVFIADSLSGKP  172 (187)
Q Consensus       135 -~~i~~~eiE~~-----------------------------------------~~~~~~~l~~~~~P~~i~~v~~lP~~t  172 (187)
                       ++|+|.|||++                                         +++|+.++++|++|+.++|+++|| ||
T Consensus       438 G~qv~P~EiE~vL~~hP~V~eaaVvgipDe~~Ge~p~A~VV~k~g~~lte~di~~~v~k~l~~y~~~~~V~Fvd~lP-Ks  516 (537)
T KOG1176|consen  438 GEQVSPAEIEAVLLTHPDVLEAAVVGIPDEVWGETPAAFVVLKKGSTLTEKDIIEYVRKKLPAYKLPGGVVFVDELP-KT  516 (537)
T ss_pred             CEEeCHHHHHHHHHhCCCccEEEEEcccccccCCcceEEEEecCCCcCCHHHHHHHHHhhCChhhccCeEEEeccCC-CC
Confidence             89999999999                                         889999999999999999999999 99


Q ss_pred             CCCcccHHHHHhhhC
Q 046701          173 LTGKIQRRIVAELRK  187 (187)
Q Consensus       173 ~~GKi~r~~l~~~~~  187 (187)
                      ++|||+|+.|++.+.
T Consensus       517 ~~GKi~R~~lr~~~~  531 (537)
T KOG1176|consen  517 PNGKILRRKLRDIAK  531 (537)
T ss_pred             CcchHHHHHHHHHHH
Confidence            999999999999863

>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>KOG1177 consensus Long chain fatty acid acyl-CoA ligase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02654 acetate-CoA ligase Back     alignment and domain information
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>KOG1175 consensus Acyl-CoA synthetase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07656 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>PRK06710 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08974 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>PRK13383 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02262 benz_CoA_lig benzoate-CoA ligase family Back     alignment and domain information
>TIGR03205 pimA dicarboxylate--CoA ligase PimA Back     alignment and domain information
>PRK12476 putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07769 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>KOG1256 consensus Long-chain acyl-CoA synthetases (AMP-forming) [Lipid transport and metabolism] Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR01923 menE O-succinylbenzoate-CoA ligase Back     alignment and domain information
>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07768 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>PRK09192 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>KOG1180 consensus Acyl-CoA synthetase [Lipid transport and metabolism] Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08308 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] Back     alignment and domain information
>TIGR01733 AA-adenyl-dom amino acid adenylation domain Back     alignment and domain information
>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>KOG1179 consensus Very long-chain acyl-CoA synthetase/fatty acid transporter [Lipid transport and metabolism] Back     alignment and domain information
>COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03335 F390_ftsA coenzyme F390 synthetase Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] Back     alignment and domain information
>KOG1178 consensus Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG3628 consensus Predicted AMP-binding protein [General function prediction only] Back     alignment and domain information
>PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B Back     alignment and domain information
>TIGR02304 aden_form_hyp probable adenylate-forming enzyme Back     alignment and domain information
>KOG3628 consensus Predicted AMP-binding protein [General function prediction only] Back     alignment and domain information
>PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria Back     alignment and domain information
>PF14535 AMP-binding_C_2: AMP-binding enzyme C-terminal domain; PDB: 2Y27_A 2Y4N_A 3QOV_B 3S89_D 3LAX_A 2Y4O_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
3r44_A517 Mycobacterium Tuberculosis Fatty Acyl Coa Synthetas 8e-07
4g36_A555 Photinus Pyralis Luciferase In The Adenylate-Formin 6e-06
3iep_A551 Firefly Luciferase Apo Structure (P41 Form) Length 6e-06
1ba3_A550 Firefly Luciferase In Complex With Bromoform Length 7e-06
2d1q_A548 Crystal Structure Of The Thermostable Japanese Fire 2e-05
2d1s_A548 Crystal Structure Of The Thermostable Japanese Fire 2e-05
2d1t_A548 Crystal Structure Of The Thermostable Japanese Fire 2e-05
3t5b_A396 Crystal Structure Of N-Terminal Domain Of Facl13 Fr 4e-05
4g37_A555 Structure Of Cross-Linked Firefly Luciferase In Sec 2e-04
3qya_A582 Crystal Structure Of A Red-Emitter Mutant Of Lampyr 2e-04
>pdb|3R44|A Chain A, Mycobacterium Tuberculosis Fatty Acyl Coa Synthetase Length = 517 Back     alignment and structure 
Iteration: 1

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 56/186 (30%)
Query: 53  VLLPKNGPHKASSVGKPVR-REMAIPDENGVDQKANVNGKMCIREGPMVQRI-NNPEANK 110
           +LL ++   KA S G+     ++A+  ++GV ++    G++ I+   +++   N PEA +
Sbjct: 326 LLLSEDALRKAGSAGRATMFTDVAVRGDDGVIREHG-EGEVVIKSDILLKEYWNRPEATR 384
Query: 111 TAFQFGWFLSGDLGYFDSQRCLNM------------WKISPTEVDAV------------- 145
            AF  GWF +GD+G  D +  L +              + P E+++V             
Sbjct: 385 DAFDNGWFRTGDIGEIDDEGYLYIKDRLKDMIISGGENVYPAEIESVIIGVPGVSEVAVI 444
Query: 146 ---------------------------KEFCKRNVASFKVPKKVFIADSLSGKPLTGKIQ 178
                                       E+C   +A +K+PKKV  A+++   P TGKI 
Sbjct: 445 GLPDEKWGEIAAAIVVADQNEVSEQQIVEYCGTRLARYKLPKKVIFAEAIPRNP-TGKIL 503
Query: 179 RRIVAE 184
           + ++ E
Sbjct: 504 KTVLRE 509
>pdb|4G36|A Chain A, Photinus Pyralis Luciferase In The Adenylate-Forming Conformation Bound To Dlsa Length = 555 Back     alignment and structure
>pdb|3IEP|A Chain A, Firefly Luciferase Apo Structure (P41 Form) Length = 551 Back     alignment and structure
>pdb|1BA3|A Chain A, Firefly Luciferase In Complex With Bromoform Length = 550 Back     alignment and structure
>pdb|2D1Q|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With Mgatp Length = 548 Back     alignment and structure
>pdb|2D1S|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|2D1T|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Red-Color Emission S286n Mutant Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|3T5B|A Chain A, Crystal Structure Of N-Terminal Domain Of Facl13 From Mycobacterium Tuberculosis Length = 396 Back     alignment and structure
>pdb|4G37|A Chain A, Structure Of Cross-Linked Firefly Luciferase In Second Catalytic Conformation Length = 555 Back     alignment and structure
>pdb|3QYA|A Chain A, Crystal Structure Of A Red-Emitter Mutant Of Lampyris Turkestanicus Luciferase Length = 582 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 2e-23
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 4e-21
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 4e-20
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 1e-19
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 3e-19
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 4e-19
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 5e-19
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 2e-18
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 3e-18
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 3e-18
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 1e-17
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 2e-16
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 1e-15
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 7e-14
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 1e-13
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 2e-13
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 2e-11
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 1e-06
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 2e-06
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 7e-05
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 5e-04
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Length = 517 Back     alignment and structure
 Score = 94.9 bits (237), Expect = 2e-23
 Identities = 44/198 (22%), Positives = 77/198 (38%), Gaps = 71/198 (35%)

Query: 50  TVFVLLPKNGPHKASSVGKPVRR-EMAIPDENGVDQKANVNGKMCIREGPMVQR--INNP 106
              +LL ++   KA S G+     ++A+  ++GV ++    G++ I+   ++ +   N P
Sbjct: 323 GGTLLLSEDALRKAGSAGRATMFTDVAVRGDDGVIREHGE-GEVVIK-SDILLKEYWNRP 380

Query: 107 EANKTAFQFGWFLSGDLGYFDSQRCL---------------NMWKISPTEV--------- 142
           EA + AF  GWF +GD+G  D +  L               N   + P E+         
Sbjct: 381 EATRDAFDNGWFRTGDIGEIDDEGYLYIKDRLKDMIISGGEN---VYPAEIESVIIGVPG 437

Query: 143 -------------------------------DAVKEFCKRNVASFKVPKKVFIADSLSGK 171
                                            + E+C   +A +K+PKKV  A+++   
Sbjct: 438 VSEVAVIGLPDEKWGEIAAAIVVADQNEVSEQQIVEYCGTRLARYKLPKKVIFAEAI--- 494

Query: 172 PL--TGKIQRRIVAELRK 187
           P   TGKI +     LR+
Sbjct: 495 PRNPTGKILKT---VLRE 509
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} Length = 509 Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 501 Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Length = 505 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Length = 617 Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Length = 529 Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* Length = 503 Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Length = 504 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} PDB: 1ba3_A 1lci_A* 3ies_A* 3iep_A* 3ier_A* 3qya_A Length = 550 Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Length = 541 Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Length = 480 Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Length = 590 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 100.0
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 100.0
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 100.0
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 100.0
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 100.0
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 100.0
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 100.0
4dg8_A 620 PA1221; ANL superfamily, adenylation domain, pepti 100.0
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 100.0
1pg4_A652 Acetyl-COA synthetase; AMP-forming, adenylate-form 100.0
4gr5_A570 Non-ribosomal peptide synthetase; MBTH-like domain 100.0
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 100.0
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 100.0
1amu_A563 GRSA, gramicidin synthetase 1; peptide synthetase, 100.0
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 100.0
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 100.0
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 100.0
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 100.0
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 100.0
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 99.98
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 99.98
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 99.97
1ry2_A663 Acetyl-coenzyme A synthetase 1, acyl-activating en 99.97
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 99.97
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 99.97
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 99.96
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 99.96
4gs5_A358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 99.94
3qov_A436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 99.91
2y4o_A443 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.89
2y27_A437 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.89
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 99.83
3hgu_A369 EHPF; phenazine, antibiotic, biosynthetic protein; 99.32
3lax_A109 Phenylacetate-coenzyme A ligase; structural genomi 98.04
3gxs_A109 Phenylacetate-coenzyme A ligase; APC62324.1, struc 97.36
4b2g_A 609 GH3-1 auxin conjugating enzyme; signaling protein, 91.35
4eql_A581 4-substituted benzoates-glutamate ligase GH3.12; f 85.04
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
Probab=100.00  E-value=2.7e-36  Score=258.79  Aligned_cols=183  Identities=20%  Similarity=0.304  Sum_probs=138.8

Q ss_pred             cccchHhhhhh--cCCCCCCceeEEEEecCCCCCCce------eCCeEEceecCceeecc--CCCCCCCCCCCccccc-c
Q 046701            3 MNPLSIHGAAQ--LTITPYTNVFLFYKGRVYLPPRLE------FGCFVTSAISVCTVFVL--LPKNGPHKASSVGKPV-R   71 (187)
Q Consensus         3 ~~~~~~~~~~~--~~~~~~~~lr~i~~~G~~l~~~~~------~~~~i~~~YG~~~~~~~--~~~~~~~~~~~~G~~~-~   71 (187)
                      .+|.++..+.+  ....++++||.+++||+++++++.      +|+.+++.||+++++..  .........+++|+|+ +
T Consensus       322 ~~P~~~~~l~~~~~~~~~l~~lr~i~~gGe~l~~~~~~~~~~~~g~~i~~~YG~TE~~~~~~~~~~~~~~~~~~G~p~~~  401 (580)
T 3etc_A          322 APPTIYRFLIKEDLSHYNFSTLKYAVVAGEPLNPEVFNRFLEFTGIKLMEGFGQTETVVTIATFPWMEPKPGSIGKPTPG  401 (580)
T ss_dssp             ECHHHHHHHHTSCC---CCTTCCEEEECSSCCCHHHHHHHHHHHSCCCEEEECCTTSSCCEECCTTSCCCTTCCBEECTT
T ss_pred             ccHHHHHHHHhcccccCCCccceEEEEccCCCCHHHHHHHHHHhCCeEecccccccccceeecCCCCCCCCCccccCCCC
Confidence            34555555543  234568999999999999999987      68999999999443221  1122345678999999 9


Q ss_pred             eeEEEeCCCCCcCCCCCceeEEEEeC-----CCee--eecChhhhhhccccCeeeeCceEEEeCCCeEEE----------
Q 046701           72 REMAIPDENGVDQKANVNGKMCIREG-----PMVQ--RINNPEANKTAFQFGWFLSGDLGYFDSQRCLNM----------  134 (187)
Q Consensus        72 ~~v~i~~~~g~~~~~g~~Gel~v~~~-----~~~~--y~~~~~~~~~~~~~g~~~TgD~~~~d~~g~l~~----------  134 (187)
                      ++++|+|++|++|++|+.|||+|+ +     +.++  ||++++.+...|.+|||+|||+|++|+||++++          
T Consensus       402 ~~v~ivd~~g~~~~~g~~GEl~v~-~~~g~~~~~~~gY~~~p~~t~~~f~~gwy~TGDlg~~d~dG~l~~~GR~dd~Ik~  480 (580)
T 3etc_A          402 YKIELMDRDGRLCEVGEEGEIVIN-TMEGKPVGLFVHYGKDPERTEETWHDGYYHTGDMAWMDEDGYLWFVGRADDIIKT  480 (580)
T ss_dssp             CEEEEECTTSCBCCTTCCEEEEEE-CTTCCCTTCCCEETTCHHHHHHHEETTEEEEEEEEEECTTSCEEEEEESSSCEEE
T ss_pred             CEEEEECCCCCCCCCCCceEEEEe-cCCCCCCeeeccccCCHhHHHhhcCCCEEecCcEEEECCCCcEEEEecCCCEEEE
Confidence            999999999999999999999999 8     6677  999999999999999999999999999999999          


Q ss_pred             --EEeCcccHHHH--------------------------------------------HHHHHhcCcCCCCccEEEEecCC
Q 046701          135 --WKISPTEVDAV--------------------------------------------KEFCKRNVASFKVPKKVFIADSL  168 (187)
Q Consensus       135 --~~i~~~eiE~~--------------------------------------------~~~~~~~l~~~~~P~~i~~v~~l  168 (187)
                        ++|+|.|||++                                            +++++++|++|++|+.|+++++|
T Consensus       481 ~G~~I~p~eIE~~l~~~p~V~~a~Vvg~~~~~~g~~~~a~vv~~~~~~~~~~~~~~l~~~l~~~l~~~~~P~~i~~v~~l  560 (580)
T 3etc_A          481 SGYKVGPFEVESALIQHPAVLECAITGVPDPVRGQVIKATIVLTKDYTPSDSLKNELQDHVKNVTAPYKYPRIIEFVPEL  560 (580)
T ss_dssp             TTEEECHHHHHHHHTTSTTEEEEEEEEEEETTTEEEEEEEEEECTTCCCCHHHHHHHHHHHHHHSCGGGCCSEEEEECC-
T ss_pred             CCEEECHHHHHHHHHhCCCeeeEEEEeeeccCCCcEEEEEEEECCCCCCCHHHHHHHHHHHHhhCCCccCCeEEEEeCCC
Confidence              89999999998                                            67788899999999999999999


Q ss_pred             CCCCCCCcccHHHHHhhhC
Q 046701          169 SGKPLTGKIQRRIVAELRK  187 (187)
Q Consensus       169 P~~t~~GKi~r~~l~~~~~  187 (187)
                      | +|++|||+|+.|+++++
T Consensus       561 P-~t~sGKi~R~~Lr~~~~  578 (580)
T 3etc_A          561 P-KTISGKIRRVEIRDKDQ  578 (580)
T ss_dssp             -------------------
T ss_pred             C-CCCCcCCcHHHHHhHhh
Confidence            9 99999999999998763
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Back     alignment and structure
>3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} Back     alignment and structure
>4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} Back     alignment and structure
>4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 187
d1v25a_534 e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 9e-16
d1pg4a_643 e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en 4e-15
d1lcia_541 e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali 1e-14
d1amua_514 e.23.1.1 (A:) Phenylalanine activating domain of g 3e-12
d1ry2a_640 e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast 3e-11
d1mdba_536 e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B 6e-09
d3cw9a1503 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc 5e-08
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Long chain fatty acid-CoA ligase TT0168
species: Thermus thermophilus [TaxId: 274]

 Score = 72.2 bits (176), Expect = 9e-16
 Identities = 33/209 (15%), Positives = 65/209 (31%), Gaps = 65/209 (31%)

Query: 37  EFGCFVTSAISVCTVFVLLPKNGPHKASSVGKPVR-REMAIPDENG--VDQKANVNGKMC 93
           E    V        +  L  +      +  G P+    + + DE G  V +     G++ 
Sbjct: 321 ETSPVVVQNFVKSHLESLSEEEKLTLKAKTGLPIPLVRLRVADEEGRPVPKDGKALGEVQ 380

Query: 94  IREGPMVQR--INNPEANKTAFQF-GWFLSGDLGYFDSQRCLNM------------WKIS 138
           ++ GP +      N EA ++A    G+F +GD+  +D +  + +              IS
Sbjct: 381 LK-GPWITGGYYGNEEATRSALTPDGFFRTGDIAVWDEEGYVEIKDRLKDLIKSGGEWIS 439

Query: 139 PTEVDAV-----------------------------------------KEFCKRNVASFK 157
             +++                                           +   K   A ++
Sbjct: 440 SVDLENALMGHPKVKEAAVVAIPHPKWQERPLAVVVPRGEKPTPEELNEHLLKAGFAKWQ 499

Query: 158 VPKKVFIADSLSGKPLT--GKIQRRIVAE 184
           +P     A+ +   P T  GK  +R + E
Sbjct: 500 LPDAYVFAEEI---PRTSAGKFLKRALRE 525
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 Back     information, alignment and structure
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
d1pg4a_643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 100.0
d1lcia_541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 99.98
d1v25a_534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 99.97
d1ry2a_640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 99.97
d1amua_514 Phenylalanine activating domain of gramicidin synt 99.97
d1mdba_536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 99.95
d3cw9a1503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 99.94
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Acetyl-CoA synthetase
species: Salmonella enterica [TaxId: 28901]

Probab=100.00  E-value=6.8e-34  Score=244.47  Aligned_cols=182  Identities=19%  Similarity=0.283  Sum_probs=152.8

Q ss_pred             cccchHhhhhh-----cCCCCCCceeEEEEecCCCCCCce------e---CCeEEceecCceeecc----CCCCCCCCCC
Q 046701            3 MNPLSIHGAAQ-----LTITPYTNVFLFYKGRVYLPPRLE------F---GCFVTSAISVCTVFVL----LPKNGPHKAS   64 (187)
Q Consensus         3 ~~~~~~~~~~~-----~~~~~~~~lr~i~~~G~~l~~~~~------~---~~~i~~~YG~~~~~~~----~~~~~~~~~~   64 (187)
                      ++|.++..+.+     ....++++||.++++|+++++++.      +   ++.+++.||+++++..    .......+.+
T Consensus       352 ~~P~~l~~l~~~~~~~~~~~dl~sLr~i~~~G~pl~~~~~~~~~~~~g~~~~~i~~~yG~TE~g~~~~~~~~~~~~~~~g  431 (643)
T d1pg4a_         352 TAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAG  431 (643)
T ss_dssp             ECHHHHHHHHTTGGGGTTTCCCTTCCEEEEESSCCCHHHHHHHHHHTTTTCSCEEEEBCCGGGSSCSBCCCTTTCCBCTT
T ss_pred             ehHHHHHHHHhCcchhccccCCCceEEEEEEeCCCCHHHHHHHHHHhCCCCceEEEeechhhccceEEecCCCccCCCCC
Confidence            34555544432     245678999999999999999987      3   4679999999443322    2223345678


Q ss_pred             Cccccc-ceeEEEeCCCCCcCCCCCceeEEEEeCCC--ee--eecChhhhhhcc---ccCeeeeCceEEEeCCCeEEE--
Q 046701           65 SVGKPV-RREMAIPDENGVDQKANVNGKMCIREGPM--VQ--RINNPEANKTAF---QFGWFLSGDLGYFDSQRCLNM--  134 (187)
Q Consensus        65 ~~G~~~-~~~v~i~~~~g~~~~~g~~Gel~v~~~~~--~~--y~~~~~~~~~~~---~~g~~~TgD~~~~d~~g~l~~--  134 (187)
                      ++|+|+ +++++++|++|++++.|+.|||+|+ ++.  .+  ||++++.+.+.+   .+|||+|||+|++|+||++++  
T Consensus       432 s~G~p~~g~~v~ivd~~g~~~~~g~~Gel~v~-~~~p~~~~~~~~~~~~~~~~~~~~~~g~~~TGDl~~~d~dG~l~i~G  510 (643)
T d1pg4a_         432 SATRPFFGVQPALVDNEGHPQEGATEGNLVIT-DSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITG  510 (643)
T ss_dssp             CCBSBCTTCCEEEECTTCCBCCSSEEEEEEEC-SCCTTCCCEETTCHHHHHHHHHSSSTTSEEEEEEEEECTTSCEEEEE
T ss_pred             ccccccCCCEEEEECCCCCCCCCCceEEEEEe-cCCCcccccccCChhhchhhhcccCCCeEEcCCEEEECCCceEEEec
Confidence            999999 9999999999999999999999999 964  44  999998877654   369999999999999999999  


Q ss_pred             ----------EEeCcccHHHH--------------------------------------------HHHHHhcCcCCCCcc
Q 046701          135 ----------WKISPTEVDAV--------------------------------------------KEFCKRNVASFKVPK  160 (187)
Q Consensus       135 ----------~~i~~~eiE~~--------------------------------------------~~~~~~~l~~~~~P~  160 (187)
                                ++|+|.|||++                                            +++|+++|+++++|+
T Consensus       511 R~dd~ik~~G~ri~p~eIE~~l~~~p~V~eaaVvg~~d~~~ge~~~a~Vv~~~~~~~~~~~~~~i~~~~~~~L~~~~vP~  590 (643)
T d1pg4a_         511 RVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPD  590 (643)
T ss_dssp             ESSSEEEETTEEEEHHHHHHHHHHSTTEEEEEEEEEEETTTEEEEEEEEEECTTCCCCHHHHHHHHHHHHHHTCGGGCCS
T ss_pred             ccccEEEECCEEECHHHHHHHHHhCCCcceEEEEEEECCCCCeEEEEEEEECCCCCCCHHHHHHHHHHHHhhCCcccCcc
Confidence                      89999999998                                            568899999999999


Q ss_pred             EEEEecCCCCCCCCCcccHHHHHhhh
Q 046701          161 KVFIADSLSGKPLTGKIQRRIVAELR  186 (187)
Q Consensus       161 ~i~~v~~lP~~t~~GKi~r~~l~~~~  186 (187)
                      .|+++++|| +|++|||+|+.|++++
T Consensus       591 ~i~~v~~lP-~T~sGKi~R~~Lr~~~  615 (643)
T d1pg4a_         591 VLHWTDSLP-KTRSGKIMRRILRKIA  615 (643)
T ss_dssp             EEEECSCCC-BCTTSCBCHHHHHHHH
T ss_pred             EEEEECCCC-CCCCcCccHHHHHHHh
Confidence            999999999 9999999999999975
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure