Citrus Sinensis ID: 046723

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560--
MNSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGNEVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGEQKEGYHILGILLHACLLEEGGGGEVKMHDVIRDMALWIACDIEKEKENFFVYAGVGLVRAPDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHCELTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQLISNLSRLQVLRMFGASHKAIKEASENSILFGGGELIVEELLGLKHLEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQQFAFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEVPEVMANLNPFEKLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLPLDSNSAKERKIVISGERNWREQLQWEDEATRNAFLRCFRDV
ccccccHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccHHHHHcccccccccccHHHHHHcccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccEEccccEEEEcHHHHHHHHHHHHHHHHHHcccEEEcccccEEcccccccccEEEEEEEcccccccccccccccccEEEccccccccccHHHHcccccEEEEEcccccccccccccccccccccccccccccccccHHHHccccccEEccccccccccccHHHHcccccccEEEEccccccccccccccccccccccEEEcccccccccccEEEEEcccccHHHHHHHHHccccccccEEEEEccccEEEEcccccccccccEEEcccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEcccccEEEcccccccccccccccccccccccEEEccccccccEEcccccccccccEEEEcccccccccccccccccccEEEEEcccccccccccccHHHHcccccccEEc
ccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHccccccccccHHHEEcHcccccHHHHHHEEEEEcccccccEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHHHHcccHccEEEEcccccccccccccHHHEEEEEccccccccccccccccccEEEEEEccccccccHHHccccccccEEEcccccccEEEcccccccccEEEEccccccccccHHHccccccEEEEEcccccHccccHHHHcccccccEEEEccccccccccccccccccccccccHHHHcccHccccccccccccHHHHHHHHHcccccHHHHEEHcccccccccccccccccccccEEEEccccHHcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccHcEccHHccccccccccccccccccccEEEEcccccHHcccccccccccccEEEEcccccHcccccccccccHcEEEEcccHHHHHHcccccHHHHHHHccccccc
MNSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRtsssqfpglgnevypllkfsydslpsdtirschlycslypedyciskeklidcwigerllterdrtgeqkegyHILGILLHACLleeggggevkmHDVIRDMALWIACDIEKEKENFFVYAGVglvrapdvrgwEKARRLSLMQNQIrnlseiptcphllTLFLNENNLRKIHNDFFqfmpslkvlnlshceltklpvgISELVSlqhldlsesdiEELPGELKALVNLkcldleytgnlitipRQLISNLSRLQVLRMFGASHKAIKEAsensilfggGELIVEELLGLKHLEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQQFAFRSLNMVEICnciklkdltflvfapnlksIKVGICHAMEEIasegkfaevpevmanlnpfeklQNLEVAGarnlksiywkplpfphlkamsflhckklkklpldsnsakERKIVISGERNWREQLQWEDEATRNAFLRCFRDV
MNSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLrtsssqfpgLGNEVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGEQKEGYHILGILLHACLLEEGGGGEVKMHDVIRDMALWIACDIEKEKENFFVYAGVGLVRAPDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHCELTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQLISNLSRLQVLRMFGASHKAIKEASENSILFGGGELIVEELLGLKHLEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQQFAFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEVPEVMANLNPFEKLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLkklpldsnsakeRKIVISgernwreqlqwedeatrnaflrcfrdv
MNSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGNEVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGEQKEGYHILGILLHACLLEEGGGGEVKMHDVIRDMALWIACDIEKEKENFFVYAGVGLVRAPDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHCELTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQLISNLSRLQVLRMFGASHKAIKEASENSILFgggeliveellglKHLEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQQFAFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEVPEVMANLNPFEKLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLPLDSNSAKERKIVISGERNWREQLQWEDEATRNAFLRCFRDV
*******LQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGNEVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGEQKEGYHILGILLHACLLEEGGGGEVKMHDVIRDMALWIACDIEKEKENFFVYAGVGLVRAPDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHCELTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQLISNLSRLQVLRMFGASHKAIKEASENSILFGGGELIVEELLGLKHLEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQQFAFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEVPEVMANLNPFEKLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLPL********KIVISGERNWREQLQWEDEATRNAFLRCF***
**SHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQ**GLGNEVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGEQKEGYHILGILLHACLLEEGGGGEVKMHDVIRDMALWIACDIEKEKENFFVYAGV*LV**P*VRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHCELTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQLISNLSRLQVLRMFGASHKAIKEASENSILFGGGELIVEELLGLKHLEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTLL*V***AYLKQLNRLQIANSVILEELKMDYAEEVQQFAFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFA*********NPFEKLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLPLDSNSAKERKIVISGERNWREQLQWEDEATRNAFLRCFRDV
MNSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGNEVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGEQKEGYHILGILLHACLLEEGGGGEVKMHDVIRDMALWIACDIEKEKENFFVYAGVGLVRAPDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHCELTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQLISNLSRLQVLRMFGASHKAIKEASENSILFGGGELIVEELLGLKHLEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQQFAFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEVPEVMANLNPFEKLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLPLDSNSAKERKIVISGERNWREQLQWEDEATRNAFLRCFRDV
**SHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGNEVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGEQKEGYHILGILLHACLLEEGGGGEVKMHDVIRDMALWIACDIEKEKENFFVYAGVGLVRAPDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHCELTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQLISNLSRLQVLRMFGASHKAIKEASENSILFGGGELIVEELLGLKHLEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQQFAFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEVPEVMANLNPFEKLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLPLDSNSAKERKIVISGERNWREQLQWEDEATRNAFLRCFRDV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGNEVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGEQKEGYHILGILLHACLLEEGGGGEVKMHDVIRDMALWIACDIEKEKENFFVYAGVGLVRAPDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHCELTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQLISNLSRLQVLRMFGASHKAIKEASENSILFGGGELIVEELLGLKHLEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQQFAFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEVPEVMANLNPFEKLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLPLDSNSAKERKIVISGERNWREQLQWEDEATRNAFLRCFRDV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query562 2.2.26 [Sep-21-2011]
O64973889 Disease resistance protei yes no 0.953 0.602 0.416 1e-103
Q8RXS5888 Probable disease resistan no no 0.948 0.600 0.400 1e-101
Q9C8T9898 Putative disease resistan no no 0.951 0.595 0.390 1e-95
P60838894 Probable disease resistan no no 0.957 0.601 0.397 6e-93
P60839884 Probable disease resistan no no 0.950 0.604 0.400 2e-91
Q8L3R3885 Disease resistance protei no no 0.960 0.610 0.413 2e-91
O82484892 Putative disease resistan no no 0.957 0.603 0.392 8e-91
Q9SH22884 Probable disease resistan no no 0.939 0.597 0.388 3e-89
Q940K0889 Probable disease resistan no no 0.943 0.596 0.385 1e-86
Q9SI85893 Probable disease resistan no no 0.939 0.591 0.379 2e-86
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function desciption
 Score =  375 bits (963), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 237/569 (41%), Positives = 336/569 (59%), Gaps = 33/569 (5%)

Query: 1   MNSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGN 60
           + SHPDI  LA+  AR+C GLPLAL  IG AMACK+T  EW +AI+VL +S+  F G+ +
Sbjct: 331 LGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAIDFSGMED 390

Query: 61  EVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERD-RTGEQK 119
           E+  +LK+SYD+L  + ++SC LYCSL+PEDY I KE L+D WI E  + E++ R     
Sbjct: 391 EILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEKEGRERNIN 450

Query: 120 EGYHILGILLHACLL--EEGGGGEVKMHDVIRDMALWIACDIEKEKENFFVYAGVGLVRA 177
           +GY I+G L+ ACLL  EE     VKMHDV+R+MALWI+ D+ K+KE   V AGVGL   
Sbjct: 451 QGYEIIGTLVRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLREV 510

Query: 178 PDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNL 237
           P V+ W   R++SLM N+I  + +   C  L TLFL +N++ KI  +FF+ MP L VL+L
Sbjct: 511 PKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDL 570

Query: 238 SHCE-LTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQL 296
           S  + L +LP  ISEL SL++ +LS + I +LP  L  L  L  L+LE+  +L +I    
Sbjct: 571 SENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILG-- 628

Query: 297 ISNLSRLQVLRMFGASHKAIKEASENSILFGGGELIVEELLGLKHLEVISLTLRNSHGLQ 356
           ISNL  L+ L +            ++ +L      +V+EL  L+HLEVI+L + +S   +
Sbjct: 629 ISNLWNLRTLGL-----------RDSRLLLDMS--LVKELQLLEHLEVITLDISSSLVAE 675

Query: 357 SFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQ 416
             L S +L  C + +  +   + + + V  L  +  L +L I     + E+K++      
Sbjct: 676 PLLCSQRLVECIKEVDFKYLKEES-VRVLTLPTMGNLRKLGIKRCG-MREIKIERTTSSS 733

Query: 417 QF-------AFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEV 469
                     F +L+ V I  C  LKDLT+L+FAPNL  ++VG    +E+I SE K    
Sbjct: 734 SRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEK---A 790

Query: 470 PEVMANLNPFEKLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLPLDSNS--A 527
            E  A + PF KL+ L +   R LK IY K L FP LK +    C+KL+KLPLDS S  A
Sbjct: 791 EEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIA 850

Query: 528 KERKIVISGERNWREQLQWEDEATRNAFL 556
            E  ++  GER W E+++WED+AT+  FL
Sbjct: 851 GEELVIYYGEREWIERVEWEDQATQLRFL 879
Disease resistance (R) protein that specifically recognizes the avrPphB type III effector avirulence protein from Pseudomonas syringae. Also confers resistance against Hyaloperonospora parasitica (downy mildew). Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Requires PBS1 to trigger the defense reaction against avrPphB. Probably triggers the defense mechanism when PBS1 is cleaved by avrPphB, suggesting that it detects indirectly the protease activity of avrPphB, and possibly binds to the cleaved RPS5.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query562
24461865 892 NBS-LRR type disease resistance protein 1.0 0.630 0.955 0.0
24461866 890 NBS-LRR type disease resistance protein 0.987 0.623 0.825 0.0
24461861 890 NBS-LRR type disease resistance protein 0.989 0.624 0.673 0.0
24461864 899 NBS-LRR type disease resistance protein 0.992 0.620 0.603 1e-180
24461863 889 NBS-LRR type disease resistance protein 0.983 0.622 0.595 1e-177
15080718479 putative disease resistance gene protein 0.731 0.858 0.699 1e-149
359482672 905 PREDICTED: probable disease resistance p 0.994 0.617 0.496 1e-147
225443158 903 PREDICTED: probable disease resistance p 0.989 0.615 0.504 1e-145
225442867 893 PREDICTED: probable disease resistance p 0.971 0.611 0.490 1e-145
359482674 991 PREDICTED: probable disease resistance p 0.959 0.543 0.485 1e-140
>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score = 1070 bits (2767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/562 (95%), Positives = 544/562 (96%)

Query: 1   MNSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGN 60
           MNSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGN
Sbjct: 331 MNSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGN 390

Query: 61  EVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGEQKE 120
           EVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGEQKE
Sbjct: 391 EVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGEQKE 450

Query: 121 GYHILGILLHACLLEEGGGGEVKMHDVIRDMALWIACDIEKEKENFFVYAGVGLVRAPDV 180
           GYHILGILLHACLLEEGG GEVKMHDVIRDMALWIACDIE+EKENFFVYAGVGLV APDV
Sbjct: 451 GYHILGILLHACLLEEGGDGEVKMHDVIRDMALWIACDIEREKENFFVYAGVGLVEAPDV 510

Query: 181 RGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHC 240
           RGWEKARRLSLMQNQIRNLSEIPTCPHLLTL LNENNLRKI N FFQFMPSLKVLNLSHC
Sbjct: 511 RGWEKARRLSLMQNQIRNLSEIPTCPHLLTLLLNENNLRKIQNYFFQFMPSLKVLNLSHC 570

Query: 241 ELTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQLISNL 300
           ELTKLPVGISELVSLQHLDLSESDIEE PGELKALVNLKCLDLEYT NLITIPRQLISNL
Sbjct: 571 ELTKLPVGISELVSLQHLDLSESDIEEFPGELKALVNLKCLDLEYTRNLITIPRQLISNL 630

Query: 301 SRLQVLRMFGASHKAIKEASENSILFGGGELIVEELLGLKHLEVISLTLRNSHGLQSFLR 360
           SRL+VLRMFGASH A  EASENSILFGGGELIVEELLGLKHLEVI+LTLR+S+GLQSFL 
Sbjct: 631 SRLRVLRMFGASHNAFDEASENSILFGGGELIVEELLGLKHLEVITLTLRSSYGLQSFLN 690

Query: 361 SWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQQFAF 420
           S KLR CT+ALLLQ F DST LEVSALA LKQLNRLQIANSVILEELKMDYAEEVQQFAF
Sbjct: 691 SHKLRSCTQALLLQHFKDSTSLEVSALADLKQLNRLQIANSVILEELKMDYAEEVQQFAF 750

Query: 421 RSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEVPEVMANLNPFE 480
           RSLNMVEICNCI+LKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEVPEVMANLNPFE
Sbjct: 751 RSLNMVEICNCIQLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEVPEVMANLNPFE 810

Query: 481 KLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLPLDSNSAKERKIVISGERNW 540
           KLQNLEVAGARNLKSIYWK LPFPHLKAMSFLHCKKLKKLPLDSNSAKERKIVISGERNW
Sbjct: 811 KLQNLEVAGARNLKSIYWKSLPFPHLKAMSFLHCKKLKKLPLDSNSAKERKIVISGERNW 870

Query: 541 REQLQWEDEATRNAFLRCFRDV 562
           REQLQWEDEATRNAFLRCFRDV
Sbjct: 871 REQLQWEDEATRNAFLRCFRDV 892

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|15080718|gb|AAK83559.1|AF278857_1 putative disease resistance gene protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|359482672|ref|XP_003632805.1| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225443158|ref|XP_002263674.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482674|ref|XP_002281708.2| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query562
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.953 0.602 0.413 5.2e-97
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.957 0.601 0.400 1.1e-96
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.948 0.600 0.398 3.7e-96
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.950 0.604 0.398 1.3e-93
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.950 0.603 0.411 5e-92
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.950 0.594 0.393 3.5e-91
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.957 0.603 0.387 1.7e-89
TAIR|locus:2031356884 AT1G63360 [Arabidopsis thalian 0.939 0.597 0.383 2.4e-85
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.966 0.604 0.383 4.9e-85
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.944 0.696 0.377 8.2e-83
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 964 (344.4 bits), Expect = 5.2e-97, P = 5.2e-97
 Identities = 235/569 (41%), Positives = 332/569 (58%)

Query:     1 MNSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGN 60
             + SHPDI  LA+  AR+C GLPLAL  IG AMACK+T  EW +AI+VL +S+  F G+ +
Sbjct:   331 LGSHPDIPGLARKVARKCRGLPLALNVIGEAMACKRTVHEWCHAIDVLTSSAIDFSGMED 390

Query:    61 EVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERD-RTGEQK 119
             E+  +LK+SYD+L  + ++SC LYCSL+PEDY I KE L+D WI E  + E++ R     
Sbjct:   391 EILHVLKYSYDNLNGELMKSCFLYCSLFPEDYLIDKEGLVDYWISEGFINEKEGRERNIN 450

Query:   120 EGYHILGILLHACLL--EEGGGGEVKMHDVIRDMALWIACDIEKEKENFFVYAGVGLVRA 177
             +GY I+G L+ ACLL  EE     VKMHDV+R+MALWI+ D+ K+KE   V AGVGL   
Sbjct:   451 QGYEIIGTLVRACLLLEEERNKSNVKMHDVVREMALWISSDLGKQKEKCIVRAGVGLREV 510

Query:   178 PDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNL 237
             P V+ W   R++SLM N+I  + +   C  L TLFL +N++ KI  +FF+ MP L VL+L
Sbjct:   511 PKVKDWNTVRKISLMNNEIEEIFDSHECAALTTLFLQKNDVVKISAEFFRCMPHLVVLDL 570

Query:   238 SHCE-LTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQL 296
             S  + L +LP  ISEL SL++ +LS + I +LP  L  L  L  L+LE+  +L +I    
Sbjct:   571 SENQSLNELPEEISELASLRYFNLSYTCIHQLPVGLWTLKKLIHLNLEHMSSLGSILG-- 628

Query:   297 ISNLSRLQVLRMFGASHKAIKEASENSILFXXXXXXXXXXXXXKHLEVISLTLRNSHGLQ 356
             ISNL  L+ L +            ++ +L              +HLEVI+L + +S   +
Sbjct:   629 ISNLWNLRTLGL-----------RDSRLLLDMSLVKELQLL--EHLEVITLDISSSLVAE 675

Query:   357 SFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQ 416
               L S +L  C + +  +   + ++  V  L  +  L +L I     + E+K++      
Sbjct:   676 PLLCSQRLVECIKEVDFKYLKEESV-RVLTLPTMGNLRKLGIKRCG-MREIKIERTTSSS 733

Query:   417 QF-------AFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEV 469
                       F +L+ V I  C  LKDLT+L+FAPNL  ++VG    +E+I SE K AE 
Sbjct:   734 SRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKEVEDIISEEK-AE- 791

Query:   470 PEVMANLNPFEKLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLPLDSNS--A 527
              E  A + PF KL+ L +   R LK IY K L FP LK +    C+KL+KLPLDS S  A
Sbjct:   792 -EHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRKLPLDSKSGIA 850

Query:   528 KERKIVISGERNWREQLQWEDEATRNAFL 556
              E  ++  GER W E+++WED+AT+  FL
Sbjct:   851 GEELVIYYGEREWIERVEWEDQATQLRFL 879
GO:0009626 "plant-type hypersensitive response" evidence=IMP
GO:0006952 "defense response" evidence=IMP;TAS
GO:0009816 "defense response to bacterium, incompatible interaction" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0008219 "cell death" evidence=IMP
GO:0038023 "signaling receptor activity" evidence=IMP
GO:0000166 "nucleotide binding" evidence=IMP
GO:0005622 "intracellular" evidence=ISS
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034579001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (884 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query562
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 1e-29
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  117 bits (296), Expect = 1e-29
 Identities = 45/111 (40%), Positives = 65/111 (58%), Gaps = 2/111 (1%)

Query: 3   SHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLGNEV 62
             P++ ++A+    +C GLPLAL  +G  +A K T +EW + +E L    +   GL NEV
Sbjct: 176 PCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGL-NEV 234

Query: 63  YPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERD 113
             +L  SYD+LP   ++ C LY +L+PEDY I KE+LI  WI E  +   D
Sbjct: 235 LSILSLSYDNLPMH-LKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPSD 284

Length = 285
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 562
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.83
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.79
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.79
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.76
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.75
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.67
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.56
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.54
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.53
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.49
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.47
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
KOG4237498 consensus Extracellular matrix protein slit, conta 99.26
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.26
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.21
KOG4237498 consensus Extracellular matrix protein slit, conta 99.17
KOG4341483 consensus F-box protein containing LRR [General fu 99.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.98
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.8
KOG4341483 consensus F-box protein containing LRR [General fu 98.79
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.78
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.78
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.74
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.69
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.68
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.65
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.63
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.61
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.6
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.58
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.53
PLN03150623 hypothetical protein; Provisional 98.38
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.22
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.2
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.18
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.18
PLN03150623 hypothetical protein; Provisional 98.18
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.09
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.05
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.99
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.91
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.89
PRK15386 426 type III secretion protein GogB; Provisional 97.77
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.76
PRK15386426 type III secretion protein GogB; Provisional 97.73
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.67
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.66
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.66
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.63
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.28
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.27
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.2
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.99
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.9
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.84
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.6
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.2
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.19
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.09
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.76
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.23
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.0
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.51
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.33
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.04
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.64
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.96
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.23
smart0037026 LRR Leucine-rich repeats, outliers. 87.92
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.92
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.34
smart0037026 LRR Leucine-rich repeats, outliers. 87.34
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 82.88
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=3e-61  Score=518.50  Aligned_cols=534  Identities=41%  Similarity=0.695  Sum_probs=437.0

Q ss_pred             CCChhHHHHHHHHHHHcCCchhHHHHHHHHhcCCCChhHHHHHHHHHhcc-CCCCCCCccchhhhhhhhccCCCchhhhh
Q 046723            2 NSHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTS-SSQFPGLGNEVYPLLKFSYDSLPSDTIRS   80 (562)
Q Consensus         2 ~~~~~l~~i~~~i~~~c~GlPLai~~ig~~L~~~~~~~~W~~~l~~l~~~-~~~~~~~~~~i~~~L~~sy~~L~~~~~k~   80 (562)
                      ++.+.++++|++||++|+|+|||++++|+.|+.|.+..+|+++.+.+.+. ....++..+.|+++|++|||+||+ ++|.
T Consensus       336 ~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~-~lK~  414 (889)
T KOG4658|consen  336 GSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPE-ELKS  414 (889)
T ss_pred             cccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhH-HHHH
Confidence            34566999999999999999999999999999999999999999999887 555556678999999999999996 5999


Q ss_pred             hhhhhcccCCCccccHHHHHHHHHHCCCccc-CCCchhhHhhHHHHHHHHHhccccccC----CCcEEEchhHHHHHHHH
Q 046723           81 CHLYCSLYPEDYCISKEKLIDCWIGERLLTE-RDRTGEQKEGYHILGILLHACLLEEGG----GGEVKMHDVIRDMALWI  155 (562)
Q Consensus        81 cfl~~a~fp~~~~~~~~~Li~~wiaeg~~~~-~~~~~~~~~~~~~~~~L~~~~l~~~~~----~~~~~mhdl~~~l~~~~  155 (562)
                      ||+|||.||+||.|+++.|+.+|+||||++. .++..+++.|+.|+++|++++++....    ...|+|||++|++|.++
T Consensus       415 CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~i  494 (889)
T KOG4658|consen  415 CFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWI  494 (889)
T ss_pred             HHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHH
Confidence            9999999999999999999999999999999 678999999999999999999998864    48999999999999999


Q ss_pred             hcccccccccEEEeeccccccCCCccccccceEEeccccccccCCCCCCCccccEEEccccC--ccccchhhhcCCCCCc
Q 046723          156 ACDIEKEKENFFVYAGVGLVRAPDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENN--LRKIHNDFFQFMPSLK  233 (562)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~l~~~~~~~~L~~L~l~~~~--l~~~~~~~~~~l~~L~  233 (562)
                      +++.+..+++.+...+.+....+....+...|+.++.++.+..++.-..++.|++|.+.++.  +..++..+|..++.|+
T Consensus       495 as~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~Lr  574 (889)
T KOG4658|consen  495 ASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLR  574 (889)
T ss_pred             hccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceE
Confidence            99877766776666655666678888889999999999999998888888899999999886  7788888899999999


Q ss_pred             EEEecCC-CCcccCcccCCcccCcEEeCCCCCccccchhhhCCCCCcEEeccCcCCCCccchhhhcCCCCCCEEEecCCC
Q 046723          234 VLNLSHC-ELTKLPVGISELVSLQHLDLSESDIEELPGELKALVNLKCLDLEYTGNLITIPRQLISNLSRLQVLRMFGAS  312 (562)
Q Consensus       234 ~L~l~~~-~~~~lp~~~~~l~~L~~L~l~~~~l~~lp~~~~~l~~L~~L~l~~~~~l~~~p~~~~~~l~~L~~L~l~~~~  312 (562)
                      +||+++| .+.++|.+|++|.+||||+++++.++.+|.++++|.+|.+|++..+..+..+|. ....+++||+|.+....
T Consensus       575 VLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~-i~~~L~~Lr~L~l~~s~  653 (889)
T KOG4658|consen  575 VLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPG-ILLELQSLRVLRLPRSA  653 (889)
T ss_pred             EEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccc-hhhhcccccEEEeeccc
Confidence            9999988 888999999999999999999999999999999999999999999877777754 36679999999998654


Q ss_pred             ccchhcccccccccCCcccchhhhcCccccceeeEEEecccchHHHHhhhhhhccccceeeccccCCCccchhhhhhhcc
Q 046723          313 HKAIKEASENSILFGGGELIVEELLGLKHLEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQ  392 (562)
Q Consensus       313 ~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~l~~  392 (562)
                      ..             .+.....++.++++|+.+.+.......+..+.....+....+.+.+.++.......  .+..+.+
T Consensus       654 ~~-------------~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~~~~~~~~--~~~~l~~  718 (889)
T KOG4658|consen  654 LS-------------NDKLLLKELENLEHLENLSITISSVLLLEDLLGMTRLRSLLQSLSIEGCSKRTLIS--SLGSLGN  718 (889)
T ss_pred             cc-------------cchhhHHhhhcccchhhheeecchhHhHhhhhhhHHHHHHhHhhhhcccccceeec--ccccccC
Confidence            22             24557788889999998888765553334444444444445555554433333332  5788999


Q ss_pred             cCeeeeccccccceeeccchhhhhhh-hhccccEEEEecCCCCCCCccccccCCCceEEEecCcchhhhhcCCCCCCccc
Q 046723          393 LNRLQIANSVILEELKMDYAEEVQQF-AFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIASEGKFAEVPE  471 (562)
Q Consensus       393 L~~L~l~~~~~l~~l~~~~~~~~~~~-~~~~L~~L~L~~c~~l~~l~~l~~l~~L~~L~L~~c~~l~~l~~~~~~~~~~~  471 (562)
                      |+.|.+.+|...+.. ..+....... .|+++.++.+.+|...+++.|....|+|+.|.+.+|..++++++......  .
T Consensus       719 L~~L~i~~~~~~e~~-~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~--~  795 (889)
T KOG4658|consen  719 LEELSILDCGISEIV-IEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALL--E  795 (889)
T ss_pred             cceEEEEcCCCchhh-cccccccchhhhHHHHHHHHhhccccccccchhhccCcccEEEEecccccccCCCHHHHhh--h
Confidence            999999999554322 2222211112 37789999999999999999998999999999999999999876332211  1


Q ss_pred             cccCCCCcccccee-eccCCcCCcccCcCCCCCCCcceeeeccCCCCccccCCCcc--ccc-cceEEEehhhhhccCccC
Q 046723          472 VMANLNPFEKLQNL-EVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLPLDSNS--AKE-RKIVISGERNWREQLQWE  547 (562)
Q Consensus       472 ~~~~~~~~~~L~~L-~l~~c~~L~~~~~~~~~~~~L~~L~i~~C~~L~~lp~~~~~--~~~-~~~~i~~~~~~~~~~~~~  547 (562)
                      .......|.++..+ .+.+.+.+..+......++.|+.+.+..||++.++|.....  ... .......+.+|.+.++|.
T Consensus       796 l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l~~~~l~~~~ve~~p~l~~~P~~~~~~i~~~~~~~~~~~~~~~~~~v~~~  875 (889)
T KOG4658|consen  796 LKELILPFNKLEGLRMLCSLGGLPQLYWLPLSFLKLEELIVEECPKLGKLPLLSTLTIVGCEEKLKEYPDGEWLEGVYWE  875 (889)
T ss_pred             cccEEecccccccceeeecCCCCceeEecccCccchhheehhcCcccccCccccccceeccccceeecCCccceeeEEeh
Confidence            11134567888888 58888888888888888899999999999999999999765  222 333444445799999999


Q ss_pred             chhhHhhh
Q 046723          548 DEATRNAF  555 (562)
Q Consensus       548 ~~~~~~~~  555 (562)
                      ++.+..++
T Consensus       876 ~~~~~~~~  883 (889)
T KOG4658|consen  876 DELTKLRF  883 (889)
T ss_pred             hhhhhhhc
Confidence            99887766

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query562
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-06
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-06
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 2e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 3e-05
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 4e-04
2z7x_B 520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 6e-04
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure 
Iteration: 1

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 64/145 (44%), Gaps = 5/145 (3%)
Query: 170 AGVGLVRAPDVRGWEKARRLSLMQNQIRNLSE--IPTCPHLLTLFLNENNLRKIHNDFFQ 227
            G+  +     RG  K   L+L  NQ++ LS         L TL L  N L  +    F 
Sbjct: 45  TGLATLSDATFRGLTKLTWLNLDYNQLQTLSAGVFDDLTELGTLGLANNQLASLPLGVFD 104
Query: 228 FMPSLKVLNLSHCELTKLPVGI-SELVSLQHLDLSESDIEELP-GELKALVNLKCLDLEY 285
            +  L  L L   +L  LP G+   L  L+ L L+ + ++ +P G    L NL+ L L  
Sbjct: 105 HLTQLDKLYLGGNQLKSLPSGVFDRLTKLKELRLNTNQLQSIPAGAFDKLTNLQTLSLS- 163
Query: 286 TGNLITIPRQLISNLSRLQVLRMFG 310
           T  L ++P      L +LQ + +FG
Sbjct: 164 TNQLQSVPHGAFDRLGKLQTITLFG 188
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query562
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 5e-27
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 4e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-20
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-15
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 8e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  114 bits (287), Expect = 5e-27
 Identities = 42/280 (15%), Positives = 91/280 (32%), Gaps = 32/280 (11%)

Query: 3   SHPDILQLAQTAARECGGLPLALITIGRAMACKKTPEEWSYAIEVLRTSSSQFPGLG--- 59
              D+ + A +  +EC G PL +  IG  +     P  W Y ++ L+    +        
Sbjct: 302 KKADLPEQAHSIIKECKGSPLVVSLIGALLRDF--PNRWEYYLKQLQNKQFKRIRKSSSY 359

Query: 60  --NEVYPLLKFSYDSLPSDTIRSCHLYCSLYPEDYCISKEKLIDCWIGERLLTERDRTGE 117
               +   +  S + L  D I+  +   S+  +D  +  + L   W  E          E
Sbjct: 360 DYEALDEAMSISVEMLRED-IKDYYTDLSILQKDVKVPTKVLCILWDME---------TE 409

Query: 118 QKEGYHILGILLHACLLEEGGGGEV---KMHDVIRDMALWIACDIEKEKENFFVYAGVGL 174
           + E    L   ++  LL     G+     +HD+  D      C  + +  +  +      
Sbjct: 410 EVEDI--LQEFVNKSLLFCDRNGKSFRYYLHDLQVDFLTEKNCS-QLQDLHKKIITQFQR 466

Query: 175 VRAPDVRGWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLR------KIHNDFFQF 228
              P     ++   +        +++       L  L  + + ++         +   +F
Sbjct: 467 YHQPHTLSPDQEDCMYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEF 526

Query: 229 MPSLKVLNLSHCELTKLPVGISELVSLQHLDLSESDIEEL 268
           +    +L+   C +++      E +SL    L       +
Sbjct: 527 VEYRHILDEKDCAVSEN---FQEFLSLNGHLLGRQPFPNI 563
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query562
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.89
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.89
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.89
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.88
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.87
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.87
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.86
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.85
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.85
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.81
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.79
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.76
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.72
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.7
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.7
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.69
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.68
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.65
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.65
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.62
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.62
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.61
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.61
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.61
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.6
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.6
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.6
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.58
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.55
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.52
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.52
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.51
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.51
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.51
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.5
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.49
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.48
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.47
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.47
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.42
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.41
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.36
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.34
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.32
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.31
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.31
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.27
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.25
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.22
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.21
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.2
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.17
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.15
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.05
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.98
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.84
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.75
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.71
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.71
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.68
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.59
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.57
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.43
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.25
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.88
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.85
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.85
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.84
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.76
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.68
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.67
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.65
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.11
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.36
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.09
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.27
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.79
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.94  E-value=2.5e-25  Score=222.52  Aligned_cols=234  Identities=21%  Similarity=0.297  Sum_probs=113.9

Q ss_pred             ccccceEEeccccccccCCCCCCCccccEEEccccCccccchhhhcCCCCCcEEEecCCCCcccCcccCCcccCcEEeCC
Q 046723          182 GWEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHCELTKLPVGISELVSLQHLDLS  261 (562)
Q Consensus       182 ~~~~l~~L~l~~~~~~~l~~~~~~~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~~~~~~lp~~~~~l~~L~~L~l~  261 (562)
                      .+++++.|++.++.+..++.+..+++|++|++++|.++.+++  +..+++|++|++++|.++.+| .+..+++|++|+++
T Consensus        42 ~l~~L~~L~l~~~~i~~~~~~~~~~~L~~L~l~~n~i~~~~~--~~~l~~L~~L~L~~n~i~~~~-~~~~l~~L~~L~l~  118 (347)
T 4fmz_A           42 ELESITKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDISP--LSNLVKLTNLYIGTNKITDIS-ALQNLTNLRELYLN  118 (347)
T ss_dssp             HHTTCSEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSSCCCCCG-GGTTCTTCSEEECT
T ss_pred             hcccccEEEEeCCccccchhhhhcCCccEEEccCCccccchh--hhcCCcCCEEEccCCcccCch-HHcCCCcCCEEECc
Confidence            344555555555555555555555555555555555555544  455555555555555555543 35555555555555


Q ss_pred             CCCccccchhhhCCCCCcEEeccCcCCCCccchhhhcCCCCCCEEEecCCCccchhcccccccccCCcccchhhhcCccc
Q 046723          262 ESDIEELPGELKALVNLKCLDLEYTGNLITIPRQLISNLSRLQVLRMFGASHKAIKEASENSILFGGGELIVEELLGLKH  341 (562)
Q Consensus       262 ~~~l~~lp~~~~~l~~L~~L~l~~~~~l~~~p~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~  341 (562)
                      +|.+..+|. +..+++|++|++++|.....++.  +..+++|++|++.+|....                 ...+..+++
T Consensus       119 ~n~i~~~~~-~~~l~~L~~L~l~~n~~~~~~~~--~~~l~~L~~L~l~~~~~~~-----------------~~~~~~l~~  178 (347)
T 4fmz_A          119 EDNISDISP-LANLTKMYSLNLGANHNLSDLSP--LSNMTGLNYLTVTESKVKD-----------------VTPIANLTD  178 (347)
T ss_dssp             TSCCCCCGG-GTTCTTCCEEECTTCTTCCCCGG--GTTCTTCCEEECCSSCCCC-----------------CGGGGGCTT
T ss_pred             CCcccCchh-hccCCceeEEECCCCCCcccccc--hhhCCCCcEEEecCCCcCC-----------------chhhccCCC
Confidence            555555543 55555555555555544444333  4555555555555554332                 111444455


Q ss_pred             cceeeEEEecccchHHHHhhhhhhccccceeeccccCCCccchhhhhhhcccCeeeeccccccceeeccchhhhhhhhhc
Q 046723          342 LEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTLLEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQQFAFR  421 (562)
Q Consensus       342 L~~L~l~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~  421 (562)
                      |+.|+++.+....+..    ....++|+.|+++++......+   +..+++|+.|++.++ .+..++. ..      .++
T Consensus       179 L~~L~l~~n~l~~~~~----~~~l~~L~~L~l~~n~l~~~~~---~~~~~~L~~L~l~~n-~l~~~~~-~~------~l~  243 (347)
T 4fmz_A          179 LYSLSLNYNQIEDISP----LASLTSLHYFTAYVNQITDITP---VANMTRLNSLKIGNN-KITDLSP-LA------NLS  243 (347)
T ss_dssp             CSEEECTTSCCCCCGG----GGGCTTCCEEECCSSCCCCCGG---GGGCTTCCEEECCSS-CCCCCGG-GT------TCT
T ss_pred             CCEEEccCCccccccc----ccCCCccceeecccCCCCCCch---hhcCCcCCEEEccCC-ccCCCcc-hh------cCC
Confidence            5555555444444332    1112245555554443222222   444455555555544 3333222 11      144


Q ss_pred             cccEEEEecCCCCCCCccccccCCCceEEEecC
Q 046723          422 SLNMVEICNCIKLKDLTFLVFAPNLKSIKVGIC  454 (562)
Q Consensus       422 ~L~~L~L~~c~~l~~l~~l~~l~~L~~L~L~~c  454 (562)
                      +|++|++++| .++.++.+..+++|++|++++|
T Consensus       244 ~L~~L~l~~n-~l~~~~~~~~l~~L~~L~l~~n  275 (347)
T 4fmz_A          244 QLTWLEIGTN-QISDINAVKDLTKLKMLNVGSN  275 (347)
T ss_dssp             TCCEEECCSS-CCCCCGGGTTCTTCCEEECCSS
T ss_pred             CCCEEECCCC-ccCCChhHhcCCCcCEEEccCC
Confidence            5555555555 3444444455555555555544
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 562
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 4e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]

 Score = 59.8 bits (143), Expect = 2e-10
 Identities = 24/101 (23%), Positives = 41/101 (40%), Gaps = 8/101 (7%)

Query: 205 CPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHCELTKLPVGISELVSLQHLDLSESD 264
              L       N             PSL+ LN+S+ +L +LP        L+ L  S + 
Sbjct: 259 LSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPP---RLERLIASFNH 315

Query: 265 IEELPGELKALVNLKCLDLEYTGNLITIPRQLISNLSRLQV 305
           + E+P   +   NLK L +EY  N +     +  ++  L++
Sbjct: 316 LAEVPELPQ---NLKQLHVEY--NPLREFPDIPESVEDLRM 351
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query562
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.69
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.63
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.57
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.51
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.5
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.41
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.37
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.23
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.2
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.07
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.02
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.02
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.02
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.85
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.81
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.72
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.69
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.75
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.41
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.58
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.41
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.79
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.85  E-value=1.6e-20  Score=187.79  Aligned_cols=284  Identities=18%  Similarity=0.235  Sum_probs=159.9

Q ss_pred             cccceEEeccccccccCCCCCCCccccEEEccccCccccchhhhcCCCCCcEEEecCCCCcccCcccCCcccCcEEeCCC
Q 046723          183 WEKARRLSLMQNQIRNLSEIPTCPHLLTLFLNENNLRKIHNDFFQFMPSLKVLNLSHCELTKLPVGISELVSLQHLDLSE  262 (562)
Q Consensus       183 ~~~l~~L~l~~~~~~~l~~~~~~~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~~~~~~lp~~~~~l~~L~~L~l~~  262 (562)
                      +.+++.|++.++.++.++++..+++|++|++++|.++++++  ++.+++|++|++++|.+..++. ++++++|++|++.+
T Consensus        43 l~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~--l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~~~~  119 (384)
T d2omza2          43 LDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNNQIADITP-LANLTNLTGLTLFN  119 (384)
T ss_dssp             HTTCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCS
T ss_pred             hCCCCEEECCCCCCCCccccccCCCCCEEeCcCCcCCCCcc--ccCCcccccccccccccccccc-cccccccccccccc
Confidence            45677788888777777777777888888888888777764  7778888888888887776653 77778888888777


Q ss_pred             CCccccchhhhCCCCCcEEeccCc-----------------------------------------CCCCccchhhhcCCC
Q 046723          263 SDIEELPGELKALVNLKCLDLEYT-----------------------------------------GNLITIPRQLISNLS  301 (562)
Q Consensus       263 ~~l~~lp~~~~~l~~L~~L~l~~~-----------------------------------------~~l~~~p~~~~~~l~  301 (562)
                      +.+..++... ....+.......+                                         ......... ...++
T Consensus       120 ~~~~~~~~~~-~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~l~  197 (384)
T d2omza2         120 NQITDIDPLK-NLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISV-LAKLT  197 (384)
T ss_dssp             SCCCCCGGGT-TCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGG-GGGCT
T ss_pred             cccccccccc-ccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccc-ccccc
Confidence            6655443211 1111111111100                                         000111111 45566


Q ss_pred             CCCEEEecCCCccchhcccccccccCCcccchhhhcCccccceeeEEEecccchHHHHhhhhhhccccceeeccccCCCc
Q 046723          302 RLQVLRMFGASHKAIKEASENSILFGGGELIVEELLGLKHLEVISLTLRNSHGLQSFLRSWKLRRCTRALLLQCFNDSTL  381 (562)
Q Consensus       302 ~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~  381 (562)
                      +++.+.+.++....                 .......++|+.|+++++....++.+    ...++|+.|++.++.....
T Consensus       198 ~~~~l~l~~n~i~~-----------------~~~~~~~~~L~~L~l~~n~l~~~~~l----~~l~~L~~L~l~~n~l~~~  256 (384)
T d2omza2         198 NLESLIATNNQISD-----------------ITPLGILTNLDELSLNGNQLKDIGTL----ASLTNLTDLDLANNQISNL  256 (384)
T ss_dssp             TCSEEECCSSCCCC-----------------CGGGGGCTTCCEEECCSSCCCCCGGG----GGCTTCSEEECCSSCCCCC
T ss_pred             ccceeeccCCccCC-----------------CCcccccCCCCEEECCCCCCCCcchh----hcccccchhccccCccCCC
Confidence            77777776665432                 12234455666666666655554322    1223666666666543322


Q ss_pred             cchhhhhhhcccCeeeeccccccceeeccchhhhhhhhhccccEEEEecCCCCCCCccccccCCCceEEEecCcchhhhh
Q 046723          382 LEVSALAYLKQLNRLQIANSVILEELKMDYAEEVQQFAFRSLNMVEICNCIKLKDLTFLVFAPNLKSIKVGICHAMEEIA  461 (562)
Q Consensus       382 ~~~~~l~~l~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~~L~~L~L~~c~~l~~l~~l~~l~~L~~L~L~~c~~l~~l~  461 (562)
                      .   .+..+++|+.|+++++ .+..++. +.      .++.++.+.+.++ .+..++.+..+++++.|+++++. +++++
T Consensus       257 ~---~~~~~~~L~~L~l~~~-~l~~~~~-~~------~~~~l~~l~~~~n-~l~~~~~~~~~~~l~~L~ls~n~-l~~l~  323 (384)
T d2omza2         257 A---PLSGLTKLTELKLGAN-QISNISP-LA------GLTALTNLELNEN-QLEDISPISNLKNLTYLTLYFNN-ISDIS  323 (384)
T ss_dssp             G---GGTTCTTCSEEECCSS-CCCCCGG-GT------TCTTCSEEECCSS-CCSCCGGGGGCTTCSEEECCSSC-CSCCG
T ss_pred             C---cccccccCCEeeccCc-ccCCCCc-cc------ccccccccccccc-ccccccccchhcccCeEECCCCC-CCCCc
Confidence            2   2555666777777655 3333321 11      1555666666665 45555556666666666666542 33331


Q ss_pred             cCCCCCCccccccCCCCccccceeeccCCcCCcccCcCCCCCCCcceeeeccCCCCcccc
Q 046723          462 SEGKFAEVPEVMANLNPFEKLQNLEVAGARNLKSIYWKPLPFPHLKAMSFLHCKKLKKLP  521 (562)
Q Consensus       462 ~~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~L~~~~~~~~~~~~L~~L~i~~C~~L~~lp  521 (562)
                                   .+..+++|++|++++| .++.++ ....+++|++|++++| +++.+|
T Consensus       324 -------------~l~~l~~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~N-~l~~l~  367 (384)
T d2omza2         324 -------------PVSSLTKLQRLFFANN-KVSDVS-SLANLTNINWLSAGHN-QISDLT  367 (384)
T ss_dssp             -------------GGGGCTTCCEEECCSS-CCCCCG-GGGGCTTCCEEECCSS-CCCBCG
T ss_pred             -------------ccccCCCCCEEECCCC-CCCCCh-hHcCCCCCCEEECCCC-cCCCCh
Confidence                         1344666666666665 455443 2334566666666655 455554
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure