Citrus Sinensis ID: 046775

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-
VLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGRGKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYACMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPEKSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSHARSKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGATIRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCGGYW
cccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccEEHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHcccccccEEEHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEcHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHcHHccccccccccHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHcccEEEEcccccccccccccccccccc
cHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEcccccccccccEEcccccc
vlkactskkdLFLGLQVHGIVvftgfdsdefVANSLVVMYAKCgnfidsrrlfdaipersvVSWNSLFSCYVHCDFLEEAVCFFKEMvlsgirpnefsLSSMINACagsgdsllgrkihgysiklgydsdmfSANALVDMYAKVGNLEDAVAVfkdiehpdivsWNAVIAGCVLHEHNDWALKLFQQMksseinpnmfTYTSALKACAGMELKELGRQLHCSLIKmeiksdpivgVGLVDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISGhlqnggdmeaaslfpwmyregvgfdqtTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAygkcghveDAVKIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQdreinpdsfVCSSLLNACANLSAYEQGKQVHVHIIKFgfmsdtfagNSLVNMYAKcgsiddadrafseipdrgivSWSAMIGGLAQHGRGKEALQMFGQMledgvlpnhITLVSVLCACNHAGLVAEAKHHFESmekkfgiqpmQEHYACMIDILGRAGKFQEAMELVdtmpfqanASVWGALLGAARIYKNVEVGQHAAEMLFAiepeksstHVLLSNIYASAGMWDNVAKVRRFMKdnklkkepgmswievKDKVytftvgdrshaRSKEIYAKLDEVSDLLnkagyvpmvetdlhdveesekEQLLYHHSEKLAVAFGliatppgatirvkKNLRICVDCHTSFEFISKIVSreiivrdvnrfhhfrngscscggyw
vlkactskkdlflgLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGRGKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYACMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPEKSSTHVLLSNIYASAGMWDNVAKVRRFMKdnklkkepgmswievkdkvytftvgdrsharsKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGATIRVKKNLRICVDCHTSFEFISKIVSREIIVrdvnrfhhfrngscscggyw
VLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGRGKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYACMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPEKSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSHARSKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGATIRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCGGYW
*******KKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGRGKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYACMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPEKSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSHARSKEIYAKLDEVSDLLNKAGYVPMVETDLHDV*****EQLLYHHSEKLAVAFGLIATPPGATIRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCGGY*
VLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGRGKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYACMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPEKSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSHARSKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGATIRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCGGYW
VLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGRGKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYACMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPEKSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSHARSKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGATIRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCGGYW
VLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGRGKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYACMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPEKSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSHARSKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGATIRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCGGYW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGRGKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYACMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPEKSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSHARSKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGATIRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCGGYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query771 2.2.26 [Sep-21-2011]
Q9SVP71064 Pentatricopeptide repeat- yes no 0.990 0.718 0.390 1e-175
Q7Y211890 Pentatricopeptide repeat- no no 0.998 0.865 0.394 1e-170
Q9ZUW3868 Pentatricopeptide repeat- no no 0.994 0.883 0.391 1e-165
Q5G1T1850 Pentatricopeptide repeat- no no 0.997 0.904 0.382 1e-160
Q9SMZ2990 Pentatricopeptide repeat- no no 0.928 0.723 0.411 1e-160
Q9S7F4825 Putative pentatricopeptid no no 0.955 0.893 0.373 1e-155
Q3E6Q1809 Pentatricopeptide repeat- no no 0.993 0.946 0.363 1e-154
Q9SN39871 Pentatricopeptide repeat- no no 1.0 0.885 0.357 1e-153
Q0WN60970 Pentatricopeptide repeat- no no 1.0 0.794 0.363 1e-152
Q9LTV8694 Pentatricopeptide repeat- no no 0.894 0.994 0.374 1e-151
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function desciption
 Score =  617 bits (1590), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 301/771 (39%), Positives = 476/771 (61%)

Query: 1    VLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERS 60
            VL AC   + L +G Q+HG+V+  GF SD +V N+LV +Y   GN I +  +F  + +R 
Sbjct: 294  VLSACKKIESLEIGEQLHGLVLKLGFSSDTYVCNALVSLYFHLGNLISAEHIFSNMSQRD 353

Query: 61   VVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHG 120
             V++N+L +    C + E+A+  FK M L G+ P+  +L+S++ AC+  G    G+++H 
Sbjct: 354  AVTYNTLINGLSQCGYGEKAMELFKRMHLDGLEPDSNTLASLVVACSADGTLFRGQQLHA 413

Query: 121  YSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDW 180
            Y+ KLG+ S+     AL+++YAK  ++E A+  F + E  ++V WN ++    L +    
Sbjct: 414  YTTKLGFASNNKIEGALLNLYAKCADIETALDYFLETEVENVVLWNVMLVAYGLLDDLRN 473

Query: 181  ALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVD 240
            + ++F+QM+  EI PN +TY S LK C  +   ELG Q+H  +IK   + +  V   L+D
Sbjct: 474  SFRIFRQMQIEEIVPNQYTYPSILKTCIRLGDLELGEQIHSQIIKTNFQLNAYVCSVLID 533

Query: 241  MYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTT 300
            MYAK G +D A  I      K++++W  +I+G+ Q   D +A + F  M   G+  D+  
Sbjct: 534  MYAKLGKLDTAWDILIRFAGKDVVSWTTMIAGYTQYNFDDKALTTFRQMLDRGIRSDEVG 593

Query: 301  LSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESS 360
            L+  + + A  QA+   +Q+HA +  + F SD    N+L+  Y +CG +E++   F+++ 
Sbjct: 594  LTNAVSACAGLQALKEGQQIHAQACVSGFSSDLPFQNALVTLYSRCGKIEESYLAFEQTE 653

Query: 361  AVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQ 420
            A D +A  ++++ + Q G  EEAL++++ M    I+ ++F   S + A +  +  +QGKQ
Sbjct: 654  AGDNIAWNALVSGFQQSGNNEEALRVFVRMNREGIDNNNFTFGSAVKAASETANMKQGKQ 713

Query: 421  VHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGR 480
            VH  I K G+ S+T   N+L++MYAKCGSI DA++ F E+  +  VSW+A+I   ++HG 
Sbjct: 714  VHAVITKTGYDSETEVCNALISMYAKCGSISDAEKQFLEVSTKNEVSWNAIINAYSKHGF 773

Query: 481  GKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYA 540
            G EAL  F QM+   V PNH+TLV VL AC+H GLV +   +FESM  ++G+ P  EHY 
Sbjct: 774  GSEALDSFDQMIHSNVRPNHVTLVGVLSACSHIGLVDKGIAYFESMNSEYGLSPKPEHYV 833

Query: 541  CMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPE 600
            C++D+L RAG    A E +  MP + +A VW  LL A  ++KN+E+G+ AA  L  +EPE
Sbjct: 834  CVVDMLTRAGLLSRAKEFIQEMPIKPDALVWRTLLSACVVHKNMEIGEFAAHHLLELEPE 893

Query: 601  KSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSHAR 660
             S+T+VLLSN+YA +  WD     R+ MK+  +KKEPG SWIEVK+ +++F VGD++H  
Sbjct: 894  DSATYVLLSNLYAVSKKWDARDLTRQKMKEKGVKKEPGQSWIEVKNSIHSFYVGDQNHPL 953

Query: 661  SKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGA 720
            + EI+    +++   ++ GYV    + L++++  +K+ +++ HSEKLA++FGL++ P   
Sbjct: 954  ADEIHEYFQDLTKRASEIGYVQDCFSLLNELQHEQKDPIIFIHSEKLAISFGLLSLPATV 1013

Query: 721  TIRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCGGYW 771
             I V KNLR+C DCH   +F+SK+ +REIIVRD  RFHHF  G+CSC  YW
Sbjct: 1014 PINVMKNLRVCNDCHAWIKFVSKVSNREIIVRDAYRFHHFEGGACSCKDYW 1064

Arabidopsis thaliana (taxid: 3702)
>sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protein At3g57430, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H81 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1 Back     alignment and function description
>sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protein At3g49170, chloroplastic OS=Arabidopsis thaliana GN=EMB2261 PE=2 SV=1 Back     alignment and function description
>sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protein At4g33170 OS=Arabidopsis thaliana GN=PCMP-H53 PE=3 SV=1 Back     alignment and function description
>sp|Q9S7F4|PP206_ARATH Putative pentatricopeptide repeat-containing protein At2g01510 OS=Arabidopsis thaliana GN=PCMP-H36 PE=3 SV=1 Back     alignment and function description
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1 Back     alignment and function description
>sp|Q0WN60|PPR48_ARATH Pentatricopeptide repeat-containing protein At1g18485 OS=Arabidopsis thaliana GN=PCMP-H8 PE=2 SV=2 Back     alignment and function description
>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query771
224077074786 predicted protein [Populus trichocarpa] 0.989 0.970 0.779 0.0
359483488 933 PREDICTED: pentatricopeptide repeat-cont 0.994 0.822 0.748 0.0
356555301858 PREDICTED: pentatricopeptide repeat-cont 0.994 0.893 0.714 0.0
147805537 906 hypothetical protein VITISV_023708 [Viti 0.964 0.821 0.722 0.0
449485624863 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.989 0.884 0.631 0.0
297719939 877 Os01g0355000 [Oryza sativa Japonica Grou 0.988 0.868 0.601 0.0
125570322 877 hypothetical protein OsJ_01713 [Oryza sa 0.988 0.868 0.601 0.0
222641140784 hypothetical protein OsJ_28537 [Oryza sa 0.988 0.971 0.596 0.0
115478174 877 Os09g0251500 [Oryza sativa Japonica Grou 0.988 0.868 0.596 0.0
413922867 882 putative pentatricopeptide repeat family 0.988 0.863 0.596 0.0
>gi|224077074|ref|XP_002305120.1| predicted protein [Populus trichocarpa] gi|222848084|gb|EEE85631.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1257 bits (3252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/771 (77%), Positives = 672/771 (87%)

Query: 1   VLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERS 60
           VLKACT  KDL LG QVHGIVV TGFDSDEFVANSLV++YAKCG F D+R LFDAIP+RS
Sbjct: 16  VLKACTVTKDLVLGKQVHGIVVVTGFDSDEFVANSLVILYAKCGGFGDARSLFDAIPDRS 75

Query: 61  VVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHG 120
           VVSWN+LFSCYVH D   EAV  F +MVLSGIRPNEFSLSSMIN C G  DS+ GRKIHG
Sbjct: 76  VVSWNALFSCYVHSDMHGEAVSLFHDMVLSGIRPNEFSLSSMINVCTGLEDSVQGRKIHG 135

Query: 121 YSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDW 180
           Y IKLGYDSD FSANALVDMYAKVG LEDA +VF +I  PDIVSWNA+IAGCVLHE++  
Sbjct: 136 YLIKLGYDSDAFSANALVDMYAKVGILEDASSVFDEIAKPDIVSWNAIIAGCVLHEYHHR 195

Query: 181 ALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVD 240
           AL+L ++M  S + PNMFT +SALKACAGM L+ELGRQLH SLIKM++ SD  +GVGL+D
Sbjct: 196 ALELLREMNKSGMCPNMFTLSSALKACAGMALRELGRQLHSSLIKMDMGSDSFLGVGLID 255

Query: 241 MYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTT 300
           MY+KC SMD+AR++F LMPE+++IAWN VISGH QN  D EAASLFP M+ EG+GF+QTT
Sbjct: 256 MYSKCNSMDDARLVFKLMPERDMIAWNAVISGHSQNEEDEEAASLFPLMHTEGIGFNQTT 315

Query: 301 LSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESS 360
           LSTVLKS+A+ QA  +C+Q+HALS+K+ FE D+Y+VNSLID YGKCGHVEDA ++F+ES 
Sbjct: 316 LSTVLKSIAALQANYMCRQIHALSLKSGFEFDNYVVNSLIDTYGKCGHVEDATRVFEESP 375

Query: 361 AVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQ 420
            VDLV  TS++TAYAQ G GEEAL+LYLEMQDR I PDSFVCSSLLNACA+LSAYEQGKQ
Sbjct: 376 IVDLVLFTSLVTAYAQDGQGEEALRLYLEMQDRGIKPDSFVCSSLLNACASLSAYEQGKQ 435

Query: 421 VHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGR 480
           VHVHI+KFGFMSD FAGNSLVNMYAKCGSI+DA  AFS IP RGIVSWSAMIGGLAQHG 
Sbjct: 436 VHVHILKFGFMSDIFAGNSLVNMYAKCGSIEDASCAFSRIPVRGIVSWSAMIGGLAQHGY 495

Query: 481 GKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYA 540
           GKEALQ+F QML+ GV PNHITLVSVLCACNHAGLVAEAKH+F SM+  FGI+PMQEHYA
Sbjct: 496 GKEALQLFKQMLKVGVPPNHITLVSVLCACNHAGLVAEAKHYFNSMKILFGIEPMQEHYA 555

Query: 541 CMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPE 600
           CMID+LGRAGK + AMELV+ MPFQANA VWGALLGAARI+KN+++G+ AAEML A+EPE
Sbjct: 556 CMIDLLGRAGKLEAAMELVNKMPFQANALVWGALLGAARIHKNIDLGEQAAEMLLALEPE 615

Query: 601 KSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSHAR 660
           KS THVLL+NIYAS GMWD VA+VRR MKD K+KKEPGMSW+EVKDKVYTF VGDRSH+R
Sbjct: 616 KSGTHVLLANIYASVGMWDKVARVRRLMKDGKVKKEPGMSWLEVKDKVYTFIVGDRSHSR 675

Query: 661 SKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGA 720
           S EIYAKLDE+SDLL KAGYVPMVE DLHDVE SEKEQLLYHHSEKLAVAFGLIATPPGA
Sbjct: 676 STEIYAKLDELSDLLKKAGYVPMVEIDLHDVERSEKEQLLYHHSEKLAVAFGLIATPPGA 735

Query: 721 TIRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCGGYW 771
            IRVKKNLRIC DCHT  +FISKIVSREIIVRD NRFHHFR GSCSCG YW
Sbjct: 736 PIRVKKNLRICFDCHTVLKFISKIVSREIIVRDTNRFHHFREGSCSCGEYW 786

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359483488|ref|XP_002273710.2| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356555301|ref|XP_003545972.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|147805537|emb|CAN74095.1| hypothetical protein VITISV_023708 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449485624|ref|XP_004157227.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297719939|ref|NP_001172331.1| Os01g0355000 [Oryza sativa Japonica Group] gi|53791352|dbj|BAD52598.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|215768699|dbj|BAH00928.1| unnamed protein product [Oryza sativa Japonica Group] gi|255673214|dbj|BAH91061.1| Os01g0355000 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125570322|gb|EAZ11837.1| hypothetical protein OsJ_01713 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|222641140|gb|EEE69272.1| hypothetical protein OsJ_28537 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115478174|ref|NP_001062682.1| Os09g0251500 [Oryza sativa Japonica Group] gi|47848472|dbj|BAD22327.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|47848643|dbj|BAD22491.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|113630915|dbj|BAF24596.1| Os09g0251500 [Oryza sativa Japonica Group] gi|215767397|dbj|BAG99625.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|413922867|gb|AFW62799.1| putative pentatricopeptide repeat family protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query771
TAIR|locus:21194401064 AT4G13650 [Arabidopsis thalian 1.0 0.724 0.390 4e-161
TAIR|locus:2103483890 OTP84 "ORGANELLE TRANSCRIPT PR 0.964 0.835 0.398 2.2e-153
TAIR|locus:2038603868 AT2G27610 "AT2G27610" [Arabido 0.994 0.883 0.391 1.4e-151
TAIR|locus:2082886850 EMB2261 "embryo defective 2261 0.997 0.904 0.383 2.3e-151
TAIR|locus:2078653825 AT3G02010 [Arabidopsis thalian 0.954 0.892 0.374 8.4e-149
TAIR|locus:2125899990 AT4G33170 [Arabidopsis thalian 0.928 0.723 0.411 1.6e-148
TAIR|locus:2032840937 AT1G16480 "AT1G16480" [Arabido 1.0 0.822 0.376 1.5e-147
TAIR|locus:2202074809 CRR22 "CHLORORESPIRATORY REDUC 0.993 0.946 0.363 4.8e-142
TAIR|locus:505006130970 AT1G18485 [Arabidopsis thalian 1.0 0.794 0.363 1.3e-141
TAIR|locus:2124137871 DOT4 "DEFECTIVELY ORGANIZED TR 1.0 0.885 0.357 1.6e-141
TAIR|locus:2119440 AT4G13650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1569 (557.4 bits), Expect = 4.0e-161, P = 4.0e-161
 Identities = 301/771 (39%), Positives = 476/771 (61%)

Query:     1 VLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERS 60
             VL AC   + L +G Q+HG+V+  GF SD +V N+LV +Y   GN I +  +F  + +R 
Sbjct:   294 VLSACKKIESLEIGEQLHGLVLKLGFSSDTYVCNALVSLYFHLGNLISAEHIFSNMSQRD 353

Query:    61 VVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHG 120
              V++N+L +    C + E+A+  FK M L G+ P+  +L+S++ AC+  G    G+++H 
Sbjct:   354 AVTYNTLINGLSQCGYGEKAMELFKRMHLDGLEPDSNTLASLVVACSADGTLFRGQQLHA 413

Query:   121 YSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDW 180
             Y+ KLG+ S+     AL+++YAK  ++E A+  F + E  ++V WN ++    L +    
Sbjct:   414 YTTKLGFASNNKIEGALLNLYAKCADIETALDYFLETEVENVVLWNVMLVAYGLLDDLRN 473

Query:   181 ALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVD 240
             + ++F+QM+  EI PN +TY S LK C  +   ELG Q+H  +IK   + +  V   L+D
Sbjct:   474 SFRIFRQMQIEEIVPNQYTYPSILKTCIRLGDLELGEQIHSQIIKTNFQLNAYVCSVLID 533

Query:   241 MYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTT 300
             MYAK G +D A  I      K++++W  +I+G+ Q   D +A + F  M   G+  D+  
Sbjct:   534 MYAKLGKLDTAWDILIRFAGKDVVSWTTMIAGYTQYNFDDKALTTFRQMLDRGIRSDEVG 593

Query:   301 LSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESS 360
             L+  + + A  QA+   +Q+HA +  + F SD    N+L+  Y +CG +E++   F+++ 
Sbjct:   594 LTNAVSACAGLQALKEGQQIHAQACVSGFSSDLPFQNALVTLYSRCGKIEESYLAFEQTE 653

Query:   361 AVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQ 420
             A D +A  ++++ + Q G  EEAL++++ M    I+ ++F   S + A +  +  +QGKQ
Sbjct:   654 AGDNIAWNALVSGFQQSGNNEEALRVFVRMNREGIDNNNFTFGSAVKAASETANMKQGKQ 713

Query:   421 VHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGR 480
             VH  I K G+ S+T   N+L++MYAKCGSI DA++ F E+  +  VSW+A+I   ++HG 
Sbjct:   714 VHAVITKTGYDSETEVCNALISMYAKCGSISDAEKQFLEVSTKNEVSWNAIINAYSKHGF 773

Query:   481 GKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYA 540
             G EAL  F QM+   V PNH+TLV VL AC+H GLV +   +FESM  ++G+ P  EHY 
Sbjct:   774 GSEALDSFDQMIHSNVRPNHVTLVGVLSACSHIGLVDKGIAYFESMNSEYGLSPKPEHYV 833

Query:   541 CMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPE 600
             C++D+L RAG    A E +  MP + +A VW  LL A  ++KN+E+G+ AA  L  +EPE
Sbjct:   834 CVVDMLTRAGLLSRAKEFIQEMPIKPDALVWRTLLSACVVHKNMEIGEFAAHHLLELEPE 893

Query:   601 KSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSHAR 660
              S+T+VLLSN+YA +  WD     R+ MK+  +KKEPG SWIEVK+ +++F VGD++H  
Sbjct:   894 DSATYVLLSNLYAVSKKWDARDLTRQKMKEKGVKKEPGQSWIEVKNSIHSFYVGDQNHPL 953

Query:   661 SKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGA 720
             + EI+    +++   ++ GYV    + L++++  +K+ +++ HSEKLA++FGL++ P   
Sbjct:   954 ADEIHEYFQDLTKRASEIGYVQDCFSLLNELQHEQKDPIIFIHSEKLAISFGLLSLPATV 1013

Query:   721 TIRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCGGYW 771
              I V KNLR+C DCH   +F+SK+ +REIIVRD  RFHHF  G+CSC  YW
Sbjct:  1014 PINVMKNLRVCNDCHAWIKFVSKVSNREIIVRDAYRFHHFEGGACSCKDYW 1064
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2103483 OTP84 "ORGANELLE TRANSCRIPT PROCESSING 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038603 AT2G27610 "AT2G27610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082886 EMB2261 "embryo defective 2261" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078653 AT3G02010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125899 AT4G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032840 AT1G16480 "AT1G16480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202074 CRR22 "CHLORORESPIRATORY REDUCTION22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006130 AT1G18485 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124137 DOT4 "DEFECTIVELY ORGANIZED TRIBUTARIES 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query771
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 0.0
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-171
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-64
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-38
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 2e-22
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-10
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-08
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 4e-04
pfam0153531 pfam01535, PPR, PPR repeat 6e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information 
 Score =  596 bits (1539), Expect = 0.0
 Identities = 268/768 (34%), Positives = 452/768 (58%), Gaps = 3/768 (0%)

Query: 1   VLKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERS 60
           + + C  K+ +  G +V    + +       + N+++ M+ + G  + +  +F  +PER 
Sbjct: 92  LFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPERD 151

Query: 61  VVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHG 120
           + SWN L   Y    + +EA+C +  M+ +G+RP+ ++   ++  C G  D   GR++H 
Sbjct: 152 LFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHA 211

Query: 121 YSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPDIVSWNAVIAGCVLHEHNDW 180
           + ++ G++ D+   NAL+ MY K G++  A  VF  +   D +SWNA+I+G   +     
Sbjct: 212 HVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLE 271

Query: 181 ALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVD 240
            L+LF  M+   ++P++ T TS + AC  +  + LGR++H  ++K     D  V   L+ 
Sbjct: 272 GLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQ 331

Query: 241 MYAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTT 300
           MY   GS  EA  +F  M  K+ ++W  +ISG+ +NG   +A   +  M ++ V  D+ T
Sbjct: 332 MYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEIT 391

Query: 301 LSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESS 360
           +++VL + A    + V  ++H L+ +    S   + N+LI+ Y KC  ++ A+++F    
Sbjct: 392 IASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIP 451

Query: 361 AVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQ 420
             D+++ TS+I          EAL  + +M    + P+S    + L+ACA + A   GK+
Sbjct: 452 EKDVISWTSIIAGLRLNNRCFEALIFFRQML-LTLKPNSVTLIAALSACARIGALMCGKE 510

Query: 421 VHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGR 480
           +H H+++ G   D F  N+L+++Y +CG ++ A   F+   ++ +VSW+ ++ G   HG+
Sbjct: 511 IHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFN-SHEKDVVSWNILLTGYVAHGK 569

Query: 481 GKEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYA 540
           G  A+++F +M+E GV P+ +T +S+LCAC+ +G+V +   +F SME+K+ I P  +HYA
Sbjct: 570 GSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYA 629

Query: 541 CMIDILGRAGKFQEAMELVDTMPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPE 600
           C++D+LGRAGK  EA   ++ MP   + +VWGALL A RI+++VE+G+ AA+ +F ++P 
Sbjct: 630 CVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPN 689

Query: 601 KSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSWIEVKDKVYTFTVGDRSHAR 660
               ++LL N+YA AG WD VA+VR+ M++N L  +PG SW+EVK KV+ F   D SH +
Sbjct: 690 SVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQ 749

Query: 661 SKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGA 720
            KEI   L+   + +  +G      + + ++E S+ + +   HSE+LA+AFGLI T PG 
Sbjct: 750 IKEINTVLEGFYEKMKASGLAGSESSSMDEIEVSKDD-IFCGHSERLAIAFGLINTVPGM 808

Query: 721 TIRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCG 768
            I V KNL +C +CH + +FISKIV REI VRD  +FHHF++G CSCG
Sbjct: 809 PIWVTKNLYMCENCHNTVKFISKIVRREISVRDTEQFHHFKDGECSCG 856

Length = 857
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 771
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.92
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.92
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.87
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.82
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.81
PRK11788389 tetratricopeptide repeat protein; Provisional 99.81
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.78
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.77
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.76
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.75
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.74
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.74
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.73
PRK14574 822 hmsH outer membrane protein; Provisional 99.72
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.71
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.68
PRK14574822 hmsH outer membrane protein; Provisional 99.65
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.63
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.61
KOG2076895 consensus RNA polymerase III transcription factor 99.56
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.53
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.53
KOG2076895 consensus RNA polymerase III transcription factor 99.52
KOG2003840 consensus TPR repeat-containing protein [General f 99.52
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.51
KOG0547606 consensus Translocase of outer mitochondrial membr 99.42
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.38
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.38
KOG2003840 consensus TPR repeat-containing protein [General f 99.37
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.36
KOG1915677 consensus Cell cycle control protein (crooked neck 99.35
KOG1126638 consensus DNA-binding cell division cycle control 99.35
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.34
KOG1126638 consensus DNA-binding cell division cycle control 99.33
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.33
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.32
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.32
KOG1915677 consensus Cell cycle control protein (crooked neck 99.31
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.31
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.3
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.3
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.27
PF1304150 PPR_2: PPR repeat family 99.23
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.22
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.21
PF1304150 PPR_2: PPR repeat family 99.21
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.19
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.18
PRK12370553 invasion protein regulator; Provisional 99.18
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.17
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.16
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.14
KOG0547606 consensus Translocase of outer mitochondrial membr 99.11
PRK11189296 lipoprotein NlpI; Provisional 99.1
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.05
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.03
PRK12370553 invasion protein regulator; Provisional 99.02
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.0
KOG2376652 consensus Signal recognition particle, subunit Srp 98.99
KOG1129478 consensus TPR repeat-containing protein [General f 98.99
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.98
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.95
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.94
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.92
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.92
PRK11189296 lipoprotein NlpI; Provisional 98.89
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.88
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.87
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.84
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.83
KOG2376652 consensus Signal recognition particle, subunit Srp 98.79
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.79
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.76
KOG1129478 consensus TPR repeat-containing protein [General f 98.74
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.69
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.62
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.6
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.57
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.53
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.53
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.53
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.51
PRK04841903 transcriptional regulator MalT; Provisional 98.5
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.5
PF1285434 PPR_1: PPR repeat 98.46
PRK15359144 type III secretion system chaperone protein SscB; 98.46
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.44
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.42
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.42
PF1285434 PPR_1: PPR repeat 98.41
KOG1128777 consensus Uncharacterized conserved protein, conta 98.41
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.4
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.39
PRK04841903 transcriptional regulator MalT; Provisional 98.39
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.38
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.38
KOG1125579 consensus TPR repeat-containing protein [General f 98.38
PLN02789320 farnesyltranstransferase 98.38
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.37
PRK10370198 formate-dependent nitrite reductase complex subuni 98.33
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.27
KOG1125579 consensus TPR repeat-containing protein [General f 98.27
PRK15359144 type III secretion system chaperone protein SscB; 98.23
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.19
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.17
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.15
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.14
PRK10370198 formate-dependent nitrite reductase complex subuni 98.13
KOG1128777 consensus Uncharacterized conserved protein, conta 98.13
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.1
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.09
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.09
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.05
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.04
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.03
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.02
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.02
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.01
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.0
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.99
PLN02789320 farnesyltranstransferase 97.97
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.95
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.95
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.93
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.89
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.75
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.72
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.68
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.67
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.66
KOG0553304 consensus TPR repeat-containing protein [General f 97.65
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.6
COG3898531 Uncharacterized membrane-bound protein [Function u 97.57
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.56
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.55
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.51
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.49
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.48
PF1343134 TPR_17: Tetratricopeptide repeat 97.47
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.46
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.46
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.46
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.44
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.41
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.41
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.37
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.36
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.35
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.33
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.32
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.31
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.28
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.25
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.21
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.2
PRK15331165 chaperone protein SicA; Provisional 97.18
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.17
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.17
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.12
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.11
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.11
COG4700251 Uncharacterized protein conserved in bacteria cont 97.11
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.08
PF1337173 TPR_9: Tetratricopeptide repeat 97.06
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.05
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.05
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.01
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.94
KOG0553304 consensus TPR repeat-containing protein [General f 96.92
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.91
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.88
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.88
PF12688120 TPR_5: Tetratrico peptide repeat 96.78
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.73
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.7
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.66
PF1342844 TPR_14: Tetratricopeptide repeat 96.62
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.59
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.58
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.56
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.53
COG4700251 Uncharacterized protein conserved in bacteria cont 96.45
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.33
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.33
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.29
PRK10803263 tol-pal system protein YbgF; Provisional 96.29
KOG20411189 consensus WD40 repeat protein [General function pr 96.25
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.23
PRK10803263 tol-pal system protein YbgF; Provisional 96.23
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.21
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.21
PF12688120 TPR_5: Tetratrico peptide repeat 96.18
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.16
PF1337173 TPR_9: Tetratricopeptide repeat 96.14
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.14
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.11
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.09
KOG4555175 consensus TPR repeat-containing protein [Function 96.08
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.07
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.01
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.93
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.82
COG3898531 Uncharacterized membrane-bound protein [Function u 95.67
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.53
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.34
PRK11906458 transcriptional regulator; Provisional 95.2
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.1
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.06
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.04
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.79
KOG20411189 consensus WD40 repeat protein [General function pr 94.72
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.66
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.54
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.41
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.4
smart00299140 CLH Clathrin heavy chain repeat homology. 94.37
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 94.32
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.29
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.26
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.19
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.15
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.13
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.03
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 94.01
PRK11906458 transcriptional regulator; Provisional 93.93
KOG3941406 consensus Intermediate in Toll signal transduction 93.93
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.69
KOG1258577 consensus mRNA processing protein [RNA processing 93.58
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.55
COG4235287 Cytochrome c biogenesis factor [Posttranslational 93.41
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.31
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.2
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.09
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.04
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.92
PF13512142 TPR_18: Tetratricopeptide repeat 92.71
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 92.61
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.47
KOG3941406 consensus Intermediate in Toll signal transduction 92.26
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.13
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 92.08
PF13512142 TPR_18: Tetratricopeptide repeat 92.02
COG3118304 Thioredoxin domain-containing protein [Posttransla 91.98
COG1729262 Uncharacterized protein conserved in bacteria [Fun 91.96
PRK12798421 chemotaxis protein; Reviewed 91.58
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 91.39
COG4105254 ComL DNA uptake lipoprotein [General function pred 91.34
smart00299140 CLH Clathrin heavy chain repeat homology. 91.26
KOG4234271 consensus TPR repeat-containing protein [General f 91.19
KOG1585308 consensus Protein required for fusion of vesicles 91.03
PRK09687280 putative lyase; Provisional 90.82
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 90.79
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.32
KOG1941518 consensus Acetylcholine receptor-associated protei 90.3
PRK15331165 chaperone protein SicA; Provisional 90.26
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 90.1
PF13281374 DUF4071: Domain of unknown function (DUF4071) 90.01
PF13170297 DUF4003: Protein of unknown function (DUF4003) 89.99
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 89.67
KOG2610491 consensus Uncharacterized conserved protein [Funct 89.4
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 89.37
COG1729262 Uncharacterized protein conserved in bacteria [Fun 89.11
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 89.05
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 88.64
PRK09687280 putative lyase; Provisional 88.55
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.42
KOG2610491 consensus Uncharacterized conserved protein [Funct 88.17
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.01
COG3629280 DnrI DNA-binding transcriptional activator of the 87.73
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 87.68
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 87.62
PF1342844 TPR_14: Tetratricopeptide repeat 87.55
COG3947361 Response regulator containing CheY-like receiver a 87.02
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 86.82
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 86.78
COG3629280 DnrI DNA-binding transcriptional activator of the 85.82
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.67
KOG4648 536 consensus Uncharacterized conserved protein, conta 85.41
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 84.78
KOG4570418 consensus Uncharacterized conserved protein [Funct 84.68
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 84.65
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 84.61
KOG4555175 consensus TPR repeat-containing protein [Function 84.02
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 83.91
PRK10941269 hypothetical protein; Provisional 83.66
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 82.99
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 82.67
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 82.22
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 82.2
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 82.02
PF13170297 DUF4003: Protein of unknown function (DUF4003) 81.7
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 81.4
KOG4570418 consensus Uncharacterized conserved protein [Funct 81.07
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.3e-165  Score=1450.02  Aligned_cols=765  Identities=35%  Similarity=0.675  Sum_probs=757.0

Q ss_pred             CchhhcCCCchhHHHHHHHHHHhCCCCChhhHHHHHHHHHcCCChHHHHHHHhcCCCCCcchHHHHHHHHHhCCChhHHH
Q 046775            2 LKACTSKKDLFLGLQVHGIVVFTGFDSDEFVANSLVVMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSCYVHCDFLEEAV   81 (771)
Q Consensus         2 l~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~ll~~y~~~g~~~~A~~~f~~~~~~~~~~~n~li~~~~~~g~~~~A~   81 (771)
                      +++|...+.+..|.++|+.+++.|+.++..++|+|+++|+++|+++.|+++|++|++||+++||+||.+|++.|++++|+
T Consensus        93 l~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~li~~~~~~g~~~~A~~~f~~m~~~d~~~~n~li~~~~~~g~~~~A~  172 (857)
T PLN03077         93 FRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEAL  172 (857)
T ss_pred             HHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHHHHhCCChHHHHHHHhcCCCCCeeEHHHHHHHHHhCCCHHHHH
Confidence            56788899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhHHCCCCCCcchHHHHHHHHhcCCCcHHHHHHHHHHHHhCCCCChhhHHHHHHHHHhcCChhHHHHHHccCCCCC
Q 046775           82 CFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEHPD  161 (771)
Q Consensus        82 ~l~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~i~~~~~~~g~~~~~~~~~~Li~~y~~~g~~~~A~~~f~~~~~~~  161 (771)
                      ++|++|...|+.||.+||+++|++|+..+++..++++|..+++.|+.||+.++|+||++|+++|++++|.++|++|++||
T Consensus       173 ~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~d  252 (857)
T PLN03077        173 CLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRD  252 (857)
T ss_pred             HHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccHHHHHHHHHhCCChhHHHHHHHHHHhCCCCCChhhHHHHHHHhhcCCcHHHHHHHHHHHHHccCCCChhHHHHHHHh
Q 046775          162 IVSWNAVIAGCVLHEHNDWALKLFQQMKSSEINPNMFTYTSALKACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDM  241 (771)
Q Consensus       162 ~~~~n~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~a~~l~~~~~~~g~~~~~~~~~~Li~~  241 (771)
                      +++||+||.+|++.|++++|+++|++|...|+.||..||+.++.+|+..|+++.|+++|..+.+.|+.||..+||+|+++
T Consensus       253 ~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~  332 (857)
T PLN03077        253 CISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQM  332 (857)
T ss_pred             cchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCChHHHHHHhhhCCCCCeehHHHHHHHHHhCCChhHHHHHHHHHHHCCCCCCHhhHHHHHHHHhccCChhHHHHHH
Q 046775          242 YAKCGSMDEARMIFHLMPEKNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVH  321 (771)
Q Consensus       242 y~~~g~~~~A~~~f~~m~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~pd~~t~~~ll~a~~~~~~~~~a~~i~  321 (771)
                      |+++|++++|.++|++|+.||+++||+||.+|++.|++++|+++|++|.+.|+.||..||++++.+|++.|+++.|.++|
T Consensus       333 y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~  412 (857)
T PLN03077        333 YLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLH  412 (857)
T ss_pred             HHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCCchHHHhHHHHHHHhcCCHHHHHHHHHhcCCCceecHHHHHHHHHHcCChHHHHHHHHHHhcCCCCCCHhh
Q 046775          322 ALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKESSAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFV  401 (771)
Q Consensus       322 ~~~~~~g~~~~~~~~~~Li~~y~k~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t  401 (771)
                      +.+.+.|+.++..++|+|+++|+++|++++|.++|++|.++|+++||+||.+|+++|+.++|+++|++|.. +++||.+|
T Consensus       413 ~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t  491 (857)
T PLN03077        413 ELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVT  491 (857)
T ss_pred             HHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999986 69999999


Q ss_pred             HHHHHHHhhcccchHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCCHHHHHHHHhhCCCCChhHHHHHHHHHHHcCCh
Q 046775          402 CSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIPDRGIVSWSAMIGGLAQHGRG  481 (771)
Q Consensus       402 ~~~ll~a~~~~~~~~~a~~i~~~~~~~g~~~~~~~~~~Li~~y~k~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~  481 (771)
                      |+++|.+|++.|+++.++++|..+.+.|+.+|..++|+||++|+|||++++|.++|+.+ .+|+++||+||.+|+++|+.
T Consensus       492 ~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~  570 (857)
T PLN03077        492 LIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKG  570 (857)
T ss_pred             HHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCH
Confidence            99999999999999999999999999999999999999999999999999999999999 99999999999999999999


Q ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCcHHHHHHHHHHHHHhhCCCCCcchHHHHHHHHhhcCCHHHHHHHHHh
Q 046775          482 KEALQMFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKFGIQPMQEHYACMIDILGRAGKFQEAMELVDT  561 (771)
Q Consensus       482 ~~A~~l~~~m~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~~~i~p~~~~y~~lv~~l~r~g~~~eA~~~~~~  561 (771)
                      ++|+++|++|.+.|+.||.+||+.+|.+|++.|++++|.++|++|.+++|+.|+.+||+|||++|+|+|+++||++++++
T Consensus       571 ~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~  650 (857)
T PLN03077        571 SMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINK  650 (857)
T ss_pred             HHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999998899999999999999999999999999999999


Q ss_pred             CCCCCCHhHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCchhHHHHHHHHHhcCCchhHHHHHHHHHhCCCccCCccce
Q 046775          562 MPFQANASVWGALLGAARIYKNVEVGQHAAEMLFAIEPEKSSTHVLLSNIYASAGMWDNVAKVRRFMKDNKLKKEPGMSW  641 (771)
Q Consensus       562 m~~~p~~~~~~~ll~a~~~~~~~~~a~~~~~~~~~l~p~~~~~~~~l~~~y~~~g~~~~a~~~~~~m~~~g~~k~~g~s~  641 (771)
                      ||++||..+|++|+++|+.|||++.|+.+++++++++|++++.|++|+|+|+..|+|++|.++|+.|+++|++|.|||||
T Consensus       651 m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~  730 (857)
T PLN03077        651 MPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSW  730 (857)
T ss_pred             CCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEcCEEEEEEeCCCCccchHHHHHHHHHHHHHHHhcCcccCCccccCCcchhhhhhhhccccHHHHHHcccccCCCCCe
Q 046775          642 IEVKDKVYTFTVGDRSHARSKEIYAKLDEVSDLLNKAGYVPMVETDLHDVEESEKEQLLYHHSEKLAVAFGLIATPPGAT  721 (771)
Q Consensus       642 i~~~~~~~~f~~~~~~h~~~~~i~~~l~~l~~~~~~~g~~p~~~~~~~~~~~~~~~~~~~~hse~la~~~~~~~~~~~~~  721 (771)
                      ||++|+||.|++||++||+.++||.+|++|..+|++.||+||++.++ |++||+||+.|++||||||||||||+||||+|
T Consensus       731 ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~g~~~~~~~~~-~~~~~~k~~~~~~hse~la~a~~l~~~~~~~~  809 (857)
T PLN03077        731 VEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGLAGSESSSM-DEIEVSKDDIFCGHSERLAIAFGLINTVPGMP  809 (857)
T ss_pred             EEECCEEEEEecCCCCCcchHHHHHHHHHHHHHHHhCCcCCCcchhc-cccHHHHHHHHHhccHHHHHHHhhhcCCCCCe
Confidence            99999999999999999999999999999999999999999999998 55889999999999999999999999999999


Q ss_pred             EEEeeccccccCccchhhhhhhhhcceEEEecCCccccccCCccCCCC
Q 046775          722 IRVKKNLRICVDCHTSFEFISKIVSREIIVRDVNRFHHFRNGSCSCGG  769 (771)
Q Consensus       722 ~~~~kn~r~c~dch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d  769 (771)
                      |||+||||||+|||+++||||||+||||||||++|||||+||+|||||
T Consensus       810 i~i~knlr~c~dch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d  857 (857)
T PLN03077        810 IWVTKNLYMCENCHNTVKFISKIVRREISVRDTEQFHHFKDGECSCGD  857 (857)
T ss_pred             EEEeCCCEeCccHHHHHHHHHHHhCeEEEEecCCcceeCCCCcccCCC
Confidence            999999999999999999999999999999999999999999999998

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query771
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 8e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-10
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-05
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 67.9 bits (164), Expect = 8e-12
 Identities = 21/184 (11%), Positives = 53/184 (28%), Gaps = 8/184 (4%)

Query: 80  AVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRKIHGYSIKLGYDSDMFSANALVD 139
           A C       +   P E  L+ ++    G     + +   G   +           A   
Sbjct: 76  AGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFK 135

Query: 140 MYAKVGNLEDAVAVFKDI-------EHPDIVSWNAVIAGCVLHEHNDWALKLFQQMKSSE 192
                  L  A  +           +   +  +NAV+ G          + +   +K + 
Sbjct: 136 CCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAG 195

Query: 193 INPNMFTYTSALKACAGME-LKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEA 251
           + P++ +Y +AL+     +       +    + +  +K   +    L+    +   +   
Sbjct: 196 LTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAV 255

Query: 252 RMIF 255
             + 
Sbjct: 256 HKVK 259
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query771
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.94
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.8
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.8
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.76
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.74
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.73
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.7
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.69
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.69
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.68
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.68
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.68
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.66
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.65
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.64
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.63
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.62
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.55
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.55
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.53
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.53
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.51
3u4t_A272 TPR repeat-containing protein; structural genomics 99.48
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.46
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.44
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.44
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.43
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.42
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.42
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.4
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.4
3u4t_A272 TPR repeat-containing protein; structural genomics 99.39
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.39
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.39
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.39
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.37
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.37
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.36
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.34
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.33
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.33
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.33
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.33
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.32
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.3
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.28
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.27
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.24
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.24
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.24
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.21
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.19
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.19
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.18
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.18
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.16
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.15
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.13
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.12
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.11
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.11
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.1
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.0
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.99
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.96
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.96
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.95
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.93
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.92
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.92
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.9
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.88
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.85
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.84
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.82
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.79
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.78
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.78
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.77
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.76
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.74
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.71
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.67
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.66
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.65
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.62
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.62
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.61
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.6
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.6
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.6
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.6
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.59
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.58
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.53
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.51
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.5
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.49
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.49
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.48
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.48
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.47
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.44
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.43
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.43
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.42
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.4
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.39
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.38
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.36
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.35
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.35
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.34
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.3
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.29
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.28
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.27
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.27
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.24
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.22
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.22
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.22
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.21
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.21
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.2
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.19
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.18
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.17
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.16
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.15
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.14
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.13
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.12
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.11
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.1
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.08
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.08
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.08
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.06
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.04
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.03
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.02
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.02
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.02
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.99
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.98
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.97
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.95
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.93
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.92
3k9i_A117 BH0479 protein; putative protein binding protein, 97.91
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.88
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.86
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.86
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.85
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.84
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.81
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.81
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.78
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.78
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.77
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.77
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.77
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.77
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.76
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.76
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.73
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.72
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.68
3k9i_A117 BH0479 protein; putative protein binding protein, 97.65
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.62
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.62
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.57
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.57
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.55
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.54
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.53
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.46
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.42
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.35
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.31
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.23
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.23
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.15
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.08
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.98
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.92
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.83
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.8
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.63
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.6
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.56
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.45
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.42
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.37
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.36
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.18
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.13
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.04
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.62
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.52
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.26
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.24
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.76
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 94.47
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.23
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.11
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.09
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.99
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.91
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.44
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 90.79
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 89.55
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 88.7
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 87.82
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 87.1
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 87.03
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 86.54
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 86.48
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 86.35
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 85.71
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 83.54
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 83.27
2p58_C116 Putative type III secretion protein YSCG; type III 82.99
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 82.91
2uwj_G115 Type III export protein PSCG; virulence, chaperone 82.51
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 81.74
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 80.17
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.3e-42  Score=397.72  Aligned_cols=498  Identities=9%  Similarity=-0.031  Sum_probs=363.9

Q ss_pred             HHHHcCCChHHHHHHHhcCCCCCcchHHHHHHHHHhCCChhHHHHHHHHhHHCCCCCCcchHHHHHHHHhcCCCcHHHHH
Q 046775           38 VMYAKCGNFIDSRRLFDAIPERSVVSWNSLFSCYVHCDFLEEAVCFFKEMVLSGIRPNEFSLSSMINACAGSGDSLLGRK  117 (771)
Q Consensus        38 ~~y~~~g~~~~A~~~f~~~~~~~~~~~n~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~  117 (771)
                      ..+.++|.+..++..|+.++.+++..|+.++..|.+.|++++|+.+|++|..  ..|+..++..+..+|...|+++.|.+
T Consensus        61 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~  138 (597)
T 2xpi_A           61 NNTSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKC  138 (597)
T ss_dssp             ---------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHH
T ss_pred             ccccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHH
Confidence            4467788899999999999999999999999999999999999999999985  56888999999999999999999999


Q ss_pred             HHHHHHHhCCCCChhhHHHHHHHHHhcCChhHHHHHHccCCC-C------------------CcccHHHHHHHHHhCCCh
Q 046775          118 IHGYSIKLGYDSDMFSANALVDMYAKVGNLEDAVAVFKDIEH-P------------------DIVSWNAVIAGCVLHEHN  178 (771)
Q Consensus       118 i~~~~~~~g~~~~~~~~~~Li~~y~~~g~~~~A~~~f~~~~~-~------------------~~~~~n~li~~~~~~g~~  178 (771)
                      ++..+...  +++..+++.++.+|.++|++++|.++|+++.. .                  +..+|+.++.+|.+.|++
T Consensus       139 ~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~  216 (597)
T 2xpi_A          139 LLTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNF  216 (597)
T ss_dssp             HHHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCH
T ss_pred             HHHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCH
Confidence            99988654  68889999999999999999999999995443 3                  478999999999999999


Q ss_pred             hHHHHHHHHHHhCCCCCChhh-HHHHHHHhhcCCcHHH--HHHH-HHHHHHccCCCChhHHHHHHHhhhcCCChHHHHHH
Q 046775          179 DWALKLFQQMKSSEINPNMFT-YTSALKACAGMELKEL--GRQL-HCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEARMI  254 (771)
Q Consensus       179 ~~A~~l~~~m~~~g~~p~~~t-~~~ll~a~~~~~~~~~--a~~l-~~~~~~~g~~~~~~~~~~Li~~y~~~g~~~~A~~~  254 (771)
                      ++|+++|++|.+.  .|+..+ +..+...+...+..+.  +..+ +..+...+......+++.++.+|.++|++++|.++
T Consensus       217 ~~A~~~~~~~~~~--~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~  294 (597)
T 2xpi_A          217 DRAKECYKEALMV--DAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDY  294 (597)
T ss_dssp             HHHHHHHHHHHHH--CTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHh--CchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHH
Confidence            9999999999885  354433 3333333332222221  1111 44455555556667788889999999999999999


Q ss_pred             hhhCCC--CCeehHHHHHHHHHhCCChhHHHHHHHHHHHCCCCCCHhhHHHHHHHHhccCChhHHHHHHHHHHHhcCCCc
Q 046775          255 FHLMPE--KNLIAWNIVISGHLQNGGDMEAASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESD  332 (771)
Q Consensus       255 f~~m~~--~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~pd~~t~~~ll~a~~~~~~~~~a~~i~~~~~~~g~~~~  332 (771)
                      |+++.+  ++..+|+.++.+|.+.|++++|+.+|+++.+.+                                    +.+
T Consensus       295 ~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~------------------------------------~~~  338 (597)
T 2xpi_A          295 LSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID------------------------------------PYN  338 (597)
T ss_dssp             HHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC------------------------------------TTC
T ss_pred             HHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC------------------------------------ccc
Confidence            999987  788888888888888888888888888887543                                    122


Q ss_pred             hHHHhHHHHHHHhcCCHHHHHHHHHhcC---CCceecHHHHHHHHHHcCChHHHHHHHHHHhcCCCCCCHhhHHHHHHHh
Q 046775          333 DYIVNSLIDAYGKCGHVEDAVKIFKESS---AVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNAC  409 (771)
Q Consensus       333 ~~~~~~Li~~y~k~g~~~~A~~~f~~~~---~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~  409 (771)
                      ..+++.++.+|.+.|++++|.++|+++.   ..+..+|+.++..|.+.|++++|.++|+++                   
T Consensus       339 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~-------------------  399 (597)
T 2xpi_A          339 LDVYPLHLASLHESGEKNKLYLISNDLVDRHPEKAVTWLAVGIYYLCVNKISEARRYFSKS-------------------  399 (597)
T ss_dssp             CTTHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTSHHHHHHHHHHHHHTTCHHHHHHHHHHH-------------------
T ss_pred             HHHHHHHHHHHHHhCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHhccHHHHHHHHHHH-------------------
Confidence            3334444444444444444444444332   223444444445555555555555544444                   


Q ss_pred             hcccchHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCCHHHHHHHHhhCC---CCChhHHHHHHHHHHHcCChHHHHH
Q 046775          410 ANLSAYEQGKQVHVHIIKFGFMSDTFAGNSLVNMYAKCGSIDDADRAFSEIP---DRGIVSWSAMIGGLAQHGRGKEALQ  486 (771)
Q Consensus       410 ~~~~~~~~a~~i~~~~~~~g~~~~~~~~~~Li~~y~k~g~~~~A~~~f~~~~---~~~~~~~~~li~~~~~~g~~~~A~~  486 (771)
                                      .+.. +.+..+++.++.+|.+.|++++|.++|+++.   ..+..+|+.++.+|.+.|++++|++
T Consensus       400 ----------------~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~  462 (597)
T 2xpi_A          400 ----------------STMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANE  462 (597)
T ss_dssp             ----------------HHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHH
T ss_pred             ----------------HHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHH
Confidence                            4332 3456677788888888888888888887664   3467788888888888888888888


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHhccCcHHHHHHHHHHHHHhh---CCCCC--cchHHHHHHHHhhcCCHHHHHHHHHh
Q 046775          487 MFGQMLEDGVLPNHITLVSVLCACNHAGLVAEAKHHFESMEKKF---GIQPM--QEHYACMIDILGRAGKFQEAMELVDT  561 (771)
Q Consensus       487 l~~~m~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~~---~i~p~--~~~y~~lv~~l~r~g~~~eA~~~~~~  561 (771)
                      +|++|.+.. +.+..++..+...|.+.|++++|.++|+++.+..   +..|+  ..+|..++.+|.+.|++++|.+.+++
T Consensus       463 ~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  541 (597)
T 2xpi_A          463 YLQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQ  541 (597)
T ss_dssp             HHHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             HHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHH
Confidence            888888742 3456788888888888888888888888887653   56777  67889999999999999999998888


Q ss_pred             CC-CCC-CHhHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCchhHHHHHHHHHh
Q 046775          562 MP-FQA-NASVWGALLGAARIYKNVEVGQHAAEMLFAIEPEKSSTHVLLSNIYAS  614 (771)
Q Consensus       562 m~-~~p-~~~~~~~ll~a~~~~~~~~~a~~~~~~~~~l~p~~~~~~~~l~~~y~~  614 (771)
                      +. ..| +..+|..+..+|...|+.+.|...++++++++|+++.+|..|+++|..
T Consensus       542 ~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~~  596 (597)
T 2xpi_A          542 GLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALEE  596 (597)
T ss_dssp             HHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTC-
T ss_pred             HHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCChHHHHHHHHHHhc
Confidence            73 445 677899999999999999999999999999999999999999998864
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query771
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.87
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.84
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.48
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.43
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.95
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.93
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.88
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.87
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.86
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.86
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.82
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.81
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.69
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.68
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.46
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.35
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.34
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.26
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.21
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.19
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.18
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.17
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.16
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.15
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.14
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.07
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.99
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.88
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.79
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.79
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.78
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.75
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.75
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.75
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.68
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.68
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.68
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.65
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.58
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.5
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.38
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.35
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.26
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.23
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.14
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.06
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.03
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.95
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.92
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.69
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.49
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.29
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 91.9
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 91.4
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 90.98
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 90.49
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 90.22
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.93
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 88.15
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 84.28
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.87  E-value=2.8e-19  Score=188.61  Aligned_cols=369  Identities=15%  Similarity=0.060  Sum_probs=261.0

Q ss_pred             HhhcCCcHHHHHHHHHHHHHccCCCChhHHHHHHHhhhcCCChHHHHHHhhhCCC---CCeehHHHHHHHHHhCCChhHH
Q 046775          206 ACAGMELKELGRQLHCSLIKMEIKSDPIVGVGLVDMYAKCGSMDEARMIFHLMPE---KNLIAWNIVISGHLQNGGDMEA  282 (771)
Q Consensus       206 a~~~~~~~~~a~~l~~~~~~~g~~~~~~~~~~Li~~y~~~g~~~~A~~~f~~m~~---~~~~~~~~li~~~~~~g~~~~A  282 (771)
                      .+.+.|+++.|.+.+..+++.. +.++.++..+...|.+.|++++|...|+...+   .+..+|..+...|.+.|++++|
T Consensus         8 ~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A   86 (388)
T d1w3ba_           8 REYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEA   86 (388)
T ss_dssp             HHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHH
T ss_pred             HHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccc
Confidence            3445667777777777666543 22455566666666666777666666666543   2344566666666666666666


Q ss_pred             HHHHHHHHHCCCCCCHhhHHHHHHHHhccCChhHHHHHHHHHHHhcCCCchHHHhHHHHHHHhcCCHHHHHHHHHh---c
Q 046775          283 ASLFPWMYREGVGFDQTTLSTVLKSVASFQAIGVCKQVHALSVKTAFESDDYIVNSLIDAYGKCGHVEDAVKIFKE---S  359 (771)
Q Consensus       283 ~~~~~~m~~~g~~pd~~t~~~ll~a~~~~~~~~~a~~i~~~~~~~g~~~~~~~~~~Li~~y~k~g~~~~A~~~f~~---~  359 (771)
                      +..+.........                                    +..........+...+....+......   .
T Consensus        87 ~~~~~~~~~~~~~------------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  130 (388)
T d1w3ba_          87 IEHYRHALRLKPD------------------------------------FIDGYINLAAALVAAGDMEGAVQAYVSALQY  130 (388)
T ss_dssp             HHHHHHHHHHCTT------------------------------------CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHH
T ss_pred             ccccccccccccc------------------------------------ccccccccccccccccccccccccccccccc
Confidence            6666666554321                                    111112222222222222222222211   1


Q ss_pred             CCCceecHHHHHHHHHHcCChHHHHHHHHHHhcCCCCCCHhhHHHHHHHhhcccchHHHHHHHHHHHHhCCCCchhHHHH
Q 046775          360 SAVDLVACTSMITAYAQFGLGEEALKLYLEMQDREINPDSFVCSSLLNACANLSAYEQGKQVHVHIIKFGFMSDTFAGNS  439 (771)
Q Consensus       360 ~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~a~~~~~~~~~a~~i~~~~~~~g~~~~~~~~~~  439 (771)
                      .......+..........+....+...+.+..... +-+...+..+...+...+..+.|...+..+++.. +.+...+..
T Consensus       131 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~  208 (388)
T d1w3ba_         131 NPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYIN  208 (388)
T ss_dssp             CTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHH
T ss_pred             ccccccccccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHH
Confidence            22333344444555556666667777666665432 2234556666677777888888888888877765 556778888


Q ss_pred             HHHHHHhcCCHHHHHHHHhhCC---CCChhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHhccCc
Q 046775          440 LVNMYAKCGSIDDADRAFSEIP---DRGIVSWSAMIGGLAQHGRGKEALQMFGQMLEDGVLPN-HITLVSVLCACNHAGL  515 (771)
Q Consensus       440 Li~~y~k~g~~~~A~~~f~~~~---~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~pd-~~t~~~ll~a~~~~g~  515 (771)
                      +...|...|++++|...|+...   ..+...|..+...|...|++++|+..|++..+  +.|+ ..++..+..++...|+
T Consensus       209 l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~l~~~~~~~~~  286 (388)
T d1w3ba_         209 LGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANALKEKGS  286 (388)
T ss_dssp             HHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--TCSSCHHHHHHHHHHHHHHSC
T ss_pred             HhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCC
Confidence            9999999999999999998765   44567788899999999999999999999998  5565 4578888999999999


Q ss_pred             HHHHHHHHHHHHHhhCCCCCcchHHHHHHHHhhcCCHHHHHHHHHhC-CCCCC-HhHHHHHHHHHHhcCCHHHHHHHHHH
Q 046775          516 VAEAKHHFESMEKKFGIQPMQEHYACMIDILGRAGKFQEAMELVDTM-PFQAN-ASVWGALLGAARIYKNVEVGQHAAEM  593 (771)
Q Consensus       516 ~~~a~~~~~~m~~~~~i~p~~~~y~~lv~~l~r~g~~~eA~~~~~~m-~~~p~-~~~~~~ll~a~~~~~~~~~a~~~~~~  593 (771)
                      +++|.+.|+.....  .+.+...+..+..++.+.|++++|.+.+++. ...|+ ..+|..+...+...|+.+.|...+++
T Consensus       287 ~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~  364 (388)
T d1w3ba_         287 VAEAEDCYNTALRL--CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKE  364 (388)
T ss_dssp             HHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHH
T ss_pred             HHHHHHHHHhhhcc--CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            99999999988765  2445678889999999999999999999886 56775 45888898999999999999999999


Q ss_pred             HHhcCCCCchhHHHHHHHHHhcCC
Q 046775          594 LFAIEPEKSSTHVLLSNIYASAGM  617 (771)
Q Consensus       594 ~~~l~p~~~~~~~~l~~~y~~~g~  617 (771)
                      +++++|+++.+|..|+++|.+.|+
T Consensus       365 al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         365 AIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHhCCCCHHHHHHHHHHHHHcCC
Confidence            999999999999999999998875
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure