Citrus Sinensis ID: 046899


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------
MKEGRKGMERSVDDRYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQFNEEARSPFVKKFKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVEAQPNRHAVLGAADSHPDLDQSVVLWSIQDHVSALAAEPGSAKSTASGGANSKNASKSGGNGDKPLESPSIGARGKYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVDWNPHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGEKQDYGELKYPIIHPAYSSDMLDIETKLLTSIGMHLIHGRLLVCLTMVKVLEIWRMIDLIYRPEEEVLAELDKFKSHIFGCDKSC
cccccccccccHHHHHHHHHHccccHHHHcccccccccEEEEEEcccccccccccEEEEEEEEEcccccccccEEEEEEEcccccEEEEEEEcccccEEEEEEccccEEEEEcccccccccccccccccccccccEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEcccccccccccccccEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEccccccccEEEEccccccEEEEEEccccccEEEEEcccccEEEEEccccccccccccEEEcccccccEEEEEEccccccEEEEEEccccEEEEEccccccccccccccccEEEEEEcccccccccccccccEEEcccccEEEEEEccccEEEEEccccccccccHHHHcccccccEEEEEcccc
ccccccHHHHcccHHHHHHHHcccHHHHHHHccccccccEEEEEcccccccccccccEEEEEEcccccccccEEEEEEEEcccccEEEEEEccccccEEEEEcccccEEEEEcccccccccccccccccccccccEEEEcccccEEEEEEccccccEEEEcccccEEEEEEcccccccccccccccEEEEEcccccEEEEEEccccccEEEEEccccEEEEEEccccccccEEEEEcccccEEEEEEccccccEEEEEccccEEEEEEcccccccccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEcccccccccccccHHHEEcccccccEEEccccccccEEEccccccEEEEEccccEEEEEEccHcccccHHHcHHHHccccEEEEEccccc
mkegrkgmersvdDRYTQWKSLVPVLYDWLANhnlvwpslscrwgpqleqatyKNRQRLYLSEQfneearspfvkkfktiihpgevnrirelpqnskivathtdspdvliwdveaqpnrhavlgaadshpdldqsVVLWSIQDHVSAlaaepgsakstasggansknasksggngdkplespsigargkylghedtvedvqfcpssaqefcsvgddsclilwdarsgstpavkvekahnadihcvdwnphdvnliltgsadnsihmfdrrkltsdgvgspihkfeghSAAVLCvqwspdkssvfgssaedgilniwdhekigekqdygelkypiihpayssdmLDIETKLLTSIGMHLIHGRLLVCLTMVKVLEIWRMIDLIYRPEEEVLAELDKFkshifgcdksc
mkegrkgmersvddrytQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEqfneearspfvKKFKTIIHpgevnrirelpqnsKIVATHTDSPDVLIWDVEAQPNRHAVLGAADSHPDLDQSVVLWSIQDHVSALAAepgsakstasggansknasksggngdkplesPSIGARGKYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVDWNPHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGEKQDYGELKYPIIHPAYSSDMLDIETKLLTSIGMHLIHGRLLVCLTMVKVLEIWRMIDLIYRPEEEVLAELDkfkshifgcdksc
MKEGRKGMERSVDDRYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQFNEEARSPFVKKFKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVEAQPNRHAVLGAADSHPDLDQSVVLWSIQDHVSALAAEPGSAKSTASGGANSKNASKSGGNGDKPLESPSIGARGKYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVDWNPHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGEKQDYGELKYPIIHPAYSSDMLDIETKLLTSIGMHLIHGRLLVCLTMVKVLEIWRMIDLIYRPEEEVLAELDKFKSHIFGCDKSC
**************RYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQFNEEARSPFVKKFKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVEAQPNRHAVLGAADSHPDLDQSVVLWSIQDHVS*******************************************YLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVDWNPHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGEKQDYGELKYPIIHPAYSSDMLDIETKLLTSIGMHLIHGRLLVCLTMVKVLEIWRMIDLIYRPEEEVLAELDKFKSHIFGC****
***********VDDRYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQFNEEARSPFVKKFKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVEAQ******************SVVLWSIQDHVSALAAEPGSAKSTASGGANSKNASKSGGNGDKPLESPSIGARGKYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVDWNPHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGEKQDYGELKYPIIHPAYSSDMLDIETKLLTSIGMHLIHGRLLVCLTMVKVLEIWRMIDLIYRPEEEVLAELDKFKSHIFGCDKSC
************DDRYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQFNEEARSPFVKKFKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVEAQPNRHAVLGAADSHPDLDQSVVLWSIQDHVSA*****************************KPLESPSIGARGKYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVDWNPHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGEKQDYGELKYPIIHPAYSSDMLDIETKLLTSIGMHLIHGRLLVCLTMVKVLEIWRMIDLIYRPEEEVLAELDKFKSHIFGCDKSC
********ERSVDDRYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQFNEEARSPFVKKFKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVEAQ***********SH*DLDQSVVLWSIQDHVSALAAEPGSAKSTASGGANSKNASKSGGNGDKPLESPSIGARGKYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVDWNPHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGEKQDYGELKYPIIHPAYSSDMLDIETKLLTSIGMHLIHGRLLVCLTMVKVLEIWRMIDLIYRPEEEVLAELDKFKSHIFGCDKSC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEGRKGMERSVDDRYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLSEQFNEEARSPFVKKFKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVEAQPNRHAVLGAADSHPDLDQSVVLWSIQDHVSALAAEPGSAKSTASGGANSKNASKSGGNGDKPLESPSIGARGKYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVDWNPHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGEKQDYGELKYPIIHPAYSSDMLDIETKLLTSIGMHLIHGRLLVCLTMVKVLEIWRMIDLIYRPEEEVLAELDKFKSHIFGCDKSC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query407 2.2.26 [Sep-21-2011]
O22607507 WD-40 repeat-containing p yes no 0.955 0.767 0.595 1e-150
Q9SU78487 WD-40 repeat-containing p no no 0.933 0.780 0.567 1e-139
Q7ZTY4426 Histone-binding protein R yes no 0.872 0.833 0.284 4e-36
Q5M7K4425 Histone-binding protein R yes no 0.877 0.84 0.281 5e-36
Q60972425 Histone-binding protein R yes no 0.877 0.84 0.281 8e-36
Q09028425 Histone-binding protein R yes no 0.877 0.84 0.281 8e-36
Q3MHL3425 Histone-binding protein R yes no 0.877 0.84 0.281 8e-36
Q6INH0425 Histone-binding protein R N/A no 0.877 0.84 0.281 9e-36
Q6P315425 Histone-binding protein R no no 0.869 0.832 0.291 1e-35
Q24572430 Probable histone-binding yes no 0.862 0.816 0.275 1e-35
>sp|O22607|MSI4_ARATH WD-40 repeat-containing protein MSI4 OS=Arabidopsis thaliana GN=MSI4 PE=1 SV=3 Back     alignment and function desciption
 Score =  533 bits (1372), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 278/467 (59%), Positives = 320/467 (68%), Gaps = 78/467 (16%)

Query: 1   MKEGRKGMERS--VDDRYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQR 58
           MKE  K  ++S  VD++Y+QWK LVP+LYDWLANHNLVWPSLSCRWGPQLEQATYKNRQR
Sbjct: 51  MKESGKKTQQSPSVDEKYSQWKGLVPILYDWLANHNLVWPSLSCRWGPQLEQATYKNRQR 110

Query: 59  LYLSEQ-----------------------------FNEEARSPFVKKFKTIIHPGEVNRI 89
           LYLSEQ                             FNEEARSPFVKK+KTIIHPGEVNRI
Sbjct: 111 LYLSEQTDGSVPNTLVIANCEVVKPRVAAAEHISQFNEEARSPFVKKYKTIIHPGEVNRI 170

Query: 90  RELPQNSKIVATHTDSPDVLIWDVEAQPNRHAVLGAADSHPDL----------------- 132
           RELPQNSKIVATHTDSPDVLIWDVE QPNRHAVLGAA+S PDL                 
Sbjct: 171 RELPQNSKIVATHTDSPDVLIWDVETQPNRHAVLGAANSRPDLILTGHQDNAEFALAMCP 230

Query: 133 ----------DQSVVLWSIQDHVSALAAEPGSAKSTASGGANSKNASKSGGNGDKPLESP 182
                     D+SVVLWSIQDH++ +  +  S+ S            K  G G    ESP
Sbjct: 231 TEPFVLSGGKDKSVVLWSIQDHITTIGTDSKSSGSII----------KQTGEGTDKNESP 280

Query: 183 SIGARGKYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADI 242
           ++G RG Y GHEDTVEDV F P+SAQEFCSVGDDSCLILWDAR+G+ P  KVEKAH+AD+
Sbjct: 281 TVGPRGVYHGHEDTVEDVAFSPTSAQEFCSVGDDSCLILWDARTGTNPVTKVEKAHDADL 340

Query: 243 HCVDWNPHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSS 302
           HCVDWNPHD NLILTGSADN++ +FDRRKLT++GVGSPI+KFEGH AAVLCVQWSPDKSS
Sbjct: 341 HCVDWNPHDDNLILTGSADNTVRLFDRRKLTANGVGSPIYKFEGHKAAVLCVQWSPDKSS 400

Query: 303 VFGSSAEDGILNIWDHEKIGEKQDYGELKYP----IIHPAYSSDMLDIETKLLTSIGMHL 358
           VFGSSAEDG+LNIWD++++ +K D    K P      H  +   ++D          +  
Sbjct: 401 VFGSSAEDGLLNIWDYDRVSKKSDRA-AKSPAGLFFQHAGHRDKVVDFHWNASDPWTIVS 459

Query: 359 IHGRLLVCLTM--VKVLEIWRMIDLIYRPEEEVLAELDKFKSHIFGC 403
           +      C T      L+IWRM DLIYRPEEEV+AEL+KFKSH+  C
Sbjct: 460 VSDD---CETTGGGGTLQIWRMSDLIYRPEEEVVAELEKFKSHVMTC 503




Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of the flowering autonomous pathway which positively regulates flowering by promoting transcriptional repression of the flowering repressor FLC. May promote histone deacetylation at the FLC locus leading to the formation of repressive chromatin structures. Also negatively regulates cold-responsive genes.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SU78|MSI5_ARATH WD-40 repeat-containing protein MSI5 OS=Arabidopsis thaliana GN=MSI5 PE=2 SV=2 Back     alignment and function description
>sp|Q7ZTY4|RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio GN=rbbp7 PE=2 SV=1 Back     alignment and function description
>sp|Q5M7K4|RBBP4_XENTR Histone-binding protein RBBP4 OS=Xenopus tropicalis GN=rbbp4 PE=2 SV=3 Back     alignment and function description
>sp|Q60972|RBBP4_MOUSE Histone-binding protein RBBP4 OS=Mus musculus GN=Rbbp4 PE=1 SV=5 Back     alignment and function description
>sp|Q09028|RBBP4_HUMAN Histone-binding protein RBBP4 OS=Homo sapiens GN=RBBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q3MHL3|RBBP4_BOVIN Histone-binding protein RBBP4 OS=Bos taurus GN=RBBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q6INH0|RBP4B_XENLA Histone-binding protein RBBP4-B OS=Xenopus laevis GN=rbbp4-b PE=1 SV=3 Back     alignment and function description
>sp|Q6P315|RBBP7_XENTR Histone-binding protein RBBP7 OS=Xenopus tropicalis GN=rbbp7 PE=2 SV=1 Back     alignment and function description
>sp|Q24572|CAF1_DROME Probable histone-binding protein Caf1 OS=Drosophila melanogaster GN=Caf1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query407
255572951466 WD-repeat protein, putative [Ricinus com 0.963 0.841 0.651 1e-165
359482834453 PREDICTED: WD-40 repeat-containing prote 0.933 0.838 0.639 1e-161
224135005465 nucleosome/chromatin assembly factor gro 0.955 0.836 0.633 1e-160
255546107503 WD-repeat protein, putative [Ricinus com 0.972 0.787 0.622 1e-158
224112132502 nucleosome/chromatin assembly factor gro 0.972 0.788 0.622 1e-157
449489878 518 PREDICTED: WD-40 repeat-containing prote 0.963 0.756 0.621 1e-156
449435868 512 PREDICTED: WD-40 repeat-containing prote 0.963 0.765 0.621 1e-156
224122490467 nucleosome/chromatin assembly factor gro 0.943 0.822 0.605 1e-155
356530366504 PREDICTED: WD-40 repeat-containing prote 0.918 0.742 0.626 1e-154
356556284 508 PREDICTED: WD-40 repeat-containing prote 0.918 0.736 0.614 1e-153
>gi|255572951|ref|XP_002527406.1| WD-repeat protein, putative [Ricinus communis] gi|223533216|gb|EEF34972.1| WD-repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 306/470 (65%), Positives = 337/470 (71%), Gaps = 78/470 (16%)

Query: 3   EGRKGMERSVDDRYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLS 62
           +GRK    SVDDRY QWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLS
Sbjct: 4   KGRK----SVDDRYAQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNRQRLYLS 59

Query: 63  EQ-----------------------------FNEEARSPFVKKFKTIIHPGEVNRIRELP 93
           EQ                             FNEEARSPFV+K+KTI+HPGEVNRIRELP
Sbjct: 60  EQTDGSVPNTLVIANCEVVKPRVAAAEHISQFNEEARSPFVRKYKTILHPGEVNRIRELP 119

Query: 94  QNSKIVATHTDSPDVLIWDVEAQPNRHAVLGAADSHPDL--------------------- 132
           QNSKIVATHTDSP+VLIWDV+AQPNRHAVLGA +S PDL                     
Sbjct: 120 QNSKIVATHTDSPEVLIWDVDAQPNRHAVLGATESRPDLVLTGHTDDAEFALAMCPTEPF 179

Query: 133 ------DQSVVLWSIQDHVSALAAEPGSAKSTASGGANSKNASKSGGNGDKPLESPSIGA 186
                 D+SVVLWSIQDH+S LAA+P S KS  S G+++K+ASK+GG+ DK  +SPSIG 
Sbjct: 180 VLSGGKDKSVVLWSIQDHISVLAADPVSLKSPGSSGSSTKHASKAGGSNDKSTKSPSIGP 239

Query: 187 RGKYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVD 246
           RG + GHEDTVEDVQFCPSSA EFCSVGDDSCLILWDAR+GS+P VKVEKAHN+D+HCVD
Sbjct: 240 RGIFQGHEDTVEDVQFCPSSAHEFCSVGDDSCLILWDARTGSSPVVKVEKAHNSDLHCVD 299

Query: 247 WNPHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGS 306
           WNPHDVN ILTGSADN+IHMFDRR LTS G+GSPIHKFEGHSAAVLCVQWSPD SSVFGS
Sbjct: 300 WNPHDVNFILTGSADNTIHMFDRRSLTSGGLGSPIHKFEGHSAAVLCVQWSPDNSSVFGS 359

Query: 307 SAEDGILNIWDHEKIGEKQDYGELKYPIIHPAYSSDMLDIETKLLTSIGMHLIHGRLLVC 366
           SAEDG+LNIWD EKIG+KQD   L  P   P           K++        H      
Sbjct: 360 SAEDGLLNIWDFEKIGKKQDSAGLNLPSAPPGLFFQHAGHRDKIVD------FHWNSSDP 413

Query: 367 LTMVKV------------LEIWRMIDLIYRPEEEVLAELDKFKSHIFGCD 404
            T+V V            L+IWRMIDLIYRPEEEVL EL+ FKSHI  CD
Sbjct: 414 WTIVSVSDDCESTSGGGTLQIWRMIDLIYRPEEEVLTELEDFKSHILTCD 463




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359482834|ref|XP_003632850.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Vitis vinifera] gi|297743080|emb|CBI35947.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224135005|ref|XP_002327543.1| nucleosome/chromatin assembly factor group [Populus trichocarpa] gi|222836097|gb|EEE74518.1| nucleosome/chromatin assembly factor group [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255546107|ref|XP_002514113.1| WD-repeat protein, putative [Ricinus communis] gi|223546569|gb|EEF48067.1| WD-repeat protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224112132|ref|XP_002332825.1| nucleosome/chromatin assembly factor group [Populus trichocarpa] gi|222833256|gb|EEE71733.1| nucleosome/chromatin assembly factor group [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449489878|ref|XP_004158447.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449435868|ref|XP_004135716.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224122490|ref|XP_002330494.1| nucleosome/chromatin assembly factor group [Populus trichocarpa] gi|222872428|gb|EEF09559.1| nucleosome/chromatin assembly factor group [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356530366|ref|XP_003533753.1| PREDICTED: WD-40 repeat-containing protein MSI4-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356556284|ref|XP_003546456.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query407
TAIR|locus:2134408487 NFC5 "AT4G29730" [Arabidopsis 0.719 0.601 0.521 1.4e-103
TAIR|locus:2050372507 FVE [Arabidopsis thaliana (tax 0.724 0.581 0.524 2e-81
ZFIN|ZDB-GENE-030131-445444 rbb4 "retinoblastoma binding p 0.727 0.666 0.307 4.6e-42
ZFIN|ZDB-GENE-030131-848426 rbb4l "retinoblastoma binding 0.700 0.669 0.313 7.5e-42
UNIPROTKB|Q5M7K4425 rbbp4 "Histone-binding protein 0.700 0.670 0.310 9.5e-42
UNIPROTKB|F2Z4M0425 RBBP4 "Histone-binding protein 0.700 0.670 0.310 1.5e-41
UNIPROTKB|Q3MHL3425 RBBP4 "Histone-binding protein 0.700 0.670 0.310 1.5e-41
UNIPROTKB|E2QXR8425 RBBP4 "Uncharacterized protein 0.700 0.670 0.310 1.5e-41
UNIPROTKB|Q09028425 RBBP4 "Histone-binding protein 0.700 0.670 0.310 1.5e-41
MGI|MGI:1194912425 Rbbp4 "retinoblastoma binding 0.700 0.670 0.310 1.5e-41
TAIR|locus:2134408 NFC5 "AT4G29730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 821 (294.1 bits), Expect = 1.4e-103, Sum P(2) = 1.4e-103
 Identities = 169/324 (52%), Positives = 218/324 (67%)

Query:    93 PQNSKIVATHTDSPDVLIWDVEAQPNRHAVLGAADSHPDL-----DQSVVLWSIQDHVSA 147
             P    ++      PD+L+  +  Q +    L    + P +     D+SV+LW+IQDH++ 
Sbjct:   178 PDRYAVLGAPDSRPDLLL--IGHQDDAEFALAMCPTEPFVLSGGKDKSVILWNIQDHITM 235

Query:   148 LAAE---PGSA-KSTASGGANSKNASKSGGNGDKPLESPSIGARGKYLGHEDTVEDVQFC 203
               ++   PGS+ K T  G      + K+GG        PS+G RG Y GH+DTVEDV FC
Sbjct:   236 AGSDSKSPGSSFKQTGEG------SDKTGG--------PSVGPRGIYNGHKDTVEDVAFC 281

Query:   204 PSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVDWNPHDVNLILTGSADNS 263
             PSSAQEFCSVGDDSCL+LWDAR+G++PA+KVEKAH+AD+HCVDWNPHD NLILTGSADN+
Sbjct:   282 PSSAQEFCSVGDDSCLMLWDARTGTSPAMKVEKAHDADLHCVDWNPHDNNLILTGSADNT 341

Query:   264 IHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGE 323
             + +FDRR LTS+GVGSP++KFEGH AAVLCVQWSPDKSSVFGSSAEDG+LNIWD +++G+
Sbjct:   342 VRVFDRRNLTSNGVGSPVYKFEGHRAAVLCVQWSPDKSSVFGSSAEDGLLNIWDCDRVGK 401

Query:   324 KQDYGELKYP----IIHPAYSSDMLDIETKLLTSIGMHLIHGRLLVCLTMVKVLEIWRMI 379
             K +    K P      H  +   ++D    LL    +  +       +     L+IWRM 
Sbjct:   402 KSERAT-KTPDGLFFQHAGHRDKVVDFHWSLLNPWTIVSVSDNC-ESIGGGGTLQIWRMS 459

Query:   380 DLIYRPEEEVLAELDKFKSHIFGC 403
             DLIYRPE+EVL EL+KFKSH+F C
Sbjct:   460 DLIYRPEDEVLTELEKFKSHVFTC 483


GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
TAIR|locus:2050372 FVE [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-445 rbb4 "retinoblastoma binding protein 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-848 rbb4l "retinoblastoma binding protein 4, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5M7K4 rbbp4 "Histone-binding protein RBBP4" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4M0 RBBP4 "Histone-binding protein RBBP4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MHL3 RBBP4 "Histone-binding protein RBBP4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXR8 RBBP4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q09028 RBBP4 "Histone-binding protein RBBP4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1194912 Rbbp4 "retinoblastoma binding protein 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22607MSI4_ARATHNo assigned EC number0.59520.95570.7672yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
NFC907
nucleosome/chromatin assembly factor group (466 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query407
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-21
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-18
pfam1226573 pfam12265, CAF1C_H4-bd, Histone-binding protein RB 1e-14
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-14
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 9e-13
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-12
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-12
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-06
smart0032040 smart00320, WD40, WD40 repeats 2e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-04
smart0032040 smart00320, WD40, WD40 repeats 1e-04
PTZ00420 568 PTZ00420, PTZ00420, coronin; Provisional 7e-04
PTZ00421 493 PTZ00421, PTZ00421, coronin; Provisional 0.001
PTZ00421 493 PTZ00421, PTZ00421, coronin; Provisional 0.001
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 0.003
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 93.6 bits (233), Expect = 1e-21
 Identities = 52/255 (20%), Positives = 98/255 (38%), Gaps = 34/255 (13%)

Query: 82  HPGEVNRIRELPQNSKIVATHTDSPDVLIWDVEAQPNRHAVLG------AADSHPDL--- 132
           H G V  +      + + +  +D   + +WD+E       + G      +    PD    
Sbjct: 50  HTGPVRDVAASADGTYLASGSSDK-TIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRIL 108

Query: 133 -----DQSVVLWSIQD--HVSALAAEPGSAKSTASGGANSKNASKSGGNGDKPL---ESP 182
                D+++ +W ++    ++ L        S A    +      +  + D  +   +  
Sbjct: 109 SSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVA---FSPDGTFVASSSQDGTIKLWDLR 165

Query: 183 SIGARGKYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADI 242
           +        GH   V  V F P   ++  S   D  + LWD  +G    +   + H   +
Sbjct: 166 TGKCVATLTGHTGEVNSVAFSPDG-EKLLSSSSDGTIKLWDLSTGKC--LGTLRGHENGV 222

Query: 243 HCVDWNPHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSS 302
           + V ++P    L+ +GS D +I ++D R       G  +    GH+ +V  + WSPD   
Sbjct: 223 NSVAFSPDG-YLLASGSEDGTIRVWDLRT------GECVQTLSGHTNSVTSLAWSPDGKR 275

Query: 303 VFGSSAEDGILNIWD 317
           +  S + DG + IWD
Sbjct: 276 LA-SGSADGTIRIWD 289


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|221499 pfam12265, CAF1C_H4-bd, Histone-binding protein RBBP4 or subunit C of CAF1 complex Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 407
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0284 464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 100.0
KOG0302440 consensus Ribosome Assembly protein [General funct 100.0
KOG0313423 consensus Microtubule binding protein YTM1 (contai 100.0
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.98
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.98
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.98
KOG0318 603 consensus WD40 repeat stress protein/actin interac 99.97
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0266456 consensus WD40 repeat-containing protein [General 99.97
PTZ00421 493 coronin; Provisional 99.97
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.97
PTZ00420 568 coronin; Provisional 99.97
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0293519 consensus WD40 repeat-containing protein [Function 99.97
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.97
KOG0645312 consensus WD40 repeat protein [General function pr 99.97
KOG0643327 consensus Translation initiation factor 3, subunit 99.97
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.97
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.97
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.96
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.96
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.96
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.96
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.96
KOG0296399 consensus Angio-associated migratory cell protein 99.96
KOG0300481 consensus WD40 repeat-containing protein [Function 99.96
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.96
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.96
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.96
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.96
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.96
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.96
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.95
KOG0293519 consensus WD40 repeat-containing protein [Function 99.95
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.95
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.95
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.95
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.95
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.95
KOG0641350 consensus WD40 repeat protein [General function pr 99.95
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.95
KOG0289506 consensus mRNA splicing factor [General function p 99.95
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.95
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.95
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.94
KOG0270463 consensus WD40 repeat-containing protein [Function 99.94
KOG0289506 consensus mRNA splicing factor [General function p 99.94
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.94
KOG0643327 consensus Translation initiation factor 3, subunit 99.94
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.94
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.94
PTZ00421 493 coronin; Provisional 99.94
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.94
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.94
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.94
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.93
KOG0646 476 consensus WD40 repeat protein [General function pr 99.93
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.93
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.93
KOG4283397 consensus Transcription-coupled repair protein CSA 99.93
PTZ00420 568 coronin; Provisional 99.93
KOG0294362 consensus WD40 repeat-containing protein [Function 99.93
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.93
KOG0275 508 consensus Conserved WD40 repeat-containing protein 99.93
KOG0267 825 consensus Microtubule severing protein katanin p80 99.93
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.93
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.93
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.93
KOG1539 910 consensus WD repeat protein [General function pred 99.92
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.92
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.92
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.92
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.92
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.92
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.92
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.92
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.92
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.92
KOG0267 825 consensus Microtubule severing protein katanin p80 99.92
KOG0641350 consensus WD40 repeat protein [General function pr 99.92
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.91
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.91
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.91
KOG2055514 consensus WD40 repeat protein [General function pr 99.91
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.91
KOG0639705 consensus Transducin-like enhancer of split protei 99.91
KOG2096420 consensus WD40 repeat protein [General function pr 99.9
KOG1274 933 consensus WD40 repeat protein [General function pr 99.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.9
KOG2106626 consensus Uncharacterized conserved protein, conta 99.9
KOG4328498 consensus WD40 protein [Function unknown] 99.9
KOG1539 910 consensus WD repeat protein [General function pred 99.9
KOG0300481 consensus WD40 repeat-containing protein [Function 99.9
KOG0270463 consensus WD40 repeat-containing protein [Function 99.89
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.89
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.89
KOG4328498 consensus WD40 protein [Function unknown] 99.89
KOG0646476 consensus WD40 repeat protein [General function pr 99.88
KOG0294362 consensus WD40 repeat-containing protein [Function 99.88
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.88
KOG4283397 consensus Transcription-coupled repair protein CSA 99.88
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.88
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.88
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.88
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.88
KOG0302440 consensus Ribosome Assembly protein [General funct 99.87
KOG1273 405 consensus WD40 repeat protein [General function pr 99.87
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.87
KOG2048 691 consensus WD40 repeat protein [General function pr 99.86
KOG1274 933 consensus WD40 repeat protein [General function pr 99.86
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.86
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.86
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.85
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.85
KOG2106626 consensus Uncharacterized conserved protein, conta 99.84
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.84
KOG2055514 consensus WD40 repeat protein [General function pr 99.84
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.83
KOG0639705 consensus Transducin-like enhancer of split protei 99.82
KOG1273405 consensus WD40 repeat protein [General function pr 99.82
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.82
KOG2048 691 consensus WD40 repeat protein [General function pr 99.82
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.82
KOG1188376 consensus WD40 repeat protein [General function pr 99.8
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.8
KOG1334 559 consensus WD40 repeat protein [General function pr 99.8
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.8
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.8
KOG1188 376 consensus WD40 repeat protein [General function pr 99.79
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.79
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.78
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.77
KOG1009 434 consensus Chromatin assembly complex 1 subunit B/C 99.77
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.77
KOG2096420 consensus WD40 repeat protein [General function pr 99.77
KOG0649325 consensus WD40 repeat protein [General function pr 99.77
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.76
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.76
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.76
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.76
COG2319 466 FOG: WD40 repeat [General function prediction only 99.75
KOG4227 609 consensus WD40 repeat protein [General function pr 99.75
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.74
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.74
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.74
KOG0649325 consensus WD40 repeat protein [General function pr 99.73
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.73
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.72
KOG0771398 consensus Prolactin regulatory element-binding pro 99.7
KOG1310 758 consensus WD40 repeat protein [General function pr 99.7
PRK01742429 tolB translocation protein TolB; Provisional 99.7
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.69
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.68
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.65
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.65
COG2319466 FOG: WD40 repeat [General function prediction only 99.65
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.64
KOG2321 703 consensus WD40 repeat protein [General function pr 99.63
PRK11028330 6-phosphogluconolactonase; Provisional 99.63
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.63
KOG0771398 consensus Prolactin regulatory element-binding pro 99.61
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.61
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.6
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.6
PRK03629429 tolB translocation protein TolB; Provisional 99.59
KOG1963 792 consensus WD40 repeat protein [General function pr 99.57
KOG4547 541 consensus WD40 repeat-containing protein [General 99.56
PRK04922433 tolB translocation protein TolB; Provisional 99.55
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.55
KOG1310 758 consensus WD40 repeat protein [General function pr 99.55
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.54
KOG4227 609 consensus WD40 repeat protein [General function pr 99.53
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.53
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.52
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.51
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.51
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.5
KOG2110391 consensus Uncharacterized conserved protein, conta 99.49
PRK02889427 tolB translocation protein TolB; Provisional 99.49
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.49
KOG2111346 consensus Uncharacterized conserved protein, conta 99.49
KOG2139445 consensus WD40 repeat protein [General function pr 99.46
PRK05137435 tolB translocation protein TolB; Provisional 99.46
KOG1963 792 consensus WD40 repeat protein [General function pr 99.45
PRK01742429 tolB translocation protein TolB; Provisional 99.43
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.42
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.42
KOG2111346 consensus Uncharacterized conserved protein, conta 99.4
KOG1409404 consensus Uncharacterized conserved protein, conta 99.39
KOG2139 445 consensus WD40 repeat protein [General function pr 99.39
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.38
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.38
PRK11028330 6-phosphogluconolactonase; Provisional 99.37
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.36
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 99.34
PRK00178430 tolB translocation protein TolB; Provisional 99.34
PRK04792448 tolB translocation protein TolB; Provisional 99.32
KOG1334559 consensus WD40 repeat protein [General function pr 99.31
PRK02889427 tolB translocation protein TolB; Provisional 99.29
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.27
KOG4547 541 consensus WD40 repeat-containing protein [General 99.27
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.27
PRK05137435 tolB translocation protein TolB; Provisional 99.26
PRK04922433 tolB translocation protein TolB; Provisional 99.23
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.22
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 99.22
KOG4532344 consensus WD40-like repeat containing protein [Gen 99.21
PRK03629429 tolB translocation protein TolB; Provisional 99.2
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.17
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.16
KOG2314698 consensus Translation initiation factor 3, subunit 99.14
KOG4714319 consensus Nucleoporin [Nuclear structure] 99.13
KOG2315 566 consensus Predicted translation initiation factor 99.11
PF1226574 CAF1C_H4-bd: Histone-binding protein RBBP4 or subu 99.09
KOG1409 404 consensus Uncharacterized conserved protein, conta 99.08
KOG4497 447 consensus Uncharacterized conserved protein WDR8, 99.08
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 99.08
PRK01029428 tolB translocation protein TolB; Provisional 99.07
KOG2321 703 consensus WD40 repeat protein [General function pr 99.07
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.05
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.05
KOG2315566 consensus Predicted translation initiation factor 99.03
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.02
PRK01029428 tolB translocation protein TolB; Provisional 99.02
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.01
PRK00178430 tolB translocation protein TolB; Provisional 98.95
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.95
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.93
PRK04792448 tolB translocation protein TolB; Provisional 98.93
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.9
KOG2695425 consensus WD40 repeat protein [General function pr 98.86
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 98.85
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.84
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.8
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.77
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.77
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.77
KOG2695425 consensus WD40 repeat protein [General function pr 98.77
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.74
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.74
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.69
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.69
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.68
PRK04043419 tolB translocation protein TolB; Provisional 98.68
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.68
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.67
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.64
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.64
COG4946 668 Uncharacterized protein related to the periplasmic 98.63
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.61
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.6
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.59
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.55
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.54
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.5
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.48
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.47
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.45
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.44
KOG1008 783 consensus Uncharacterized conserved protein, conta 98.44
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.44
COG4946668 Uncharacterized protein related to the periplasmic 98.4
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.4
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.39
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.31
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.29
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.29
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.27
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.27
PRK04043419 tolB translocation protein TolB; Provisional 98.24
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.2
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.18
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.16
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.15
KOG1008 783 consensus Uncharacterized conserved protein, conta 98.09
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.07
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.06
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.03
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.0
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.0
KOG2314 698 consensus Translation initiation factor 3, subunit 97.99
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.96
PRK02888 635 nitrous-oxide reductase; Validated 97.95
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.94
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.92
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.81
KOG3621 726 consensus WD40 repeat-containing protein [General 97.71
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.71
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.68
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.68
KOG2395644 consensus Protein involved in vacuole import and d 97.66
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.63
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.63
KOG3621 726 consensus WD40 repeat-containing protein [General 97.61
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.6
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.55
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.49
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.46
KOG2444238 consensus WD40 repeat protein [General function pr 97.41
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.37
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.37
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.34
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.27
KOG2444238 consensus WD40 repeat protein [General function pr 97.13
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.03
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.94
COG3391381 Uncharacterized conserved protein [Function unknow 96.93
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.92
KOG4649 354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 96.9
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.86
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.83
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.83
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.73
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.68
COG3391 381 Uncharacterized conserved protein [Function unknow 96.67
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.65
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.61
KOG4649 354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 96.54
KOG2395644 consensus Protein involved in vacuole import and d 96.54
PRK02888635 nitrous-oxide reductase; Validated 96.44
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.37
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.3
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.02
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 95.97
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.87
PRK13616591 lipoprotein LpqB; Provisional 95.82
PHA02713557 hypothetical protein; Provisional 95.62
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.6
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.45
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.43
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.41
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.38
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.28
COG5167776 VID27 Protein involved in vacuole import and degra 95.13
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 95.1
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.79
PHA02713557 hypothetical protein; Provisional 94.43
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 94.4
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.38
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 94.27
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 94.24
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 94.2
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 94.2
PF14727418 PHTB1_N: PTHB1 N-terminus 94.09
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 94.07
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.07
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 93.96
COG3204316 Uncharacterized protein conserved in bacteria [Fun 93.93
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 93.74
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 93.69
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 93.45
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 93.39
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 93.39
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 93.39
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 93.35
COG3490366 Uncharacterized protein conserved in bacteria [Fun 92.96
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 92.89
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 92.75
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 92.63
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 92.52
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 92.39
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 92.26
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 92.21
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 92.18
PHA03098534 kelch-like protein; Provisional 91.79
COG3490366 Uncharacterized protein conserved in bacteria [Fun 91.74
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 91.5
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 91.25
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 91.22
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 90.77
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 90.41
KOG2247 615 consensus WD40 repeat-containing protein [General 89.83
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 89.4
PRK13616591 lipoprotein LpqB; Provisional 89.29
PF12768281 Rax2: Cortical protein marker for cell polarity 89.25
PF14727 418 PHTB1_N: PTHB1 N-terminus 89.19
KOG2377 657 consensus Uncharacterized conserved protein [Funct 88.63
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 88.46
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 88.29
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 88.01
KOG2247 615 consensus WD40 repeat-containing protein [General 87.9
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 87.82
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 87.26
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 87.04
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 86.42
PHA03098534 kelch-like protein; Provisional 86.33
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 86.28
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 86.16
COG3204316 Uncharacterized protein conserved in bacteria [Fun 86.04
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 86.02
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 85.8
PF12768281 Rax2: Cortical protein marker for cell polarity 85.71
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 85.47
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 84.9
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 84.74
PRK13684334 Ycf48-like protein; Provisional 84.56
COG5276370 Uncharacterized conserved protein [Function unknow 83.24
PHA02790480 Kelch-like protein; Provisional 82.72
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 82.29
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 82.09
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 81.58
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 81.15
PRK10115 686 protease 2; Provisional 80.44
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 80.41
COG5167776 VID27 Protein involved in vacuole import and degra 80.39
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 80.13
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
Probab=100.00  E-value=1.7e-48  Score=334.90  Aligned_cols=334  Identities=36%  Similarity=0.633  Sum_probs=264.7

Q ss_pred             cccCcchhhhhhhhccCceEEEeeeecccCCCeeEEEEeec--ccccCccceEEEEeec---------------------
Q 046899            7 GMERSVDDRYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQ--LEQATYKNRQRLYLSE---------------------   63 (407)
Q Consensus         7 ~~~~~~~~~~~~w~~~~~~~y~~l~~~~~~~p~~s~~~~~~--~~~~~~~~~~~i~~~~---------------------   63 (407)
                      .+.+.++|+|++||+|.|+||+++..|.++||++++||+|+  ...+.+...+|+++++                     
T Consensus        11 ~~~~~i~Eey~~WKkNtp~LYDlv~th~LeWPSLt~qWlPd~~~~~~~~~~~~rliLGthTs~~~~n~L~iA~v~lp~~~   90 (422)
T KOG0264|consen   11 LEQRQINEEYKIWKKNTPFLYDLVITHALEWPSLTVQWLPDVTKPEEKDFSKQRLILGTHTSGSEQNYLVIASVQLPTDD   90 (422)
T ss_pred             hccccccchhhHHhhcCcHHHHHhhhccccccceEEEEcCCcccccCCCceeEEEEEEeecCCCCccEEEEEeecCCCcc
Confidence            44558899999999999999999999999999999999997  4444555568888888                     


Q ss_pred             ------ccCcc--------cCCcceeeEEEeeCCCceEEEEEeCCCCeEEEEeeCCCcEEEEeCcCCCCccc--------
Q 046899           64 ------QFNEE--------ARSPFVKKFKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVEAQPNRHA--------  121 (407)
Q Consensus        64 ------~~~~~--------~~~~~~~~~~~~~h~~~v~~l~~~~~~~~~l~tg~~dg~i~vwd~~~~~~~~~--------  121 (407)
                            .++.+        .....++..+.+.|.++|+.+++.|++..++||++..+.|.|||..+......        
T Consensus        91 ~~~~~~~~~~e~~e~~g~~~~~~~v~i~~~i~h~gEVnRaRymPQnp~iVAt~t~~~dv~Vfd~tk~~s~~~~~~~~~Pd  170 (422)
T KOG0264|consen   91 AQFEDKHYDEERGEFGGFGAVSGKVEISQKINHDGEVNRARYMPQNPNIVATKTSSGDVYVFDYTKHPSKPKASGECRPD  170 (422)
T ss_pred             cccccccccccccccCCccccccceEEEEeccCCccchhhhhCCCCCcEEEecCCCCCEEEEEeccCCCcccccccCCCc
Confidence                  11111        12236677777889999999999999999999999999999999987654332        


Q ss_pred             --ccCcCCCCCCCCCcEEEEeccccccccccCCCCCcccccCCCCCccccccCCCCCCCCCCCCcC-------ceeeEee
Q 046899          122 --VLGAADSHPDLDQSVVLWSIQDHVSALAAEPGSAKSTASGGANSKNASKSGGNGDKPLESPSIG-------ARGKYLG  192 (407)
Q Consensus       122 --~~~~~~~~~~~d~~i~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~d~~~~~-------~~~~~~~  192 (407)
                        +.+|..     .|.-..|+....                    ..+++++.++.+.+||+....       +...+.+
T Consensus       171 l~L~gH~~-----eg~glsWn~~~~--------------------g~Lls~~~d~~i~lwdi~~~~~~~~~~~p~~~~~~  225 (422)
T KOG0264|consen  171 LRLKGHEK-----EGYGLSWNRQQE--------------------GTLLSGSDDHTICLWDINAESKEDKVVDPKTIFSG  225 (422)
T ss_pred             eEEEeecc-----cccccccccccc--------------------eeEeeccCCCcEEEEeccccccCCccccceEEeec
Confidence              223322     122233433321                    236778888888888875433       3566789


Q ss_pred             cccCEEEEEECCCCCcEEEEEeCCCcEEEEEcCCCCCCceeeecccCcceEEEEecCCCCCEEEEEeCCCcEEEEeCCCC
Q 046899          193 HEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVDWNPHDVNLILTGSADNSIHMFDRRKL  272 (407)
Q Consensus       193 ~~~~v~~l~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~l~~~~~~~~~l~tg~~dg~i~vwd~~~~  272 (407)
                      |+..|..++|++....+|++++.|+.+.|||+|+..........+|.++|+|++|+|.++.+||||+.|++|++||+|++
T Consensus       226 h~~~VeDV~~h~~h~~lF~sv~dd~~L~iwD~R~~~~~~~~~~~ah~~~vn~~~fnp~~~~ilAT~S~D~tV~LwDlRnL  305 (422)
T KOG0264|consen  226 HEDVVEDVAWHPLHEDLFGSVGDDGKLMIWDTRSNTSKPSHSVKAHSAEVNCVAFNPFNEFILATGSADKTVALWDLRNL  305 (422)
T ss_pred             CCcceehhhccccchhhheeecCCCeEEEEEcCCCCCCCcccccccCCceeEEEeCCCCCceEEeccCCCcEEEeechhc
Confidence            99999999999998899999999999999999964333567778999999999999999999999999999999999997


Q ss_pred             CCCCCCCceeeecCCCCCEEEEEEcCCCCCEEEEeeCCCeEEEEeCCCCCccccc--------------ccCCCcccCCC
Q 046899          273 TSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGEKQDY--------------GELKYPIIHPA  338 (407)
Q Consensus       273 ~~~~~~~~~~~~~~h~~~v~~v~~~~~~~~ll~s~~~d~~i~vwd~~~~~~~~~~--------------~~~~~~v~~~~  338 (407)
                           .+++.++.+|+..|.+|.|+|+...+|||++.|+.+.|||+.+....+.-              .+|...|....
T Consensus       306 -----~~~lh~~e~H~dev~~V~WSPh~etvLASSg~D~rl~vWDls~ig~eq~~eda~dgppEllF~HgGH~~kV~Dfs  380 (422)
T KOG0264|consen  306 -----NKPLHTFEGHEDEVFQVEWSPHNETVLASSGTDRRLNVWDLSRIGEEQSPEDAEDGPPELLFIHGGHTAKVSDFS  380 (422)
T ss_pred             -----ccCceeccCCCcceEEEEeCCCCCceeEecccCCcEEEEeccccccccChhhhccCCcceeEEecCccccccccc
Confidence                 47999999999999999999999999999999999999999986665541              23334444444


Q ss_pred             CcCcchhccccceeeeeEeeCccc-eeeeEEEeeeEEEeeccccccCChHH
Q 046899          339 YSSDMLDIETKLLTSIGMHLIHGR-LLVCLTMVKVLEIWRMIDLIYRPEEE  388 (407)
Q Consensus       339 ~s~d~~~~~~~~~~~~~~~~~~~~-~i~~~~~d~~i~iwd~~~~~~~~~~~  388 (407)
                      |+|.                  .. .|++.+.|+.++||+..++++.++.+
T Consensus       381 Wnp~------------------ePW~I~SvaeDN~LqIW~~s~~i~~~e~~  413 (422)
T KOG0264|consen  381 WNPN------------------EPWTIASVAEDNILQIWQMAENIYNPEDP  413 (422)
T ss_pred             CCCC------------------CCeEEEEecCCceEEEeeccccccCcccc
Confidence            4443                  22 35588999999999999888776554



>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12265 CAF1C_H4-bd: Histone-binding protein RBBP4 or subunit C of CAF1 complex; InterPro: IPR022052 The CAF-1 complex is a conserved heterotrimeric protein complex that promotes histone H3 and H4 deposition onto newly synthesized DNA during replication or DNA repair; specifically it facilitates replication-dependent nucleosome assembly with the major histone H3 (H3 Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query407
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 6e-37
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 8e-37
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 8e-37
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 8e-37
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 1e-35
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 7e-34
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 1e-09
2h9l_A329 Wdr5delta23 Length = 329 6e-09
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 6e-09
2gnq_A336 Structure Of Wdr5 Length = 336 6e-09
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 6e-09
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 6e-09
2g9a_A311 Structural Basis For The Specific Recognition Of Me 6e-09
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 7e-09
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 7e-09
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 7e-09
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 7e-09
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 7e-09
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 7e-09
2g99_A308 Structural Basis For The Specific Recognition Of Me 7e-09
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 7e-09
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 8e-09
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 1e-08
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 1e-08
3zey_7318 High-resolution Cryo-electron Microscopy Structure 4e-08
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 3e-06
2aq5_A 402 Crystal Structure Of Murine Coronin-1 Length = 402 4e-06
3jro_A 753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 1e-05
2pm6_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 1e-05
2b4e_A 402 Crystal Structure Of Murine Coronin-1: Monoclinic F 1e-05
3jrp_A 379 Sec13 With Nup145c (Aa109-179) Insertion Blade Leng 2e-05
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 2e-05
2pm9_B297 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 2e-05
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 3e-05
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 7e-05
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 8e-05
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 9e-05
1nr0_A 611 Two Seven-Bladed Beta-Propeller Domains Revealed By 1e-04
4gqb_B344 Crystal Structure Of The Human Prmt5:mep50 Complex 2e-04
2pm7_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 2e-04
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 3e-04
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 3e-04
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 4e-04
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 4e-04
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 5e-04
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 5e-04
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 6e-04
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 7e-04
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 7e-04
3bg0_A316 Architecture Of A Coat For The Nuclear Pore Membran 8e-04
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure

Iteration: 1

Score = 151 bits (382), Expect = 6e-37, Method: Compositional matrix adjust. Identities = 119/422 (28%), Positives = 189/422 (44%), Gaps = 65/422 (15%) Query: 9 ERSVDDRYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATYKNR--QRLYLSEQFN 66 ER +++ Y WK P LYD + H L WPSL+ +W P + + K+ RL L + Sbjct: 14 ERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTS 73 Query: 67 EEARSPFVKKFK----------------------------------TIIHPGEVNRIREL 92 +E + + I H GEVNR R + Sbjct: 74 DEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYM 133 Query: 93 PQNSKIVATHTDSPDVLIWDVEAQPNRHAVLGAADSHPDLDQSVVLWSIQDHVSALAAEP 152 PQN I+AT T S DVL++D P++ G + +PDL L Q L+ P Sbjct: 134 PQNPCIIATKTPSSDVLVFDYTKHPSKPDPSG--ECNPDLR----LRGHQKEGYGLSWNP 187 Query: 153 GSAKSTASGGANSKNASKSGGNGDKPLESPSIGARGKYLGHEDTVEDVQFCPSSAQEFCS 212 + S A+ + P E + A+ + GH VEDV + F S Sbjct: 188 NLSGHLLS--ASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGS 245 Query: 213 VGDDSCLILWDARSGST--PAVKVEKAHNADIHCVDWNPHDVNLILTGSADNSIHMFDRR 270 V DD L++WD RS +T P+ V+ AH A+++C+ +NP+ ++ TGSAD ++ ++D R Sbjct: 246 VADDQKLMIWDTRSNNTSKPSHSVD-AHTAEVNCLSFNPYSEFILATGSADKTVALWDLR 304 Query: 271 KLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGEKQ----- 325 L +H FE H + VQWSP ++ SS D LN+WD KIGE+Q Sbjct: 305 NLKLK-----LHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDA 359 Query: 326 DYGELKYPIIHPAYSSDMLDIETKLLTSIGMHLIHGRLLVCLTMVKVLEIWRMIDLIYRP 385 + G + IH +++ + D + ++ ++ ++++W+M + IY Sbjct: 360 EDGPPELLFIHGGHTAKISD--------FSWNPNEPWVICSVSEDNIMQVWQMAENIYND 411 Query: 386 EE 387 E+ Sbjct: 412 ED 413
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|2PM6|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Native Version Length = 297 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|3JRP|A Chain A, Sec13 With Nup145c (Aa109-179) Insertion Blade Length = 379 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|2PM9|B Chain B, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 297 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|4GQB|B Chain B, Crystal Structure Of The Human Prmt5:mep50 Complex Length = 344 Back     alignment and structure
>pdb|2PM7|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Selenomethionine Version Length = 297 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|3BG0|A Chain A, Architecture Of A Coat For The Nuclear Pore Membrane Length = 316 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query407
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.98
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.98
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.98
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.98
3jro_A 753 Fusion protein of protein transport protein SEC13 99.98
2pm7_B297 Protein transport protein SEC13, protein transport 99.98
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.97
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.97
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.97
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.97
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.96
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
3jrp_A379 Fusion protein of protein transport protein SEC13 99.96
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.96
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.96
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
3jro_A 753 Fusion protein of protein transport protein SEC13 99.95
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.94
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.93
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.93
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.92
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.92
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.9
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.88
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.87
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.85
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.85
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.85
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.85
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.85
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.84
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.84
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.83
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.83
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.82
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.81
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.81
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.81
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.8
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.79
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.79
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.78
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.77
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.77
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.77
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.76
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.74
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.74
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.73
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.68
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.67
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.66
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.65
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.64
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.64
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.63
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.63
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.62
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.62
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.59
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.57
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.52
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.51
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.48
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.48
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.48
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.46
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.45
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.45
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.44
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.43
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.42
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.41
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.39
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.39
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.39
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.38
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.35
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.33
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.31
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.29
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.27
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.27
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.25
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.24
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.24
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.2
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.2
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.18
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.17
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.16
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.14
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.13
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.1
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.09
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.08
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.04
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.03
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.99
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.96
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.94
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.93
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.92
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.92
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.88
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.82
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.8
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.78
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.77
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.76
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.76
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.75
2qe8_A343 Uncharacterized protein; structural genomics, join 98.74
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.71
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.7
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.69
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.68
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.67
2qe8_A343 Uncharacterized protein; structural genomics, join 98.65
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.64
2ece_A462 462AA long hypothetical selenium-binding protein; 98.62
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.61
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.61
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.54
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.51
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.49
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.48
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.47
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.46
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.44
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.43
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.4
3v65_B386 Low-density lipoprotein receptor-related protein; 98.34
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.34
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.31
2ece_A462 462AA long hypothetical selenium-binding protein; 98.29
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.25
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.23
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.23
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.19
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.14
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.12
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.08
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.06
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.02
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.02
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.99
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.98
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.95
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.9
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.87
3v65_B386 Low-density lipoprotein receptor-related protein; 97.87
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.82
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.82
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.78
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.78
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.76
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.72
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.72
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.7
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.67
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.59
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.52
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.5
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.5
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.47
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.37
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.28
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.26
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.26
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.25
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.24
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.17
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.14
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.1
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.08
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.01
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.99
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 96.97
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.9
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 96.76
3kya_A496 Putative phosphatase; structural genomics, joint c 96.71
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.56
3kya_A 496 Putative phosphatase; structural genomics, joint c 96.52
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.47
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.46
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.35
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 96.35
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 96.35
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.29
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.97
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 95.7
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.54
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.52
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.3
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.23
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.22
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.02
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 94.54
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 94.28
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 94.08
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 94.04
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 93.67
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 92.97
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 92.89
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 92.12
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 91.98
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 91.95
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 91.88
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 91.7
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 91.59
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 89.96
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 89.48
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 89.3
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 89.13
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 88.89
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 88.88
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 88.28
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 87.84
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 87.58
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 86.88
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 86.53
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 84.94
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 84.49
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 82.36
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 80.25
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
Probab=100.00  E-value=1e-45  Score=347.25  Aligned_cols=329  Identities=29%  Similarity=0.510  Sum_probs=255.0

Q ss_pred             cccCcchhhhhhhhccCceEEEeeeecccCCCeeEEEEeecccccCc--cceEEEEeecc--------------c-----
Q 046899            7 GMERSVDDRYTQWKSLVPVLYDWLANHNLVWPSLSCRWGPQLEQATY--KNRQRLYLSEQ--------------F-----   65 (407)
Q Consensus         7 ~~~~~~~~~~~~w~~~~~~~y~~l~~~~~~~p~~s~~~~~~~~~~~~--~~~~~i~~~~~--------------~-----   65 (407)
                      .+++.++++|++||+|+|++|++++.+.++||+++++|+|+......  ....++++++.              +     
T Consensus        16 ~~~~~~~~~~~~wk~n~~~~y~~~~~~~l~wp~l~~~~~p~~~~~~~~~~~~~~~~~GT~t~~~~n~i~i~~~~lp~~~~   95 (430)
T 2xyi_A           16 VEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDA   95 (430)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHEEEEEEEECSSCCSCEEECSCCEECTTCSCEEEEEEEECCCSSSCEEEEEEEEEEC----
T ss_pred             hhhhhhhHHHhhHhhCChHHHHHHhhcCCCCCceEEEECcccccccCCCcceEEEEEEEcCCCCCCEEEEEEEECCCCcc
Confidence            45678899999999999999999999999999999999997532111  11466677661              0     


Q ss_pred             -------Ccc--------cCCcceeeEEEeeCCCceEEEEEeCCCCeEEEEeeCCCcEEEEeCcCCC----------Ccc
Q 046899           66 -------NEE--------ARSPFVKKFKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVEAQP----------NRH  120 (407)
Q Consensus        66 -------~~~--------~~~~~~~~~~~~~h~~~v~~l~~~~~~~~~l~tg~~dg~i~vwd~~~~~----------~~~  120 (407)
                             +++        ...+.+......+|.+.|++++|+|+++++||+|+.||.|++||+.+..          ...
T Consensus        96 ~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~h~~~v~~l~~~p~~~~~lat~~~dg~V~vwd~~~~~~~~~~~~~~~~~~  175 (430)
T 2xyi_A           96 QFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDL  175 (430)
T ss_dssp             ----------------------CEEEEEEEEESSCCSEEEEETTEEEEEEEECSSSCEEEEEGGGSCSSCCTTCCCCCSE
T ss_pred             ccccccccccccccccccCCCCceEEEEEEcCCCcEEEEEECCCCCcEEEEECCCCcEEEEECCCcccccCccccCCCcE
Confidence                   000        1233455677789999999999999658899999999999999998632          222


Q ss_pred             cccCcCCCCCCCCCcEEEEeccccccccccCCCCCcccccCCCCC-ccccccCCCCCCCCCCCCcCc-------eeeEee
Q 046899          121 AVLGAADSHPDLDQSVVLWSIQDHVSALAAEPGSAKSTASGGANS-KNASKSGGNGDKPLESPSIGA-------RGKYLG  192 (407)
Q Consensus       121 ~~~~~~~~~~~~d~~i~~w~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~i~i~d~~~~~~-------~~~~~~  192 (407)
                      .+.+|..                          .+..+....... .+++++.+|.+++|++.....       ...+.+
T Consensus       176 ~~~~h~~--------------------------~v~~l~~~~~~~~~l~s~~~dg~i~vwd~~~~~~~~~~~~~~~~~~~  229 (430)
T 2xyi_A          176 RLRGHQK--------------------------EGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTG  229 (430)
T ss_dssp             EEECCSS--------------------------CCCCEEECTTSTTEEEEECTTSCEEEEETTSCCBGGGEEECSEEECC
T ss_pred             EecCCCC--------------------------CeEEEEeCCCCCCeEEEEeCCCeEEEEeCCCCCCCCceeccceeecC
Confidence            2222221                          122222222223 578889999999999987432       455668


Q ss_pred             cccCEEEEEECCCCCcEEEEEeCCCcEEEEEcCCCC-CCceeeecccCcceEEEEecCCCCCEEEEEeCCCcEEEEeCCC
Q 046899          193 HEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGS-TPAVKVEKAHNADIHCVDWNPHDVNLILTGSADNSIHMFDRRK  271 (407)
Q Consensus       193 ~~~~v~~l~~~~~~~~~l~s~~~dg~i~iwd~~~~~-~~~~~~~~~~~~~v~~l~~~~~~~~~l~tg~~dg~i~vwd~~~  271 (407)
                      |...|.+++|+|.+..+|++++.||.|++||+++.. ......+..|...|++++|+|.+..++++|+.||.|++||++.
T Consensus       230 h~~~v~~v~~~p~~~~~l~s~~~dg~i~i~d~~~~~~~~~~~~~~~~~~~v~~i~~~p~~~~~l~tg~~dg~v~vwd~~~  309 (430)
T 2xyi_A          230 HTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRN  309 (430)
T ss_dssp             CSSCEEEEEECSSCTTEEEEEETTSEEEEEETTCSCSSSCSEEEECCSSCEEEEEECSSCTTEEEEEETTSEEEEEETTC
T ss_pred             CCCCEeeeEEeCCCCCEEEEEeCCCeEEEEECCCCCCCcceeEeecCCCCeEEEEeCCCCCCEEEEEeCCCeEEEEeCCC
Confidence            999999999999665899999999999999999873 1145566789999999999994445899999999999999997


Q ss_pred             CCCCCCCCceeeecCCCCCEEEEEEcCCCCCEEEEeeCCCeEEEEeCCCC--------------CcccccccCCCcccCC
Q 046899          272 LTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKI--------------GEKQDYGELKYPIIHP  337 (407)
Q Consensus       272 ~~~~~~~~~~~~~~~h~~~v~~v~~~~~~~~ll~s~~~d~~i~vwd~~~~--------------~~~~~~~~~~~~v~~~  337 (407)
                      .     ..++..+..|...|++++|+|+++++|++++.|+.|++||+...              +.+..+.+|..+|+++
T Consensus       310 ~-----~~~~~~~~~h~~~v~~i~~sp~~~~~l~s~~~d~~i~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~v~~~  384 (430)
T 2xyi_A          310 L-----KLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDF  384 (430)
T ss_dssp             T-----TSCSEEEECCSSCEEEEEECSSCTTEEEEEETTSCCEEEEGGGTTCCCCHHHHHHCCTTEEEECCCCSSCEEEE
T ss_pred             C-----CCCeEEeecCCCCEEEEEECCCCCCEEEEEeCCCcEEEEeCCCCccccCccccccCCcceEEEcCCCCCCceEE
Confidence            4     36788999999999999999999888899999999999999873              4445566788888899


Q ss_pred             CCcCcchhccccceeeeeEeeCccc-eeeeEEEeeeEEEeeccccccC
Q 046899          338 AYSSDMLDIETKLLTSIGMHLIHGR-LLVCLTMVKVLEIWRMIDLIYR  384 (407)
Q Consensus       338 ~~s~d~~~~~~~~~~~~~~~~~~~~-~i~~~~~d~~i~iwd~~~~~~~  384 (407)
                      +|+|+                  +. .|++++.|+.|+||++....+.
T Consensus       385 ~~~p~------------------~~~~l~s~s~dg~i~iw~~~~~~~~  414 (430)
T 2xyi_A          385 SWNPN------------------EPWIICSVSEDNIMQVWQMAENVYN  414 (430)
T ss_dssp             EECSS------------------STTEEEEEETTSEEEEEEECHHHHC
T ss_pred             EECCC------------------CCCEEEEEECCCCEEEeEccccccc
Confidence            88887                  66 7899999999999999854443



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 407
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-16
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-14
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 7e-06
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-14
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 7e-09
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-08
d1p22a2 293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 8e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-04
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-04
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-08
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-07
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-05
d1pgua1 325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.002
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-07
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 6e-07
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-05
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-04
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.003
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-05
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.001
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 6e-06
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 6e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.002
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-05
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 4e-05
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 8e-04
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 78.2 bits (191), Expect = 1e-16
 Identities = 29/129 (22%), Positives = 50/129 (38%), Gaps = 9/129 (6%)

Query: 189 KYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLILWDARSGSTPAVKVEKAHNADIHCVDWN 248
            + GHE  +  + F P+    F +  DD+   L+D R+               I  V ++
Sbjct: 221 TFTGHESDINAICFFPNG-NAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFS 279

Query: 249 PHDVNLILTGSADNSIHMFDRRKLTSDGVGSPIHKFEGHSAAVLCVQWSPDKSSVFGSSA 308
                L+L G  D + +++D  K              GH   V C+  + D  +V  + +
Sbjct: 280 KSG-RLLLAGYDDFNCNVWDALK------ADRAGVLAGHDNRVSCLGVTDDGMAVA-TGS 331

Query: 309 EDGILNIWD 317
            D  L IW+
Sbjct: 332 WDSFLKIWN 340


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query407
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.98
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.89
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.85
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.84
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.78
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.77
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.75
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.73
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.72
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.69
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.68
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.66
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.64
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.6
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.55
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.49
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.41
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.33
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.28
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.98
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.97
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.94
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.9
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.86
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.84
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.74
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.7
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.63
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.59
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.58
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.41
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.38
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.24
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.24
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.13
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.05
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.01
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.84
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.61
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.48
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.44
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.25
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.21
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.79
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.28
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 95.97
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 95.86
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 94.84
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 94.82
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 93.25
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 92.77
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 92.72
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 92.61
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 92.42
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 92.39
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 90.46
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 90.22
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 85.88
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.61
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 83.33
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 82.7
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 82.41
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 81.74
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=1.2e-38  Score=282.66  Aligned_cols=272  Identities=19%  Similarity=0.310  Sum_probs=232.1

Q ss_pred             EEEeeCCCceEEEEEeCCCCeEEEEeeCCCcEEEEeCcCCCCcccccCcCCCCCCC--------------CCcEEEEecc
Q 046899           77 FKTIIHPGEVNRIRELPQNSKIVATHTDSPDVLIWDVEAQPNRHAVLGAADSHPDL--------------DQSVVLWSIQ  142 (407)
Q Consensus        77 ~~~~~h~~~v~~l~~~~~~~~~l~tg~~dg~i~vwd~~~~~~~~~~~~~~~~~~~~--------------d~~i~~w~~~  142 (407)
                      ..+.||.++|++|+|+| ++++||||+.||+|+|||+.+++....+.+|...+...              ++.+..|+..
T Consensus        11 ~~L~GH~~~I~~l~~sp-~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~h~~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~   89 (317)
T d1vyhc1          11 YALSGHRSPVTRVIFHP-VFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQ   89 (317)
T ss_dssp             CEEECCSSCEEEEEECS-SSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEETT
T ss_pred             EEEcCCCCCeEEEEEcC-CCCEEEEEeCCCeEEEEECCCCCEEEEEeCCCCcEEEEeeeccccccccccccccccccccc
Confidence            35669999999999999 88999999999999999999999888888776654322              4555566655


Q ss_pred             ccccc--cccCCCCCcccccCCCCCccccccCCCCCCCCCCCCcCceeeEeecccCEEEEEECCCCCcEEEEEeCCCcEE
Q 046899          143 DHVSA--LAAEPGSAKSTASGGANSKNASKSGGNGDKPLESPSIGARGKYLGHEDTVEDVQFCPSSAQEFCSVGDDSCLI  220 (407)
Q Consensus       143 ~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~d~~~~~~~~~~~~~~~~v~~l~~~~~~~~~l~s~~~dg~i~  220 (407)
                      .....  +..+...............+++++.++.+++||..+++.+..+.+|...+.+++|+|++ .+|++++.|+.|+
T Consensus        90 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~l~~~~~d~~v~  168 (317)
T d1vyhc1          90 GFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDG-TLIASCSNDQTVR  168 (317)
T ss_dssp             SSCEEECCCCCSSCEEEEEECSSSSEEEEEETTSEEEEEETTTCCEEEEEECCSSCEEEEEECTTS-SEEEEEETTSCEE
T ss_pred             ccccccccccccccceeeeccCCCceEEeeccCcceeEeecccceeeeEEccCCCcceeeecccCC-CEEEEEeCCCeEE
Confidence            44322  22223333333444445668889999999999999999999999999999999999998 8999999999999


Q ss_pred             EEEcCCCCCCceeeecccCcceEEEEecCC-------------------CCCEEEEEeCCCcEEEEeCCCCCCCCCCCce
Q 046899          221 LWDARSGSTPAVKVEKAHNADIHCVDWNPH-------------------DVNLILTGSADNSIHMFDRRKLTSDGVGSPI  281 (407)
Q Consensus       221 iwd~~~~~~~~~~~~~~~~~~v~~l~~~~~-------------------~~~~l~tg~~dg~i~vwd~~~~~~~~~~~~~  281 (407)
                      +|+++++.  ....+..|...+.+++|+|.                   .+.++++|+.||.|++||+++      ++++
T Consensus       169 ~~~~~~~~--~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~i~~~~~~~------~~~~  240 (317)
T d1vyhc1         169 VWVVATKE--CKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVST------GMCL  240 (317)
T ss_dssp             EEETTTCC--EEEEECCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCEEEEEETTSEEEEEETTT------TEEE
T ss_pred             EEeeccce--eeEEEecCCCCceEEEEeeccccceeeccccceeeeeccCCceeEeccCCCEEEEEECCC------CcEE
Confidence            99999888  67788889999999999873                   235799999999999999998      8999


Q ss_pred             eeecCCCCCEEEEEEcCCCCCEEEEeeCCCeEEEEeCCCCCcccccccCCCcccCCCCcCcchhccccceeeeeEeeCcc
Q 046899          282 HKFEGHSAAVLCVQWSPDKSSVFGSSAEDGILNIWDHEKIGEKQDYGELKYPIIHPAYSSDMLDIETKLLTSIGMHLIHG  361 (407)
Q Consensus       282 ~~~~~h~~~v~~v~~~~~~~~ll~s~~~d~~i~vwd~~~~~~~~~~~~~~~~v~~~~~s~d~~~~~~~~~~~~~~~~~~~  361 (407)
                      .++.+|...|.+++|+|++++| ++|+.||.|++||+++++.+..+.+|..+|++++|+|+                  +
T Consensus       241 ~~~~~~~~~v~~~~~~~~~~~l-~s~~~dg~i~iwd~~~~~~~~~~~~h~~~V~~~~~s~~------------------~  301 (317)
T d1vyhc1         241 MTLVGHDNWVRGVLFHSGGKFI-LSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKT------------------A  301 (317)
T ss_dssp             EEEECCSSCEEEEEECSSSSCE-EEEETTTEEEEECCTTSCCCEEEECCSSCEEEEEECSS------------------S
T ss_pred             EEEeCCCCCEEEEEECCCCCEE-EEEECCCeEEEEECCCCcEEEEEcCCCCCEEEEEEcCC------------------C
Confidence            9999999999999999999966 69999999999999999999999999999999999998                  8


Q ss_pred             ceeeeEEEeeeEEEee
Q 046899          362 RLLVCLTMVKVLEIWR  377 (407)
Q Consensus       362 ~~i~~~~~d~~i~iwd  377 (407)
                      ..|++++.|++|+|||
T Consensus       302 ~~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         302 PYVVTGSVDQTVKVWE  317 (317)
T ss_dssp             SCEEEEETTSEEEEEC
T ss_pred             CEEEEEeCCCeEEEeC
Confidence            8999999999999997



>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure