Citrus Sinensis ID: 047092

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
MEPLAPKIISPKSPNPIPVKLYPHRFWCSNRCKSKKWSMPMHSCASDNVKLAESSKLQLNNRKDFIESIAKGFVGFAAAATALASICFDSPAFAESLTVAFPASRAPEVNTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGHLVVLSCVEDSPAARAGIHEGDELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVGRESGTREVNIPRGYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNPVILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCTTDMLSSPKESLLKNKSSVSSLEADSCIMVAEHELDVQESKGTAS
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccHHHHHHccccccEEEEEEEEEEEEEcccccEEEEEEccccHHHHcccccccEEEEEccEEcccccHHHHHHHcccccccEEEEEEEEcccccccccEEEEEEEEcEEEcccEEEEEccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccccEEEEccccccEEEEEcccccccccccEEEEEccccccHHHHHHHHHcccccEEEEccccccccEEEEEEEcccccEEEEEEEEEccccccccccccccccEEEccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHcccc
ccccccHccccccccccccccccccccccccccHHHccccccccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccHHHHHHHcccccccEcEEEEEEEEcccccEEEEEEcccccHHHHcccccccEEEEEcccccccccHHHHHHHHccccccEEEEEEEEcccccccccEEEEEEEEEEEEEccEEEEEEcccccccccccEEEEEEHHccHcHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHcccccEEEEEEcccccEEEEEcccccccccccEEEEEccccccHHHHHHHHHHHccccEEEEcccccccEEEEEEEcccccEEEEEEEEEEcccccEcccccccccEEcccccccccHHHHHHccHHHHHccccHHHHHHHHHHHHHHHccccc
meplapkiispkspnpipvklyphrfwcsnrckskkwsmpmhscasdnVKLAESSKLQLNNRKDFIESIAKGFVGFAAAATALASIcfdspafaesltvafpasrapevnTVQRTLVEAWGLIretfvdptfnhqdwdSKLQQTMVEIFPLKSADAAYSKISGMlstlgdpftriispkeyqsfrigsdgnlqgVGLFisveprtghLVVLScvedspaaragihegdelieingerldgIDSEAAALKLrgragtpvtvkvhsgkdvgresgtrevniprgyiklspisrtiiphrtpdghltktgyVKLSAFSQTAAADMANTIHELESEGAHSYildlrnnpvilRLDVAQIWLDGDETLVNAvdreghtlpinmvdghaithdPLVVLVNEGSASASEILAGALHDNGRAILVghktfgkgkiqsvtelhdgSALFVTVAKYlspalhdidqvgitpdvqcttdmlsspkesllknkssvssleadsciMVAEHELDVQESKGTAS
meplapkiispkspnpipvklyphrFWCSNRCKSKKWSMPMHSCASDNVKLAESSKLQLNNRKDFIESIAKGFVGFAAAATALASICFDSPAFAESLTVAfpasrapevnTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGHLVVLSCVEDSPAARAGIHEGDELIEINGERLDGIDSEAAALKlrgragtpvtvkvhsgkdvgresgtrevniprgyiklspisrtiiphrtpdghltKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNPVILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCTTDMLSSPKESLLKNKSSVSSLEADSCIMVAEHeldvqeskgtas
MEPLApkiispkspnpipVKLYPHRFWCSNRCKSKKWSMPMHSCASDNVKLAESSKLQLNNRKDFIESIAKGFVGFaaaatalaSICFDSPAFAESLTVAFPASRAPEVNTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGHLVVLSCVEDSPAARAGIHEGDELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVGRESGTREVNIPRGYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNPVILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCTTDMLSSPkesllknkssvsslEADSCIMVAEHELDVQESKGTAS
****************IPVKLYPHRFWCSNRCKSKKWSMPMH*C*************QLNNRKDFIESIAKGFVGFAAAATALASICFDSPAFAESLTVAFPASRAPEVNTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGHLVVLSCVEDSPAARAGIHEGDELIEINGERLDGID**AAALKLR******VTV****************VNIPRGYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNPVILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCTT*******************************************
*****************************NRCKSKKWSMPMHSCASD***********************KGFVGFAAAATALASICFDSPAFAESL**************VQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIISPKEY*******DGNLQGVGLFISVEPRTGHLVVLSCVEDSPAARAGIHEGDELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVGRESGTREVNIPRGYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNPVILRLDVAQIWLDGDETLVNA*****************ITHDPLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCTT*******************************************
MEPLAPKIISPKSPNPIPVKLYPHRFWCSNRCKSKKWSMPMHSCASDNVKLAESSKLQLNNRKDFIESIAKGFVGFAAAATALASICFDSPAFAESLTVAFPASRAPEVNTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGHLVVLSCVEDSPAARAGIHEGDELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVGRESGTREVNIPRGYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNPVILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCTTDMLSSPK*************EADSCIMVAEHEL**********
*********SPKSPNPIPVKLYPHRFWCSNRCKSKKWSMPMHSCASDNVKLAESSKLQLNNRKDFIESIAKGFVGFAAAATALASICFDSPAFAESLTVAFPASRAPEVNTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGHLVVLSCVEDSPAARAGIHEGDELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVGRESGTREVNIPRGYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNPVILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCTTDMLSSPKESLLKNKSSVSSLEADSCIMVAEHELDVQE******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPLAPKIISPKSPNPIPVKLYPHRFWCSNRCKSKKWSMPMHSCASDNVKLAESSKLQLNNRKDFIESIAKGFVGFAAAATALASICFDSPAFAESLTVAFPASRAPEVNTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGHLVVLSCVEDSPAARAGIHEGDELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVGRESGTREVNIPRGYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNPVILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCTTDMLSSPKESLLKNKSSVSSLEADSCIMVAEHELDVQESKGTAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query510 2.2.26 [Sep-21-2011]
P42784414 Carboxyl-terminal-process yes no 0.682 0.840 0.423 2e-73
Q55669427 Carboxyl-terminal-process N/A no 0.660 0.789 0.423 2e-71
O04073464 C-terminal processing pep N/A no 0.719 0.790 0.353 2e-54
O35002480 Carboxy-terminal processi yes no 0.564 0.6 0.326 5e-38
Q4L6D0496 Probable CtpA-like serine yes no 0.566 0.582 0.317 8e-36
Q49XN1491 Probable CtpA-like serine yes no 0.554 0.576 0.321 6e-35
O34666466 Carboxy-terminal processi no no 0.562 0.615 0.325 8e-35
Q44879434 Carboxy-terminal-processi yes no 0.560 0.658 0.311 2e-34
Q6GGY8496 Probable CtpA-like serine yes no 0.566 0.582 0.317 2e-34
Q2YXZ9496 Probable CtpA-like serine yes no 0.566 0.582 0.317 3e-34
>sp|P42784|CTPA_SYNP2 Carboxyl-terminal-processing protease OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ctpA PE=3 SV=2 Back     alignment and function desciption
 Score =  276 bits (707), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 154/364 (42%), Positives = 225/364 (61%), Gaps = 16/364 (4%)

Query: 102 PASRAPEVNTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKI 161
           P  RA      Q  L++AW  + + +VD TFNHQ+W    Q+ +    PLK+ D AY  +
Sbjct: 23  PMERAIAFTDEQDLLLQAWRYVSQAYVDETFNHQNWWLIRQKFLKR--PLKTRDEAYEAV 80

Query: 162 SGMLSTLGDPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGHLVVLSCVEDSPAAR 221
             ML+ L DP+TR++ P++Y+S ++ + G L GVGL I+V P    L V+  +  SPA  
Sbjct: 81  GEMLALLDDPYTRLLRPEQYRSLKVSTSGELSGVGLQINVNPEVDVLEVILPLPGSPAEA 140

Query: 222 AGIHEGDELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVGRESGTREVNIPR 281
           AGI   D+++ I+G     I  E AA ++RG+ G+ V++ V S K        R V + R
Sbjct: 141 AGIEAKDQILAIDGIDTRNIGLEEAAARMRGKKGSTVSLTVKSPK----TDTVRTVKVTR 196

Query: 282 GYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDL 341
             I L+P+       +  + +  K GY++L+ FS  A  ++  ++++L+ +GA  Y+LDL
Sbjct: 197 DTIALNPVY-----DKLDEKNGEKVGYIRLNQFSANAKTEIIKSLNQLQKQGADRYVLDL 251

Query: 342 RNNPVILR---LDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSA 398
           RNNP  L    +++A++WLD  ET+V  V+R+G     + V G  +T  PLVVLVN+ +A
Sbjct: 252 RNNPGGLLQAGIEIARLWLD-QETIVYTVNRQGIFESYSAV-GQPLTDAPLVVLVNQATA 309

Query: 399 SASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVG 458
           SASEILAGAL DNGRA+LVG KTFGKG IQS+ EL DG+ + VTVAKY +P  HDI+++G
Sbjct: 310 SASEILAGALQDNGRAMLVGEKTFGKGLIQSLFELPDGAGMAVTVAKYETPLHHDINKLG 369

Query: 459 ITPD 462
           I PD
Sbjct: 370 IMPD 373
Cleavage of the 16 C-terminal residues from the D1 precursor of photosystem II. May be involved in protection of the bacterium from thermal and osmotic stresses.
Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (taxid: 32049)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 1EC: 0EC: 2
>sp|Q55669|CTPA_SYNY3 Carboxyl-terminal-processing protease OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ctpA PE=3 SV=1 Back     alignment and function description
>sp|O04073|CTPA_SCEOB C-terminal processing peptidase, chloroplastic OS=Scenedesmus obliquus GN=ctpA PE=1 SV=1 Back     alignment and function description
>sp|O35002|CTPB_BACSU Carboxy-terminal processing protease CtpB OS=Bacillus subtilis (strain 168) GN=ctpB PE=1 SV=1 Back     alignment and function description
>sp|Q4L6D0|CTPAL_STAHJ Probable CtpA-like serine protease OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1486 PE=3 SV=2 Back     alignment and function description
>sp|Q49XN1|CTPAL_STAS1 Probable CtpA-like serine protease OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1319 PE=3 SV=1 Back     alignment and function description
>sp|O34666|CTPA_BACSU Carboxy-terminal processing protease CtpA OS=Bacillus subtilis (strain 168) GN=ctpA PE=2 SV=1 Back     alignment and function description
>sp|Q44879|CTPA_BARBK Carboxy-terminal-processing protease OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ctpA PE=3 SV=1 Back     alignment and function description
>sp|Q6GGY8|CTPAL_STAAR Probable CtpA-like serine protease OS=Staphylococcus aureus (strain MRSA252) GN=SAR1432 PE=3 SV=1 Back     alignment and function description
>sp|Q2YXZ9|CTPAL_STAAB Probable CtpA-like serine protease OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1275c PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
359481833520 PREDICTED: carboxyl-terminal-processing 0.992 0.973 0.753 0.0
297739701431 unnamed protein product [Vitis vinifera] 0.839 0.993 0.837 0.0
356534629508 PREDICTED: carboxyl-terminal-processing 0.937 0.940 0.737 0.0
449453838511 PREDICTED: carboxyl-terminal-processing 0.978 0.976 0.720 0.0
334186065519 Peptidase S41 family protein [Arabidopsi 0.866 0.851 0.746 0.0
297817096517 peptidase S41 family protein [Arabidopsi 0.980 0.967 0.677 0.0
226493045520 carboxyl-terminal-processing protease [Z 0.850 0.834 0.706 1e-179
413953827520 carboxyl-terminal-processing protease is 0.850 0.834 0.704 1e-179
242092926522 hypothetical protein SORBIDRAFT_10g01216 0.850 0.831 0.695 1e-177
356498523504 PREDICTED: LOW QUALITY PROTEIN: carboxyl 0.892 0.902 0.681 1e-176
>gi|359481833|ref|XP_002277512.2| PREDICTED: carboxyl-terminal-processing protease-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/524 (75%), Positives = 435/524 (83%), Gaps = 18/524 (3%)

Query: 1   MEPLAPKIISPKSPNPIPVKLYP-----HRFWCSNRCKSKKWSMPMHSCASDNVKLAESS 55
           ME L+P      +PN +P  L P     HR   S +CK+   S P   C S    +A   
Sbjct: 1   MESLSPISTKFSNPNSLPSLLSPFSTFNHRRK-SRKCKAWTLSFP---CFSSYKTVATQC 56

Query: 56  KLQLNNR------KDFIESIAKGFVGFAAAATALASICFDSPAFAESLTVAFPASRAPEV 109
           K+QLN+R       D+  SI +G  G AAAA A+ S+C DSPA AESLTVAFP SRA EV
Sbjct: 57  KVQLNDRDLVKFESDWRRSIGRGLFGVAAAAAAMFSVCCDSPALAESLTVAFPVSRAREV 116

Query: 110 NTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLG 169
           NTVQRTLVE WGLIRETF+DPTFNHQDWD KLQQTMVE+FPL++ADAAY+KISGMLSTLG
Sbjct: 117 NTVQRTLVETWGLIRETFIDPTFNHQDWDLKLQQTMVEMFPLRTADAAYNKISGMLSTLG 176

Query: 170 DPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGHLVVLSCVEDSPAARAGIHEGDE 229
           DPFTRIISPKEYQ+FRIGSDGNLQGVG+FI+ EPRTGHL+VLSC+E SPAARAGIHEGDE
Sbjct: 177 DPFTRIISPKEYQNFRIGSDGNLQGVGIFINAEPRTGHLIVLSCIEGSPAARAGIHEGDE 236

Query: 230 LIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVGRESGTREVNIPRGYIKLSPI 289
           LIEINGERLDG D E AA KLRGR GT VTVK+HSG D G +SG REV + R +IKLSPI
Sbjct: 237 LIEINGERLDGTDDETAAQKLRGRVGTTVTVKLHSGTDWGSDSGFREVKLSRDFIKLSPI 296

Query: 290 SRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNP---V 346
           S  IIPH+TPDGH++K GYVKLSAFSQTAAA+M N IHE+E++   SYILDLRNNP   V
Sbjct: 297 SSAIIPHKTPDGHVSKLGYVKLSAFSQTAAAEMENCIHEMEAQDVCSYILDLRNNPGGLV 356

Query: 347 ILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSASASEILAG 406
            + LDVAQIWLDGDETLVN +DR+G+ LPINMVDGHAIT DPLVVLVNEGSASASEILAG
Sbjct: 357 KVGLDVAQIWLDGDETLVNTIDRDGNMLPINMVDGHAITRDPLVVLVNEGSASASEILAG 416

Query: 407 ALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCT 466
           ALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQC+
Sbjct: 417 ALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCS 476

Query: 467 TDMLSSPKESLLKNKSSVSSLEADSCIMVAEHELDVQESKGTAS 510
           T+MLSSPKESLLK+KSS SSLEADSCIMVAEHELDVQESKGT S
Sbjct: 477 TEMLSSPKESLLKDKSSASSLEADSCIMVAEHELDVQESKGTPS 520

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297739701|emb|CBI29883.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356534629|ref|XP_003535855.1| PREDICTED: carboxyl-terminal-processing protease-like [Glycine max] Back     alignment and taxonomy information
>gi|449453838|ref|XP_004144663.1| PREDICTED: carboxyl-terminal-processing protease-like [Cucumis sativus] gi|449480092|ref|XP_004155797.1| PREDICTED: carboxyl-terminal-processing protease-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|334186065|ref|NP_191327.4| Peptidase S41 family protein [Arabidopsis thaliana] gi|332646165|gb|AEE79686.1| Peptidase S41 family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297817096|ref|XP_002876431.1| peptidase S41 family protein [Arabidopsis lyrata subsp. lyrata] gi|297322269|gb|EFH52690.1| peptidase S41 family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|226493045|ref|NP_001148747.1| carboxyl-terminal-processing protease [Zea mays] gi|195621830|gb|ACG32745.1| carboxyl-terminal-processing protease precursor [Zea mays] Back     alignment and taxonomy information
>gi|413953827|gb|AFW86476.1| carboxyl-terminal-processing protease isoform 1 [Zea mays] gi|413953828|gb|AFW86477.1| carboxyl-terminal-processing protease isoform 2 [Zea mays] Back     alignment and taxonomy information
>gi|242092926|ref|XP_002436953.1| hypothetical protein SORBIDRAFT_10g012160 [Sorghum bicolor] gi|241915176|gb|EER88320.1| hypothetical protein SORBIDRAFT_10g012160 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|356498523|ref|XP_003518100.1| PREDICTED: LOW QUALITY PROTEIN: carboxyl-terminal-processing protease-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
UNIPROTKB|P73458423 prc "Carboxyl-terminal proteas 0.650 0.784 0.405 6.9e-63
UNIPROTKB|P75023462 ctpB "Carboxyl-terminal protea 0.666 0.735 0.375 5.1e-58
TAIR|locus:2129411515 AT4G17740 [Arabidopsis thalian 0.658 0.652 0.396 6.8e-56
TAIR|locus:2170443489 AT5G46390 [Arabidopsis thalian 0.674 0.703 0.347 1.8e-46
TIGR_CMR|CHY_0170377 CHY_0170 "carboxyl-terminal pr 0.582 0.787 0.352 3.6e-41
TIGR_CMR|GSU_0969450 GSU_0969 "carboxy-terminal pro 0.554 0.628 0.367 2.7e-36
TIGR_CMR|GSU_1772443 GSU_1772 "carboxy-terminal pro 0.562 0.647 0.329 3.1e-35
TIGR_CMR|CBU_1538456 CBU_1538 "carboxyl-terminal pr 0.582 0.651 0.352 1.3e-34
TIGR_CMR|DET_0364377 DET_0364 "carboxyl-terminal pr 0.586 0.793 0.300 2.7e-34
TIGR_CMR|CJE_0618444 CJE_0618 "carboxyl-terminal pr 0.568 0.653 0.329 1.5e-33
UNIPROTKB|P73458 prc "Carboxyl-terminal protease" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
 Score = 642 (231.1 bits), Expect = 6.9e-63, P = 6.9e-63
 Identities = 142/350 (40%), Positives = 214/350 (61%)

Query:   118 EAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIIS 177
             E W ++  T+VD TFN +DW +  Q  +   +  K+ + AY+ I  ML  L DP+TR +S
Sbjct:    46 EVWQIVNRTYVDGTFNGEDWVAVRQDYLTRDY--KNQEEAYTAIREMLEKLNDPYTRFMS 103

Query:   178 PKEYQSFRIGSDGNLQGVGLFISVEPRTGHLVVLSCVEDSPAARAGIHEGDELIEINGER 237
             P E+QS RI + G L GVG+ I+ +  T  +VV++ +ED+PA  AGI   D + +I+G+ 
Sbjct:   104 PDEFQSMRIDTSGELTGVGIQITQDQDTKKIVVVAPIEDTPAYNAGILSKDVITKIDGKS 163

Query:   238 LDGIDSEAAALKLRGRAGTPVTVKVHSGKDVGRESGTREVNIPRGYIKLSPISRTIIPHR 297
              DG++ + A   +RG+ GT V + +       RE    E  + R  I++ P+   +    
Sbjct:   164 TDGMEVDDAVKLIRGKPGTSVVLTIE------REGQAIEYPLTRTLIEIHPVRAQV---- 213

Query:   298 TPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNP---VILRLDVAQ 354
               D +  + GY++L+ FS  A+ +M   + +LE E    YI DLR+NP   +   +D+A+
Sbjct:   214 -EDINGARVGYIRLNQFSAQASEEMRQAVQKLEKENVVGYIFDLRSNPGGLLYSSVDIAR 272

Query:   355 IWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSASASEILAGALHDNGRA 414
             IWLD +  +V+ VDR G  +     +   +++ PLVVLV+ GSASASEI++GAL DN RA
Sbjct:   273 IWLD-EGGIVSTVDRRGE-VEQQSANKRQLSNRPLVVLVDGGSASASEIVSGALQDNQRA 330

Query:   415 ILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQ 464
             ++VG KTFGKG +QSV EL DGS + VT+AKYL+P   DI++ GI PDV+
Sbjct:   331 VIVGTKTFGKGLVQSVRELGDGSGMAVTIAKYLTPNGRDINKHGIDPDVE 380
GO:0030288 "outer membrane-bounded periplasmic space" evidence=IDA
UNIPROTKB|P75023 ctpB "Carboxyl-terminal protease" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
TAIR|locus:2129411 AT4G17740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170443 AT5G46390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0170 CHY_0170 "carboxyl-terminal protease" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0969 GSU_0969 "carboxy-terminal processing protease" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1772 GSU_1772 "carboxy-terminal processing protease" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1538 CBU_1538 "carboxyl-terminal protease family protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0364 DET_0364 "carboxyl-terminal protease" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0618 CJE_0618 "carboxyl-terminal protease" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.766
3rd Layer3.4.21.1020.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
TIGR00225334 TIGR00225, prc, C-terminal peptidase (prc) 2e-87
PLN00049389 PLN00049, PLN00049, carboxyl-terminal processing p 2e-87
COG0793406 COG0793, Prc, Periplasmic protease [Cell envelope 5e-86
cd07560211 cd07560, Peptidase_S41_CPP, C-terminal processing 1e-64
TIGR03900 973 TIGR03900, prc_long_Delta, putative carboxyl-termi 5e-53
smart00245192 smart00245, TSPc, tail specific protease 3e-48
pfam03572166 pfam03572, Peptidase_S41, Peptidase family S41 3e-48
cd06567224 cd06567, Peptidase_S41, C-terminal processing pept 5e-46
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 7e-20
PRK11186 667 PRK11186, PRK11186, carboxy-terminal protease; Pro 5e-19
cd07562266 cd07562, Peptidase_S41_TRI, Tricorn protease; seri 2e-15
cd07563250 cd07563, Peptidase_S41_IRBP, Interphotoreceptor re 2e-12
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 5e-12
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 3e-11
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 3e-10
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 6e-08
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 1e-07
pfam1318081 pfam13180, PDZ_2, PDZ domain 8e-07
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 2e-06
cd07561256 cd07561, Peptidase_S41_CPP_like, C-terminal proces 2e-06
cd06567224 cd06567, Peptidase_S41, C-terminal processing pept 6e-06
cd0099080 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain ass 3e-05
cd0099179 cd00991, PDZ_archaeal_metalloprotease, PDZ domain 0.002
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 0.002
>gnl|CDD|232883 TIGR00225, prc, C-terminal peptidase (prc) Back     alignment and domain information 
 Score =  271 bits (696), Expect = 2e-87
 Identities = 126/345 (36%), Positives = 194/345 (56%), Gaps = 22/345 (6%)

Query: 150 PLKSADAAYSKISGMLSTLGDPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGHLV 209
            L   +  Y  I GML++L DP+TR +SP+  +SF   + G+L+G+G  I V    G +V
Sbjct: 8   VLDETEEIYGAIKGMLASLNDPYTRYLSPETAKSFSETTSGSLEGIG--IQVGMDDGEIV 65

Query: 210 VLSCVEDSPAARAGIHEGDELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVG 269
           ++S  E SPA +AGI  GD++I+ING+ + G+  + A   +RG+ GT V++++       
Sbjct: 66  IVSPFEGSPAEKAGIKPGDKIIKINGKSVAGMSLDDAVALIRGKKGTKVSLEILRAG--- 122

Query: 270 RESGTREVNIPRGYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHEL 329
            +S      + R  I+L  +  ++       G     GY+++S+FS+    D+   + +L
Sbjct: 123 -KSKPLTFTLKRDRIELQTVKASVK---KVGGK--SVGYIRISSFSEHTTEDVKKALDKL 176

Query: 330 ESEGAHSYILDLRNNPVIL---RLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITH 386
           E + A  YILDLR NP  L    +D++++++     +V   DR G +      +G    +
Sbjct: 177 EKKNAKGYILDLRGNPGGLLQSAVDISRLFIT-KGPIVQTKDRNG-SKRHYKANGRQPYN 234

Query: 387 DPLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKY 446
            PLVVLVN GSASASEI AGAL DNGRA +VG KTFGKG +Q V  L+DGS + VT+AKY
Sbjct: 235 LPLVVLVNRGSASASEIFAGALQDNGRATIVGEKTFGKGTVQQVRPLNDGSGIKVTIAKY 294

Query: 447 LSPALHDIDQVGITPDVQCTTDMLSSPKESL-LKNKSSVSSLEAD 490
            +P    I + GI PD+      +  P +    + K  +++L  D
Sbjct: 295 YTPNGGSIHKKGIEPDIV-----IEQPDDPKEYEEKFELNALPWD 334

A C-terminal peptidase with different substrates in different species including processing of D1 protein of the photosystem II reaction center in higher plants and cleavage of a peptide of 11 residues from the precursor form of penicillin-binding protein in E.coli E.coli and H influenza have the most distal branch of the tree and their proteins have an N-terminal 200 amino acids that show no homology to other proteins in the database [Protein fate, Degradation of proteins, peptides, and glycopeptides, Protein fate, Protein modification and repair]. Length = 334
>gnl|CDD|177681 PLN00049, PLN00049, carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|143476 cd07560, Peptidase_S41_CPP, C-terminal processing peptidase; serine protease family S41 Back     alignment and domain information
>gnl|CDD|234386 TIGR03900, prc_long_Delta, putative carboxyl-terminal-processing protease, deltaproteobacterial Back     alignment and domain information
>gnl|CDD|214582 smart00245, TSPc, tail specific protease Back     alignment and domain information
>gnl|CDD|217620 pfam03572, Peptidase_S41, Peptidase family S41 Back     alignment and domain information
>gnl|CDD|143475 cd06567, Peptidase_S41, C-terminal processing peptidase family S41 Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|236873 PRK11186, PRK11186, carboxy-terminal protease; Provisional Back     alignment and domain information
>gnl|CDD|143478 cd07562, Peptidase_S41_TRI, Tricorn protease; serine protease family S41 Back     alignment and domain information
>gnl|CDD|143479 cd07563, Peptidase_S41_IRBP, Interphotoreceptor retinoid-binding protein; serine protease family S41 Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|143477 cd07561, Peptidase_S41_CPP_like, C-terminal processing peptidase-like; serine protease family S41 Back     alignment and domain information
>gnl|CDD|143475 cd06567, Peptidase_S41, C-terminal processing peptidase family S41 Back     alignment and domain information
>gnl|CDD|238490 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>gnl|CDD|238491 cd00991, PDZ_archaeal_metalloprotease, PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 510
PLN00049389 carboxyl-terminal processing protease; Provisional 100.0
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 100.0
PRK11186667 carboxy-terminal protease; Provisional 100.0
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 100.0
cd07562266 Peptidase_S41_TRI Tricorn protease; serine proteas 100.0
cd06567224 Peptidase_S41 C-terminal processing peptidase fami 100.0
cd07563250 Peptidase_S41_IRBP Interphotoreceptor retinoid-bin 100.0
smart00245192 TSPc tail specific protease. tail specific proteas 100.0
cd07560211 Peptidase_S41_CPP C-terminal processing peptidase; 99.98
cd07561256 Peptidase_S41_CPP_like C-terminal processing pepti 99.97
PF03572169 Peptidase_S41: Peptidase family S41; InterPro: IPR 99.96
PF1468470 Tricorn_C1: Tricorn protease C1 domain; PDB: 1N6F_ 99.41
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.29
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 99.18
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.99
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 98.93
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.81
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.8
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.8
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 98.7
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.61
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.57
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.56
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.5
COG3975558 Predicted protease with the C-terminal PDZ domain 98.32
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.17
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.16
PRK10139455 serine endoprotease; Provisional 98.14
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 98.13
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.1
PRK10898353 serine endoprotease; Provisional 98.09
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 98.05
PRK10779449 zinc metallopeptidase RseP; Provisional 98.05
PRK10779449 zinc metallopeptidase RseP; Provisional 98.01
PRK10942473 serine endoprotease; Provisional 97.97
KOG3209984 consensus WW domain-containing protein [General fu 97.94
KOG3550207 consensus Receptor targeting protein Lin-7 [Extrac 97.86
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 97.85
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.83
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.76
PRK10139455 serine endoprotease; Provisional 97.74
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 97.63
PRK10942473 serine endoprotease; Provisional 97.62
KOG3129231 consensus 26S proteasome regulatory complex, subun 97.58
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 97.52
COG0265347 DegQ Trypsin-like serine proteases, typically peri 97.28
KOG3209 984 consensus WW domain-containing protein [General fu 97.15
KOG3549 505 consensus Syntrophins (type gamma) [Extracellular 96.85
KOG3580 1027 consensus Tight junction proteins [Signal transduc 96.81
COG3480342 SdrC Predicted secreted protein containing a PDZ d 96.69
PRK09681276 putative type II secretion protein GspC; Provision 96.65
KOG1892 1629 consensus Actin filament-binding protein Afadin [C 96.64
KOG3651429 consensus Protein kinase C, alpha binding protein 96.59
KOG3552 1298 consensus FERM domain protein FRM-8 [General funct 96.58
KOG3580 1027 consensus Tight junction proteins [Signal transduc 96.47
KOG3551506 consensus Syntrophins (type beta) [Extracellular s 96.26
KOG1421 955 consensus Predicted signaling-associated protein ( 96.2
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 95.97
KOG3532 1051 consensus Predicted protein kinase [General functi 95.94
KOG0609542 consensus Calcium/calmodulin-dependent serine prot 95.62
KOG3605829 consensus Beta amyloid precursor-binding protein [ 95.38
KOG3571626 consensus Dishevelled 3 and related proteins [Gene 94.83
KOG1320473 consensus Serine protease [Posttranslational modif 93.91
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 93.49
COG3031275 PulC Type II secretory pathway, component PulC [In 92.99
KOG0606 1205 consensus Microtubule-associated serine/threonine 92.72
PF1281278 PDZ_1: PDZ-like domain 92.38
KOG3834462 consensus Golgi reassembly stacking protein GRASP6 92.29
KOG3605829 consensus Beta amyloid precursor-binding protein [ 91.45
KOG3938334 consensus RGS-GAIP interacting protein GIPC, conta 91.42
KOG1738 638 consensus Membrane-associated guanylate kinase-int 90.81
KOG3834 462 consensus Golgi reassembly stacking protein GRASP6 87.89
COG0750375 Predicted membrane-associated Zn-dependent proteas 84.94
PF11874183 DUF3394: Domain of unknown function (DUF3394); Int 83.71
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 81.46
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.9e-62  Score=513.47  Aligned_cols=353  Identities=39%  Similarity=0.659  Sum_probs=307.9

Q ss_pred             cHHHHHHHHHHHHHHHHcCCCCCCCCChHHHHHHHHHHhcCCCCHHHHHHHHHHhHhhcCCCceEeeChHHHhhhhccCC
Q 047092          110 NTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIISPKEYQSFRIGSD  189 (510)
Q Consensus       110 ~~~q~~f~e~w~~i~~~Y~~~~~~~~dWd~~~~~~~~~~~~a~~~~e~~~~i~~ml~~L~D~Ht~~~~~~~~~~~~~~~~  189 (510)
                      ++.+++|+++|+.++++||+++++|+||++..++|.+.. +..+.++++.+|++|+++|+|+|++|++++++..+.....
T Consensus         3 ~~~~~~f~e~w~~v~~~~~d~~~~g~dW~~~~e~y~~~~-~~~~~~~~~~~i~~ml~~L~D~hs~y~~~~~~~~~~~~~~   81 (389)
T PLN00049          3 TEENLLFLEAWRTVDRAYVDKTFNGQSWFRYRENALKNE-PMNTREETYAAIRKMLATLDDPFTRFLEPEKFKSLRSGTK   81 (389)
T ss_pred             ccHHHHHHHHHHHHHHHHcCccccccCHHHHHHHHhhcc-CCCcHHHHHHHHHHHHhhCCCCcccCcCHHHHHHHHHhcc
Confidence            457899999999999999999999999999999988875 6788889999999999999999999999999998887778


Q ss_pred             CceeeeeEEEEEEcCC----CcEEEEeecCCChhhhcCCCCCCEEEEECCEecCCCCHHHHHHHHcCCCCCeEEEEEEeC
Q 047092          190 GNLQGVGLFISVEPRT----GHLVVLSCVEDSPAARAGIHEGDELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSG  265 (510)
Q Consensus       190 g~~~glGi~l~~~~~~----g~l~V~~v~~gsPA~~AGL~~GD~IlaING~~v~~~~~~~~~~ll~g~~G~~V~l~v~r~  265 (510)
                      +.+.|+|+.+.....+    .+++|..|.+||||+++||++||+|++|||+++.+++..++..++++..|+.|.|+|.|+
T Consensus        82 ~~~~GiG~~~~~~~~~~~~~~g~~V~~V~~~SPA~~aGl~~GD~Iv~InG~~v~~~~~~~~~~~l~g~~g~~v~ltv~r~  161 (389)
T PLN00049         82 GAVTGVGLEVGYPTGSDGPPAGLVVVAPAPGGPAARAGIRPGDVILAIDGTSTEGLSLYEAADRLQGPEGSSVELTLRRG  161 (389)
T ss_pred             CCceEEEEEEEEccCCCCccCcEEEEEeCCCChHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHhcCCCCEEEEEEEEC
Confidence            8899999998764322    168999999999999999999999999999999998878888899999999999999987


Q ss_pred             CCCCCCCceEEEEEecceeeeCCCcceeeeccCCCCCcCceEEEEecccchhHHHHHHHHHHHHHHcCCCEEEEEcCCCC
Q 047092          266 KDVGRESGTREVNIPRGYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNP  345 (510)
Q Consensus       266 ~~~~~~g~~~~vtl~r~~~~~~~v~~~~i~~~~~~~~~~~igYi~i~sF~~~~~~~l~~~l~~l~~~~~~~LIlDLR~N~  345 (510)
                            ++.++++|+|..+..+|+....+.....+..+++||||+|++|..++.+++.++|++++++++++||||||+|+
T Consensus       162 ------g~~~~~~l~r~~v~~~~v~~~~~~~~~~~~~~~~IgYi~i~~F~~~~~~~~~~~l~~l~~~~~~glIlDLR~N~  235 (389)
T PLN00049        162 ------PETRLVTLTREKVSLNPVKSRLCEVPGPGAGSPKIGYIKLTTFNQNASSAVKEAIETLRANGVDAFVLDLRDNS  235 (389)
T ss_pred             ------CEEEEEEEEeeeEeccceeeEEEeeccccCCCCCEEEEEeccccchhHHHHHHHHHHHHHCCCCEEEEEcCCCC
Confidence                  57889999999998888877654211111113589999999999999999999999999999999999999999


Q ss_pred             ---hhhHHHHHHhhcCCCceEEEEecCCCceeEEEcCCC-CccCCCcEEEEEcCCCCcHHHHHHHHHhcCCCeEEEccCC
Q 047092          346 ---VILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDG-HAITHDPLVVLVNEGSASASEILAGALHDNGRAILVGHKT  421 (510)
Q Consensus       346 ---~~~~~~la~~fl~~~~~~~~~~~r~g~~~~~~~~~~-~~~~~gpvvVLvn~~TaSaaE~~a~~Lk~~~~a~vVG~~T  421 (510)
                         +..+..++++|++++ .++++..+.+....+..... ...+.+|++||||++||||||+|+++||+++++++||++|
T Consensus       236 GG~~~~a~~ia~~f~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~PvvVLvn~~TaSasEi~a~alk~~~~~~vvG~~T  314 (389)
T PLN00049        236 GGLFPAGIEIAKLWLDKG-VIVYIADSRGVRDIYDADGSSAIATSEPLAVLVNKGTASASEILAGALKDNKRAVVLGEPT  314 (389)
T ss_pred             CCCHHHHHHHHHHhcCCC-cEEEEecCCCceeEEecCCCccccCCCCEEEEECCCCccHHHHHHHHHhhCCCeEEEecCC
Confidence               667889999999987 46666666555433333222 2347899999999999999999999999999999999999


Q ss_pred             CCCceeeeEEEcCCCcEEEEEEEEEEcCCCCcccCCCccccEEecCCCC
Q 047092          422 FGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCTTDML  470 (510)
Q Consensus       422 ~G~g~~~~~~~L~dg~~l~vt~~~~~~p~G~~~e~~GV~PDi~V~~~~~  470 (510)
                      +|++..|..+.|+||+.+++|+++|++|+|+.+|+.||.||+.|+....
T Consensus       315 ~Gkg~~q~~~~L~dG~~l~lt~~~~~~p~G~~ie~~Gi~PDi~v~~~~~  363 (389)
T PLN00049        315 FGKGLIQSVFELSDGSGLAVTVARYQTPAGTDIDKVGITPDHPLPESLP  363 (389)
T ss_pred             cCCcccceeEEeCCCCEEEEEEEEEECCCCCCcCCCCcCCCeECCCCCC
Confidence            9999999999999999999999999999999999999999999975443

>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>cd07562 Peptidase_S41_TRI Tricorn protease; serine protease family S41 Back     alignment and domain information
>cd06567 Peptidase_S41 C-terminal processing peptidase family S41 Back     alignment and domain information
>cd07563 Peptidase_S41_IRBP Interphotoreceptor retinoid-binding protein; serine protease family S41 Back     alignment and domain information
>smart00245 TSPc tail specific protease Back     alignment and domain information
>cd07560 Peptidase_S41_CPP C-terminal processing peptidase; serine protease family S41 Back     alignment and domain information
>cd07561 Peptidase_S41_CPP_like C-terminal processing peptidase-like; serine protease family S41 Back     alignment and domain information
>PF03572 Peptidase_S41: Peptidase family S41; InterPro: IPR005151 This group of putative serine peptidases belong to the MEROPS peptidase family S41 (C-terminal processing peptidase family, clan SM) Back     alignment and domain information
>PF14684 Tricorn_C1: Tricorn protease C1 domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3551 consensus Syntrophins (type beta) [Extracellular structures] Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>KOG3938 consensus RGS-GAIP interacting protein GIPC, contains PDZ domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1738 consensus Membrane-associated guanylate kinase-interacting protein/connector enhancer of KSR-like [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF11874 DUF3394: Domain of unknown function (DUF3394); InterPro: IPR021814 This domain is functionally uncharacterised Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
1fc7_A388 Photosystem Ii D1 C-Terminal Processing Protease Le 8e-55
1fc6_A388 Photosystem Ii D1 C-Terminal Processing Protease Le 3e-53
2w4f_A97 Crystal Structure Of The First Pdz Domain Of Human 1e-04
1x5q_A110 Solution Structure Of The First Pdz Domain Of Scrib 2e-04
4f8k_A109 Molecular Analysis Of The Interaction Between The P 7e-04
>pdb|1FC7|A Chain A, Photosystem Ii D1 C-Terminal Processing Protease Length = 388 Back     alignment and structure 
Iteration: 1

 Score =  211 bits (537), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 133/373 (35%), Positives = 210/373 (56%), Gaps = 18/373 (4%)
Query: 109 VNTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTL 168
           V + Q   +EAW  +   +VD +FN Q W  KL++T ++  P+      Y  I  +L+ L
Sbjct: 2   VTSEQLLFLEAWRAVDRAYVDKSFNGQSW-FKLRETYLKKEPMDRRAQTYDAIRKLLAVL 60
Query: 169 GDPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGH-LVVLSCVEDSPAARAGIHEG 227
            DPFTR + P    + R G+ G++ GVGL I+ +  +G  +VVL+     PA +AG   G
Sbjct: 61  DDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAG 120
Query: 228 DELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVGRESGTREVNIPRGYIKLS 287
           D ++ ++G  + G+     +  L+G A + V V +H+    G  S TR + + R  + ++
Sbjct: 121 DVIVTVDGTAVKGLSLYDVSDLLQGEADSQVEVVLHA---PGAPSNTRTLQLTRQKVTIN 177
Query: 288 PISRTIIPHRTPDGHLT-----KTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLR 342
           P++ T   +             + GYV+L+ F+    A       EL  +G    +LD+R
Sbjct: 178 PVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIR 237
Query: 343 NNPVIL---RLDVAQIWLD-GDETLVNAVDREGHTLPINMVDGHAI-THDPLVVLVNEGS 397
           NN   L    ++VA++ +D GD  L+   D +G    I   DG++I +  PLVVLVN G+
Sbjct: 238 NNGGGLFPAGVNVARMLVDRGDLVLI--ADSQG-IRDIYSADGNSIDSATPLVVLVNRGT 294
Query: 398 ASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQV 457
           ASASE+LAGAL D+ R ++ G +TFGKG IQ+V +L DGS + VTVA+Y +PA  DI+++
Sbjct: 295 ASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKI 354
Query: 458 GITPDVQCTTDML 470
           G++PDVQ   ++L
Sbjct: 355 GVSPDVQLDPEVL 367
>pdb|1FC6|A Chain A, Photosystem Ii D1 C-Terminal Processing Protease Length = 388 Back     alignment and structure
>pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 Back     alignment and structure
>pdb|1X5Q|A Chain A, Solution Structure Of The First Pdz Domain Of Scribble Homolog Protein (Hscrib) Length = 110 Back     alignment and structure
>pdb|4F8K|A Chain A, Molecular Analysis Of The Interaction Between The Prostacyclin Receptor And The First Pdz Domain Of Pdzk1 Length = 109 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 1e-141
3k50_A403 Putative S41 protease; structural genomics, joint 8e-72
1k32_A1045 Tricorn protease; protein degradation, substrate g 1e-56
1j7x_A302 IRBP, interphotoreceptor retinoid-binding protein; 2e-49
3dor_A583 Protein CT_858, CPAF; mature CPAF, dimer, transfer 6e-40
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 7e-15
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 2e-11
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-09
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 6e-09
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 7e-09
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 8e-09
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 1e-08
2ego_A96 General receptor for phosphoinositides 1- associat 2e-08
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 2e-08
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-08
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 2e-08
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 3e-08
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 3e-08
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 4e-08
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 5e-08
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 6e-08
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 6e-08
2eei_A106 PDZ domain-containing protein 1; regulatory factor 6e-08
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 8e-08
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 8e-08
2eaq_A90 LIM domain only protein 7; conserved hypothetical 9e-08
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 9e-08
2eeh_A100 PDZ domain-containing protein 7; structural genomi 1e-07
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 1e-07
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 1e-07
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 1e-07
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 1e-07
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-07
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-06
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 2e-07
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-07
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 2e-07
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 2e-07
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 2e-07
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 2e-07
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 2e-07
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-07
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 2e-07
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 3e-07
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 3e-07
3khf_A99 Microtubule-associated serine/threonine-protein ki 3e-07
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-07
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 3e-07
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 3e-07
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 3e-07
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 3e-07
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 3e-07
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 3e-07
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 3e-07
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 3e-07
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-07
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 4e-07
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 4e-07
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 4e-07
3k1r_A192 Harmonin; protein-protein complex, alternative spl 4e-07
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 4e-07
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 4e-07
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 5e-07
2v90_A96 PDZ domain-containing protein 3; membrane, protein 5e-07
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 5e-07
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 5e-07
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 6e-07
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 6e-07
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 6e-07
2awx_A105 Synapse associated protein 97; membrane protein, s 6e-07
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 7e-07
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 7e-07
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 7e-07
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 7e-07
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 7e-07
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 7e-07
2byg_A117 Channel associated protein of synapse-110; DLG2, P 7e-07
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 8e-07
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 7e-04
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 8e-07
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 8e-07
2djt_A104 Unnamed protein product; PDZ domain, structural ge 8e-07
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 9e-07
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 9e-07
2opg_A98 Multiple PDZ domain protein; structural protein, s 1e-06
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-06
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 1e-06
2d90_A102 PDZ domain containing protein 1; structural genomi 1e-06
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 1e-06
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 1e-06
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 1e-06
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 2e-06
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 2e-06
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-06
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-05
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-06
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 2e-06
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-06
2xkx_A721 Disks large homolog 4; structural protein, scaffol 2e-06
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 3e-05
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-06
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 3e-05
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 2e-06
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 2e-06
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-06
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 2e-06
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 2e-06
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 3e-06
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 3e-06
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 3e-06
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 3e-06
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 3e-06
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 3e-06
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 3e-06
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 3e-06
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 4e-06
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 4e-06
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 4e-06
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 4e-06
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 4e-06
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 5e-06
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 5e-06
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 5e-06
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 6e-06
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 6e-06
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 9e-06
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 9e-06
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 9e-06
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 9e-06
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 1e-05
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 1e-05
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-05
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 1e-05
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 1e-05
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 1e-05
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-05
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-05
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 2e-05
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 2e-05
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 2e-05
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 2e-05
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 2e-05
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 2e-05
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-05
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-05
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 2e-05
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 3e-05
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 3e-05
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 3e-05
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 4e-05
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 4e-05
2hga_A125 Conserved protein MTH1368; GFT structural genomics 4e-05
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 4e-05
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 4e-05
4fgm_A597 Aminopeptidase N family protein; structural genomi 5e-05
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 5e-05
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 6e-05
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 1e-04
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 1e-04
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 1e-04
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 1e-04
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 1e-04
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 2e-04
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 2e-04
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 2e-04
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 2e-04
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 3e-04
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 3e-04
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 3e-04
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 3e-04
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 3e-04
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 4e-04
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 4e-04
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 4e-04
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 5e-04
2kl1_A94 YLBL protein; structure genomics, structural genom 6e-04
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 Back     alignment and structure
 Score =  409 bits (1054), Expect = e-141
 Identities = 131/384 (34%), Positives = 209/384 (54%), Gaps = 14/384 (3%)

Query: 109 VNTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTL 168
           V + Q   +EAW  +   +VD +FN Q W  KL++T ++  P+      Y  I  ML+ L
Sbjct: 2   VTSEQLLFLEAWRAVDRAYVDKSFNGQSWF-KLRETYLKKEPMDRRAQTYDAIRKMLAVL 60

Query: 169 GDPFTRIISPKEYQSFRIGSDGNLQGVGLFISVEPRTGH-LVVLSCVEDSPAARAGIHEG 227
            DPFTR + P    + R G+ G++ GVGL I+ +  +G  +VVL+     PA +AG   G
Sbjct: 61  DDPFTRFLEPSRLAALRRGTAGSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAG 120

Query: 228 DELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVGRESGTREVNIPRGYIKLS 287
           D ++ ++G  + G+     +  L+G A + V V +H+    G  S TR + + R  + ++
Sbjct: 121 DVIVTVDGTAVKGMSLYDVSDLLQGEADSQVEVVLHAP---GAPSNTRTLQLTRQKVTIN 177

Query: 288 PISRTIIPHRT-----PDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLR 342
           P++ T   +       P     + GYV+L+ F+    A       EL  +G    +LD+R
Sbjct: 178 PVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIR 237

Query: 343 NNP---VILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSAS 399
           NN        ++VA++ +D  + LV   D +G     +       +  PLVVLVN G+AS
Sbjct: 238 NNGGGLFPAGVNVARMLVDRGD-LVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTAS 296

Query: 400 ASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGI 459
           ASE+LAGAL D+ R ++ G +TFGKG IQ+V +L DGS + VTVA+Y +PA  DI+++G+
Sbjct: 297 ASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGV 356

Query: 460 TPDVQCTTDMLSSPKESLLKNKSS 483
           +PDVQ   ++L +  E + +   S
Sbjct: 357 SPDVQLDPEVLPTDLEGVCRVLGS 380
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 Back     alignment and structure
>1j7x_A IRBP, interphotoreceptor retinoid-binding protein; beta BETA alpha spiral, transport protein; 1.80A {Xenopus laevis} SCOP: c.14.1.2 Length = 302 Back     alignment and structure
>3dor_A Protein CT_858, CPAF; mature CPAF, dimer, transferase; 2.20A {Chlamydia trachomatis} PDB: 3dpm_A* 3dpn_A 3dja_A Length = 583 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 100.0
1k32_A1045 Tricorn protease; protein degradation, substrate g 100.0
3k50_A403 Putative S41 protease; structural genomics, joint 100.0
3dor_A583 Protein CT_858, CPAF; mature CPAF, dimer, transfer 100.0
1j7x_A302 IRBP, interphotoreceptor retinoid-binding protein; 100.0
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.37
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.34
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.26
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.24
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.23
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.15
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.14
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.14
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.13
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.11
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.11
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.11
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.1
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.1
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.09
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.08
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.08
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.08
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.08
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.07
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.07
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.06
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.06
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.06
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.04
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.04
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.04
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.04
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.04
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.04
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.03
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.03
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.03
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.03
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.03
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.02
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.02
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.02
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.01
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.01
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.01
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.01
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.0
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.0
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.0
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.0
2d90_A102 PDZ domain containing protein 1; structural genomi 99.0
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.0
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.99
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.99
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.98
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.98
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.98
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.97
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.97
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.97
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.97
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.97
2awx_A105 Synapse associated protein 97; membrane protein, s 98.97
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.97
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.96
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.96
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.96
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.96
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.95
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.95
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.95
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.94
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.94
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.93
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.93
2ego_A96 General receptor for phosphoinositides 1- associat 98.93
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.93
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.92
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.92
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.92
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.92
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.91
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.91
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 98.91
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.9
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.9
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.9
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.9
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.9
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.9
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.9
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.89
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.89
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.89
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 98.89
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.89
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.89
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.89
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.89
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.88
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.88
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.87
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.87
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.87
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.87
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.87
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.87
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.86
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.86
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.86
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.86
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.85
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.85
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.85
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.85
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.84
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.84
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.84
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.83
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.83
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.83
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 98.82
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.82
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.82
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.81
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.81
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.81
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.81
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.81
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.81
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.81
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.8
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.8
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.8
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.8
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.8
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.79
2kl1_A94 YLBL protein; structure genomics, structural genom 98.79
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.79
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 98.79
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.78
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.78
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.78
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.78
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.78
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.78
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.77
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.77
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.76
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.76
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.75
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.75
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.75
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.74
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.73
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.73
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.72
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.7
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.69
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.69
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.69
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.69
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.69
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 98.69
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.13
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.68
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.67
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.67
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.66
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.65
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.64
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.63
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.62
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.62
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.62
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.58
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.57
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.53
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.52
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.5
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.48
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.47
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.45
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.44
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.42
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.42
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.39
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.37
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.35
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.33
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.32
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.18
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.07
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.06
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.06
2xkx_A721 Disks large homolog 4; structural protein, scaffol 97.98
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.89
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 97.7
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 97.69
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.64
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 97.44
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 95.83
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
Probab=100.00  E-value=3e-62  Score=512.13  Aligned_cols=354  Identities=35%  Similarity=0.604  Sum_probs=314.6

Q ss_pred             cHHHHHHHHHHHHHHHHcCCCCCCCCChHHHHHHHHHHhcCCCCHHHHHHHHHHhHhhcCCCceEeeChHHHhhhhccCC
Q 047092          110 NTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIISPKEYQSFRIGSD  189 (510)
Q Consensus       110 ~~~q~~f~e~w~~i~~~Y~~~~~~~~dWd~~~~~~~~~~~~a~~~~e~~~~i~~ml~~L~D~Ht~~~~~~~~~~~~~~~~  189 (510)
                      +++++.|+++|+.|+++|+++.++++||++++++|++. ....+.++++.+|.+|+++|+|+||.|++++++..+.....
T Consensus         3 ~~~~~~f~~~w~~i~~~y~~~~~~~~dW~~~~~~y~~~-~~~~~~~~~~~~i~~ml~~L~D~hs~~~~~~~~~~~~~~~~   81 (388)
T 1fc6_A            3 TSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKK-EPMDRRAQTYDAIRKMLAVLDDPFTRFLEPSRLAALRRGTA   81 (388)
T ss_dssp             CHHHHHHHHHHHHHHHHCSCTTGGGCCHHHHHHHHHHH-SCCSSHHHHHHHHHHHHHTTCCTTCEEECHHHHHHHHHCSS
T ss_pred             ccHHHHHHHHHHHHHHHHhcccccCccHHHHHHHhhhc-cCCCCHHHHHHHHHHHHHhcCCCcceecCHHHHHHHHHhhc
Confidence            46789999999999999999999999999999999987 67889999999999999999999999999999999887778


Q ss_pred             CceeeeeEEEEEE-cCCCcEEEEeecCCChhhhcCCCCCCEEEEECCEecCCCCHHHHHHHHcCCCCCeEEEEEEeCCCC
Q 047092          190 GNLQGVGLFISVE-PRTGHLVVLSCVEDSPAARAGIHEGDELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDV  268 (510)
Q Consensus       190 g~~~glGi~l~~~-~~~g~l~V~~v~~gsPA~~AGL~~GD~IlaING~~v~~~~~~~~~~ll~g~~G~~V~l~v~r~~~~  268 (510)
                      |.+.|+|+.+... ..+++++|..|.+||||++|||++||+|++|||+++.++..+++..++++..|++|+|+|.|.+  
T Consensus        82 g~~~giG~~~~~~~~~~~~~~V~~v~~~spA~~aGl~~GD~I~~Ing~~v~~~~~~~~~~~l~~~~g~~v~l~v~r~g--  159 (388)
T 1fc6_A           82 GSVTGVGLEITYDGGSGKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQGEADSQVEVVLHAPG--  159 (388)
T ss_dssp             SSCBBCSEEEEECTTCSSCEEEEEECTTSHHHHTTCCTTCEEEEETTEECTTCCHHHHHHHHCBSTTCEEEEEEEETT--
T ss_pred             CceEEEEEEEEEeecCCCcEEEEEeCCCChHHHcCCCCCCEEEEECCEECCCCCHHHHHHHHhcCCCCEEEEEEEeCC--
Confidence            8999999998764 2357899999999999999999999999999999999998888999999999999999999974  


Q ss_pred             CCCC--ceEEEEEecceeeeCCCcceeeec-----cCCCCCcCceEEEEecccchhHHHHHHHHHHHHHHcCCCEEEEEc
Q 047092          269 GRES--GTREVNIPRGYIKLSPISRTIIPH-----RTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDL  341 (510)
Q Consensus       269 ~~~g--~~~~vtl~r~~~~~~~v~~~~i~~-----~~~~~~~~~igYi~i~sF~~~~~~~l~~~l~~l~~~~~~~LIlDL  341 (510)
                         .  +.++++|+|..+..+++.+..+..     ...+..+++||||+|++|..++.++|.++|.+|+++++++|||||
T Consensus       160 ---~~~~~~~~~l~r~~i~~~~v~~~~~~~~~~~~~~~~~~~~~igYi~i~~F~~~~~~~~~~~l~~l~~~~~~~lIlDL  236 (388)
T 1fc6_A          160 ---APSNTRTLQLTRQKVTINPVTFTTCSNVAAAALPPGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDI  236 (388)
T ss_dssp             ---EEEEEEEEEEECBCCCCCCEEEEEECSCCGGGSCTTCSSSCEEEEEECCBSTTHHHHHHHHHHHHHHTTCSEEEEEC
T ss_pred             ---CCcceEEEEEEEceeecCceeeeeeccccccccccccCCCCEEEEEeCccCcchHHHHHHHHHHHHhCCCCeEEEEc
Confidence               2  278999999988888887665420     001122468999999999999899999999999989999999999


Q ss_pred             CCCC---hhhHHHHHHhhcCCCceEEEEecCCCceeEEEcCCCCc-cCCCcEEEEEcCCCCcHHHHHHHHHhcCCCeEEE
Q 047092          342 RNNP---VILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHA-ITHDPLVVLVNEGSASASEILAGALHDNGRAILV  417 (510)
Q Consensus       342 R~N~---~~~~~~la~~fl~~~~~~~~~~~r~g~~~~~~~~~~~~-~~~gpvvVLvn~~TaSaaE~~a~~Lk~~~~a~vV  417 (510)
                      |+|+   +..+..++++|++++ .+++++.|.|....+.. .+.. .+.+||+||||++||||||+|+++||+++++++|
T Consensus       237 R~N~GG~~~~~~~~~~~f~~~~-~i~~~~~r~~~~~~~~~-~~~~~~~~~pv~VLvn~~taSasEi~a~al~~~~~~~~v  314 (388)
T 1fc6_A          237 RNNGGGLFPAGVNVARMLVDRG-DLVLIADSQGIRDIYSA-DGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIA  314 (388)
T ss_dssp             TTCCCBCHHHHHHHHHHHCSSS-EEEEEEETTEEEEEEEC-CSCCSCSSSCEEEEECTTCCTHHHHHHHHHHHTTSEEEE
T ss_pred             CCCCCCCHHHHHHHHHHHcCCC-cEEEEecCCCceeEEec-CCccccCCCCEEEEeCCCCccHHHHHHHHHhhCCCEEEE
Confidence            9999   667888999999987 67888888887655543 3333 3899999999999999999999999999999999


Q ss_pred             ccCCCCCceeeeEEEcCCCcEEEEEEEEEEcCCCCcccCCCccccEEecCCCCC
Q 047092          418 GHKTFGKGKIQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCTTDMLS  471 (510)
Q Consensus       418 G~~T~G~g~~~~~~~L~dg~~l~vt~~~~~~p~G~~~e~~GV~PDi~V~~~~~~  471 (510)
                      |++|+|++.++..++|+||+.+.+|+++|++|+|+.+++.||.|||+|+.+.+.
T Consensus       315 G~~T~Gkg~~~~~~~L~~g~~l~~t~~~~~~p~G~~~~~~Gi~PDi~v~~~~~~  368 (388)
T 1fc6_A          315 GERTFGKGLIQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVLP  368 (388)
T ss_dssp             ESCCCCCCEEEEEEECTTSCEEEEEEEEEECTTSCBCTTTCCCCSEECCTTSSC
T ss_pred             eecCCCCCeeeeEEEcCCCCEEEEEEEEEEcCCCCCccCCCcCCCEEeCCcccc
Confidence            999999999999999999999999999999999999999999999999988643
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3dor_A Protein CT_858, CPAF; mature CPAF, dimer, transferase; 2.20A {Chlamydia trachomatis} PDB: 3dpm_A* 3dpn_A 3dja_A Back     alignment and structure
>1j7x_A IRBP, interphotoreceptor retinoid-binding protein; beta BETA alpha spiral, transport protein; 1.80A {Xenopus laevis} SCOP: c.14.1.2 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 510
d1fc6a4294 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C- 8e-38
d1fc6a4294 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C- 7e-22
d1j7xa_302 c.14.1.2 (A:) Interphotoreceptor retinoid-binding 5e-26
d1k32a4291 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease { 1e-21
d1k32a4291 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease { 1e-12
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 1e-13
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 8e-12
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-11
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 1e-10
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 2e-09
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 2e-09
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 3e-09
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 4e-09
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 1e-08
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 2e-08
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 3e-08
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 4e-08
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-08
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-07
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 1e-07
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 1e-07
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-07
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-07
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 2e-07
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-07
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 3e-07
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 3e-07
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 3e-07
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 4e-07
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 4e-07
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 5e-07
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 5e-07
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 6e-07
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 7e-07
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 8e-07
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-06
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 1e-06
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 2e-06
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 6e-06
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 7e-06
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 9e-06
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-05
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 1e-05
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-05
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 1e-05
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 1e-05
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 1e-05
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 3e-05
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 3e-05
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 4e-05
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 4e-05
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 4e-05
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 4e-05
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 7e-05
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 7e-05
d1k32a191 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Th 1e-04
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 1e-04
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 2e-04
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-04
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-04
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 4e-04
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 5e-04
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 5e-04
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 5e-04
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 0.001
>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 294 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Tail specific protease, catalytic domain
domain: Photosystem II D1 C-terminal processing protease
species: Algae (Scenedesmus obliquus) [TaxId: 3088]

 Score =  138 bits (348), Expect = 8e-38
 Identities = 72/212 (33%), Positives = 116/212 (54%), Gaps = 7/212 (3%)

Query: 271 ESGTREVNIPRGYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELE 330
             GT+    P  +   S ++   +P         + GYV+L+ F+    A       EL 
Sbjct: 76  RRGTKVTINPVTFTTCSNVAAAALPPGAAKQ---QLGYVRLATFNSNTTAAAQQAFTELS 132

Query: 331 SEGAHSYILDLRNNP---VILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHD 387
            +G    +LD+RNN        ++VA++ +D  + ++ A  +       +       +  
Sbjct: 133 KQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIADSQGIRD-IYSADGNSIDSAT 191

Query: 388 PLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGKIQSVTELHDGSALFVTVAKYL 447
           PLVVLVN G+ASASE+LAGAL D+ R ++ G +TFGKG IQ+V +L DGS + VTVA+Y 
Sbjct: 192 PLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVARYQ 251

Query: 448 SPALHDIDQVGITPDVQCTTDMLSSPKESLLK 479
           +PA  DI+++G++PDVQ   ++L +  E + +
Sbjct: 252 TPAGVDINKIGVSPDVQLDPEVLPTDLEGVCR 283
>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 294 Back     information, alignment and structure
>d1j7xa_ c.14.1.2 (A:) Interphotoreceptor retinoid-binding protein IRBP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 302 Back     information, alignment and structure
>d1k32a4 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 291 Back     information, alignment and structure
>d1k32a4 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 291 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
d1fc6a4294 Photosystem II D1 C-terminal processing protease { 100.0
d1k32a4291 Tricorn protease {Archaeon Thermoplasma acidophilu 100.0
d1j7xa_302 Interphotoreceptor retinoid-binding protein IRBP { 99.96
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.64
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 99.37
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.31
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.19
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.15
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.13
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.07
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.06
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.04
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.04
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.03
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.01
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 98.97
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.97
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 98.96
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.96
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.94
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 98.93
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.93
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 98.93
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.93
d1y7na179 Amyloid beta A4 precursor protein-binding family A 98.92
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 98.91
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 98.91
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 98.9
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.9
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 98.9
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.88
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 98.88
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 98.87
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 98.86
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.85
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 98.85
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 98.82
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.81
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.81
d1x45a185 Amyloid beta A4 precursor protein-binding family A 98.81
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 98.8
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 98.8
d1rzxa_98 GTPase-binding domain of the cell polarity protein 98.79
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 98.79
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.79
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 98.78
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.78
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.77
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 98.77
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 98.74
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 98.73
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.71
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.71
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 98.7
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.7
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 98.69
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.69
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 98.69
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 98.68
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 98.66
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.62
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.59
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.56
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 98.54
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 98.48
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.47
>d1fc6a4 c.14.1.2 (A:78-156,A:249-463) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Tail specific protease, catalytic domain
domain: Photosystem II D1 C-terminal processing protease
species: Algae (Scenedesmus obliquus) [TaxId: 3088]

Probab=100.00  E-value=1.8e-47  Score=383.35  Aligned_cols=270  Identities=36%  Similarity=0.613  Sum_probs=224.4

Q ss_pred             cHHHHHHHHHHHHHHHHcCCCCCCCCChHHHHHHHHHHhcCCCCHHHHHHHHHHhHhhcCCCceEeeChHHHhhhhccCC
Q 047092          110 NTVQRTLVEAWGLIRETFVDPTFNHQDWDSKLQQTMVEIFPLKSADAAYSKISGMLSTLGDPFTRIISPKEYQSFRIGSD  189 (510)
Q Consensus       110 ~~~q~~f~e~w~~i~~~Y~~~~~~~~dWd~~~~~~~~~~~~a~~~~e~~~~i~~ml~~L~D~Ht~~~~~~~~~~~~~~~~  189 (510)
                      +..|+.|+++|+.++++|++++++++||++++++|+++ ..+.+.++++.+|++|+++|+|+|+++++++++..+.....
T Consensus         2 ~~~~~if~e~W~~~~~~y~~~~~~gvDW~a~~~~y~~~-~~~~~~~e~~~~i~~ml~~L~D~Ht~~~~~~~~~~~~~g~~   80 (294)
T d1fc6a4           2 TSEQLLFLEAWRAVDRAYVDKSFNGQSWFKLRETYLKK-EPMDRRAQTYDAIRKMLAVLDDPFTRFLEPSRLAALRRGTK   80 (294)
T ss_dssp             CHHHHHHHHHHHHHHHHCSCTTGGGCCHHHHHHHHHHH-SCCSSHHHHHHHHHHHHHTTCCTTCEEECHHHHHHHHHCSC
T ss_pred             CcHHHHHHHHHHHhhccccCCCCCccCHHHHHHHHhcc-ccCCCHHHHHHHHHHHHHHhCCCceEEeChHHhhhhccCce
Confidence            56789999999999999999999999999999999997 56778899999999999999999999999999887654221


Q ss_pred             CceeeeeEEEEEEcCCCcEEEEeecCCChhhhcCCCCCCEEEEECCEecCCCCHHHHHHHHcCCCCCeEEEEEEeCCCCC
Q 047092          190 GNLQGVGLFISVEPRTGHLVVLSCVEDSPAARAGIHEGDELIEINGERLDGIDSEAAALKLRGRAGTPVTVKVHSGKDVG  269 (510)
Q Consensus       190 g~~~glGi~l~~~~~~g~l~V~~v~~gsPA~~AGL~~GD~IlaING~~v~~~~~~~~~~ll~g~~G~~V~l~v~r~~~~~  269 (510)
                      ....                                                               .+.......    
T Consensus        81 ~~~~---------------------------------------------------------------~~~~~~~~~----   93 (294)
T d1fc6a4          81 VTIN---------------------------------------------------------------PVTFTTCSN----   93 (294)
T ss_dssp             CCCC---------------------------------------------------------------CEEEEEECS----
T ss_pred             EEec---------------------------------------------------------------ccCCCcccc----
Confidence            1000                                                               000000000    


Q ss_pred             CCCceEEEEEecceeeeCCCcceeeeccCCCCCcCceEEEEecccchhHHHHHHHHHHHHHHcCCCEEEEEcCCCC---h
Q 047092          270 RESGTREVNIPRGYIKLSPISRTIIPHRTPDGHLTKTGYVKLSAFSQTAAADMANTIHELESEGAHSYILDLRNNP---V  346 (510)
Q Consensus       270 ~~g~~~~vtl~r~~~~~~~v~~~~i~~~~~~~~~~~igYi~i~sF~~~~~~~l~~~l~~l~~~~~~~LIlDLR~N~---~  346 (510)
                                    +....+.        ....+++||||+|++|+..+.+++++++.+++++++++||||||+|+   +
T Consensus        94 --------------~~~~~~~--------~~~~~~~IGYi~i~~F~~~~~~~~~~~l~~l~~~~~~~lIiDLR~N~GG~~  151 (294)
T d1fc6a4          94 --------------VAAAALP--------PGAAKQQLGYVRLATFNSNTTAAAQQAFTELSKQGVAGLVLDIRNNGGGLF  151 (294)
T ss_dssp             --------------CCGGGSC--------TTCSSSCEEEEEECCBSTTHHHHHHHHHHHHHHTTCSEEEEECTTCCCBCH
T ss_pred             --------------ccccccc--------CCCCCCcEEEEEEcccCchhHHHHHHHHHHHHHCCCcEEEEEeecCcccch
Confidence                          0000000        11124689999999999999999999999999999999999999999   6


Q ss_pred             hhHHHHHHhhcCCCceEEEEecCCCceeEEEcCCCCccCCCcEEEEEcCCCCcHHHHHHHHHhcCCCeEEEccCCCCCce
Q 047092          347 ILRLDVAQIWLDGDETLVNAVDREGHTLPINMVDGHAITHDPLVVLVNEGSASASEILAGALHDNGRAILVGHKTFGKGK  426 (510)
Q Consensus       347 ~~~~~la~~fl~~~~~~~~~~~r~g~~~~~~~~~~~~~~~gpvvVLvn~~TaSaaE~~a~~Lk~~~~a~vVG~~T~G~g~  426 (510)
                      ..+..++++|++++ ...++..+++....+....+...+.+|++||||+.|+||||+|+++||+++++++||++|+|++.
T Consensus       152 ~~a~~~~~~f~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~pv~VL~~~~TaSaaE~~a~~lk~~~~a~vvG~~T~G~g~  230 (294)
T d1fc6a4         152 PAGVNVARMLVDRG-DLVLIADSQGIRDIYSADGNSIDSATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGL  230 (294)
T ss_dssp             HHHHHHHHHHCSSS-EEEEEEETTEEEEEEECCSCCSCSSSCEEEEECTTCCTHHHHHHHHHHHTTSEEEEESCCCCCCE
T ss_pred             hhhHHHHHhhcccc-cceEEEEeccccceeccccccccccceEEEEecCCccchHHHHHHHhhhcCeEEEEeeeccCcce
Confidence            78899999999987 45555666665555555666778999999999999999999999999999999999999999999


Q ss_pred             eeeEEEcCCCcEEEEEEEEEEcCCCCcccCCCccccEEecCCCC
Q 047092          427 IQSVTELHDGSALFVTVAKYLSPALHDIDQVGITPDVQCTTDML  470 (510)
Q Consensus       427 ~~~~~~L~dg~~l~vt~~~~~~p~G~~~e~~GV~PDi~V~~~~~  470 (510)
                      .+..+.|+||+.+.+|+.+|++|+|+.+++.||+|||+|+++..
T Consensus       231 ~~~~~~L~dG~~l~~t~~~~~~p~G~~~e~~Gv~PDi~v~~~~~  274 (294)
T d1fc6a4         231 IQTVVDLSDGSGVAVTVARYQTPAGVDINKIGVSPDVQLDPEVL  274 (294)
T ss_dssp             EEEEEECTTSCEEEEEEEEEECTTSCBCTTTCCCCSEECCTTSS
T ss_pred             eeEEEEeCCCCEEEEEeEEEECCCCCEeeCcccCCCeEECCccC
Confidence            99999999999999999999999999999999999999986653
>d1k32a4 c.14.1.2 (A:680-762,A:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1j7xa_ c.14.1.2 (A:) Interphotoreceptor retinoid-binding protein IRBP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure