Citrus Sinensis ID: 047113


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MDDAERIFGGIIDKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILFACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDLLATGETEPYVWGALLGACRIHHNVKIGELVAKDPFHLDPKNDAYYTSL
ccHHHHHHcccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHcHHcccccccccccc
cHHHHHHHHHcccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEc
mddaerifggiidknvVIWSGMIASHAIHGQEREALEAFYLVIHcsdgkpnnvTFLSILFACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDllatgetepyVWGALLGACRihhnvkigelvakdpfhldpkndayytsl
mddaerifggiidknvvIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILFACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDLLATGETEPYVWGALLGACRIHHNVKIGElvakdpfhldpkndayytsl
MDDAERIFGGIIDKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILFACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDLLATGETEPYVWGALLGACRIHHNVKIGELVAKDPFHLDPKNDAYYTSL
*****RIFGGIIDKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILFACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDLLATGETEPYVWGALLGACRIHHNVKIGELVAKDPFHL***********
MDDAERIFGGIIDKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILFACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDLLATGETEPYVWGALLGACRIHHNVKIGELVAKDPFHLDPKNDAYYTSL
MDDAERIFGGIIDKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILFACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDLLATGETEPYVWGALLGACRIHHNVKIGELVAKDPFHLDPKNDAYYTSL
MDDAERIFGGIIDKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILFACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDLLATGETEPYVWGALLGACRIHHNVKIGELVAKDPFHLDPKNDAYYTSL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDAERIFGGIIDKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILFACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDLLATGETEPYVWGALLGACRIHHNVKIGELVAKDPFHLDPKNDAYYTSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query145 2.2.26 [Sep-21-2011]
Q9SS97660 Putative pentatricopeptid yes no 0.979 0.215 0.433 8e-32
Q9STF3 657 Pentatricopeptide repeat- no no 0.993 0.219 0.362 6e-26
Q9FFG8 657 Pentatricopeptide repeat- no no 0.937 0.207 0.410 7e-26
Q9SUH6 792 Pentatricopeptide repeat- no no 0.979 0.179 0.373 2e-25
Q9SN39 871 Pentatricopeptide repeat- no no 0.951 0.158 0.383 3e-25
Q9FJY7 620 Pentatricopeptide repeat- no no 0.910 0.212 0.392 8e-25
Q5G1T1 850 Pentatricopeptide repeat- no no 0.993 0.169 0.375 4e-24
P0C8Q2654 Pentatricopeptide repeat- no no 0.979 0.217 0.386 8e-24
Q9LTV8 694 Pentatricopeptide repeat- no no 0.986 0.206 0.35 1e-23
Q9FLZ9677 Pentatricopeptide repeat- no no 0.993 0.212 0.365 2e-23
>sp|Q9SS97|PP205_ARATH Putative pentatricopeptide repeat-containing protein At3g01580 OS=Arabidopsis thaliana GN=PCMP-E87 PE=3 SV=2 Back     alignment and function desciption
 Score =  135 bits (340), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 99/157 (63%), Gaps = 15/157 (9%)

Query: 1   MDDAERIFGGIIDKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILF 60
           + +A ++F GI  K+ V+W+ +I  + IHG+  +ALE F  ++  S+ KPN VTFLSIL 
Sbjct: 417 LGNASKVFNGIALKDTVVWTSLITGYGIHGKGTKALETFNHMVKSSEVKPNEVTFLSILS 476

Query: 61  ACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDLLA-TGETE--------------P 105
           ACS++GLI EG+++F +MV+D++L  NLEHY + VDLL   G+ +              P
Sbjct: 477 ACSHAGLIHEGLRIFKLMVNDYRLAPNLEHYAVLVDLLGRVGDLDTAIEITKRMPFSPTP 536

Query: 106 YVWGALLGACRIHHNVKIGELVAKDPFHLDPKNDAYY 142
            + G LLGACRIH N ++ E VAK  F L+  +  YY
Sbjct: 537 QILGTLLGACRIHQNGEMAETVAKKLFELESNHAGYY 573





Arabidopsis thaliana (taxid: 3702)
>sp|Q9STF3|PP265_ARATH Pentatricopeptide repeat-containing protein At3g46790, chloroplastic OS=Arabidopsis thaliana GN=CRR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FFG8|PP417_ARATH Pentatricopeptide repeat-containing protein At5g44230 OS=Arabidopsis thaliana GN=PCMP-H17 PE=2 SV=1 Back     alignment and function description
>sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protein At4g30700 OS=Arabidopsis thaliana GN=DYW9 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function description
>sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protein At3g49170, chloroplastic OS=Arabidopsis thaliana GN=EMB2261 PE=2 SV=1 Back     alignment and function description
>sp|P0C8Q2|PP323_ARATH Pentatricopeptide repeat-containing protein At4g19191, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLZ9|PP405_ARATH Pentatricopeptide repeat-containing protein At5g39350 OS=Arabidopsis thaliana GN=PCMP-E16 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
356514095 700 PREDICTED: putative pentatricopeptide re 1.0 0.207 0.537 2e-39
359488803 1291 PREDICTED: putative pentatricopeptide re 1.0 0.112 0.525 1e-38
357468777 838 hypothetical protein MTR_4g015760 [Medic 1.0 0.173 0.518 2e-38
356514087 701 PREDICTED: putative pentatricopeptide re 1.0 0.206 0.518 3e-37
297828580 638 predicted protein [Arabidopsis lyrata su 0.979 0.222 0.433 4e-30
6016735 641 hypothetical protein [Arabidopsis thalia 0.979 0.221 0.433 5e-30
334185017 660 pentatricopeptide repeat-containing prot 0.979 0.215 0.433 5e-30
296082284 581 unnamed protein product [Vitis vinifera] 0.972 0.242 0.445 3e-29
359488559 735 PREDICTED: pentatricopeptide repeat-cont 0.972 0.191 0.445 4e-29
449492963 1725 PREDICTED: uncharacterized protein LOC10 0.972 0.081 0.414 4e-28
>gi|356514095|ref|XP_003525742.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580-like [Glycine max] Back     alignment and taxonomy information
 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/160 (53%), Positives = 112/160 (70%), Gaps = 15/160 (9%)

Query: 1   MDDAERIFGGIIDKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILF 60
           +D+A ++F G+  K+VV WS +IA++  HGQ  EAL+ FY + + SD KPN+VTF+SIL 
Sbjct: 460 IDNANKVFKGMRRKDVVTWSSIIAAYGFHGQGEEALKLFYQMSNHSDVKPNDVTFVSILS 519

Query: 61  ACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDLLAT-GETE--------------P 105
           ACS++GLIEEGIK+F +MV+++QL  N EHYGI VDLL   GE +              P
Sbjct: 520 ACSHAGLIEEGIKMFHVMVNEYQLMPNTEHYGIMVDLLGRMGELDKALDMINEMPMQAGP 579

Query: 106 YVWGALLGACRIHHNVKIGELVAKDPFHLDPKNDAYYTSL 145
           +VWGALLGACRIH N+KIGEL A + F LDP +  YYT L
Sbjct: 580 HVWGALLGACRIHQNIKIGELAALNLFLLDPNHAGYYTLL 619




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359488803|ref|XP_002272525.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357468777|ref|XP_003604673.1| hypothetical protein MTR_4g015760 [Medicago truncatula] gi|355505728|gb|AES86870.1| hypothetical protein MTR_4g015760 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356514087|ref|XP_003525738.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580-like [Glycine max] Back     alignment and taxonomy information
>gi|297828580|ref|XP_002882172.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297328012|gb|EFH58431.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|6016735|gb|AAF01561.1|AC009325_31 hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334185017|ref|NP_186807.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546765|sp|Q9SS97.2|PP205_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g01580 gi|332640170|gb|AEE73691.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|296082284|emb|CBI21289.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488559|ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449492963|ref|XP_004159154.1| PREDICTED: uncharacterized protein LOC101226880 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
TAIR|locus:2167593 657 AT5G44230 [Arabidopsis thalian 0.937 0.207 0.417 1.3e-23
TAIR|locus:2124137 871 DOT4 "DEFECTIVELY ORGANIZED TR 0.951 0.158 0.396 1.8e-23
TAIR|locus:2102852 657 CRR2 "AT3G46790" [Arabidopsis 0.993 0.219 0.368 5.8e-23
TAIR|locus:2131939 792 MEF29 "AT4G30700" [Arabidopsis 0.979 0.179 0.373 1.4e-22
TAIR|locus:4515103421654 AT4G19191 "AT4G19191" [Arabido 0.979 0.217 0.398 8.9e-22
TAIR|locus:2154855 620 AT5G66520 "AT5G66520" [Arabido 0.972 0.227 0.375 1e-21
TAIR|locus:2175653677 AT5G39350 "AT5G39350" [Arabido 0.993 0.212 0.378 1.2e-21
TAIR|locus:2170548 608 AT5G40410 [Arabidopsis thalian 0.993 0.236 0.368 2.6e-21
TAIR|locus:2082886 850 EMB2261 "embryo defective 2261 0.986 0.168 0.378 3.1e-21
TAIR|locus:2102514 581 AT3G56550 [Arabidopsis thalian 0.972 0.242 0.343 6.3e-21
TAIR|locus:2167593 AT5G44230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 280 (103.6 bits), Expect = 1.3e-23, P = 1.3e-23
 Identities = 63/151 (41%), Positives = 91/151 (60%)

Query:     1 MDDAERIFGGIIDKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILF 60
             +++A  +F  + +KNV  +S MI   A HG+ +EAL  F+ ++  ++ KPN VTF+  L 
Sbjct:   334 VEEAVNVFMSMNNKNVFTYSSMILGLATHGRAQEALHLFHYMVTQTEIKPNTVTFVGALM 393

Query:    61 ACSYSGLIEEGIKVFDIMVHDFQLDLNLEHYGITVDLLA-TGE------------TEPY- 106
             ACS+SGL+++G +VFD M   F +    +HY   VDLL  TG              EP+ 
Sbjct:   394 ACSHSGLVDQGRQVFDSMYQTFGVQPTRDHYTCMVDLLGRTGRLQEALELIKTMSVEPHG 453

Query:   107 -VWGALLGACRIHHNVKIGELVAKDPFHLDP 136
              VWGALLGACRIH+N +I E+ A+  F L+P
Sbjct:   454 GVWGALLGACRIHNNPEIAEIAAEHLFELEP 484




GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2124137 DOT4 "DEFECTIVELY ORGANIZED TRIBUTARIES 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102852 CRR2 "AT3G46790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131939 MEF29 "AT4G30700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515103421 AT4G19191 "AT4G19191" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154855 AT5G66520 "AT5G66520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175653 AT5G39350 "AT5G39350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170548 AT5G40410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082886 EMB2261 "embryo defective 2261" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102514 AT3G56550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 6e-32
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-26
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-08
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-07
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-07
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 0.002
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  118 bits (298), Expect = 6e-32
 Identities = 57/148 (38%), Positives = 84/148 (56%), Gaps = 16/148 (10%)

Query: 13  DKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILFACSYSGLIEEGI 72
           +K+VV W+ ++  +  HG+   A+E F  ++  S   P+ VTF+S+L ACS SG++ +G+
Sbjct: 551 EKDVVSWNILLTGYVAHGKGSMAVELFNRMVE-SGVNPDEVTFISLLCACSRSGMVTQGL 609

Query: 73  KVFDIMVHDFQLDLNLEHYGITVDLLA-TGETE--------------PYVWGALLGACRI 117
           + F  M   + +  NL+HY   VDLL   G+                P VWGALL ACRI
Sbjct: 610 EYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRI 669

Query: 118 HHNVKIGELVAKDPFHLDPKNDAYYTSL 145
           H +V++GEL A+  F LDP +  YY  L
Sbjct: 670 HRHVELGELAAQHIFELDPNSVGYYILL 697


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 145
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.97
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.96
PLN03077 857 Protein ECB2; Provisional 99.96
PLN03077 857 Protein ECB2; Provisional 99.95
PLN03218 1060 maturation of RBCL 1; Provisional 99.95
PLN03218 1060 maturation of RBCL 1; Provisional 99.94
PF1304150 PPR_2: PPR repeat family 99.75
PF1304150 PPR_2: PPR repeat family 99.66
PF1285434 PPR_1: PPR repeat 99.18
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.18
PF1285434 PPR_1: PPR repeat 99.16
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 99.06
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.01
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.98
PRK11788389 tetratricopeptide repeat protein; Provisional 98.95
KOG4422 625 consensus Uncharacterized conserved protein [Funct 98.93
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.86
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.79
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.74
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.67
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.67
PRK15359144 type III secretion system chaperone protein SscB; 98.63
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.62
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.56
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.44
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.42
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.4
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.38
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.36
KOG1126638 consensus DNA-binding cell division cycle control 98.34
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.3
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.3
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.27
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.27
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.25
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.24
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.23
PRK10370198 formate-dependent nitrite reductase complex subuni 98.21
PRK11189296 lipoprotein NlpI; Provisional 98.19
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.18
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.18
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.17
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.15
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 98.15
PRK12370553 invasion protein regulator; Provisional 98.14
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.08
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.06
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.05
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.04
PRK11189296 lipoprotein NlpI; Provisional 97.95
KOG1126638 consensus DNA-binding cell division cycle control 97.91
KOG0553 304 consensus TPR repeat-containing protein [General f 97.89
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.88
PRK12370 553 invasion protein regulator; Provisional 97.87
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.81
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 97.77
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.77
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.74
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.73
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.68
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.67
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.65
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.61
PRK14574 822 hmsH outer membrane protein; Provisional 97.61
PRK15359144 type III secretion system chaperone protein SscB; 97.58
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.56
KOG3941 406 consensus Intermediate in Toll signal transduction 97.52
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.52
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.44
KOG1129478 consensus TPR repeat-containing protein [General f 97.44
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.42
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.4
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.4
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.39
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.37
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.36
PRK14574 822 hmsH outer membrane protein; Provisional 97.34
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.34
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.34
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.32
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.31
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.3
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.3
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.29
KOG2003 840 consensus TPR repeat-containing protein [General f 97.23
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.22
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.21
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.17
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.15
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.14
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.12
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.11
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.06
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.04
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.03
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.99
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.97
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 96.96
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.96
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.94
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.9
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 96.88
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.82
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 96.8
PLN02789 320 farnesyltranstransferase 96.78
PRK10803263 tol-pal system protein YbgF; Provisional 96.71
PRK10370198 formate-dependent nitrite reductase complex subuni 96.68
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.66
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.66
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.63
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 96.63
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.61
PF1342844 TPR_14: Tetratricopeptide repeat 96.52
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 96.44
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.42
KOG0547606 consensus Translocase of outer mitochondrial membr 96.42
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.4
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.35
KOG2076 895 consensus RNA polymerase III transcription factor 96.3
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.3
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.25
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.23
KOG1129478 consensus TPR repeat-containing protein [General f 96.22
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.19
PF1337173 TPR_9: Tetratricopeptide repeat 96.18
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.16
PF1337173 TPR_9: Tetratricopeptide repeat 96.13
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.12
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 96.09
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 95.96
KOG1128 777 consensus Uncharacterized conserved protein, conta 95.91
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 95.88
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 95.81
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 95.8
KOG3616 1636 consensus Selective LIM binding factor [Transcript 95.77
KOG1125579 consensus TPR repeat-containing protein [General f 95.7
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 95.68
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 95.66
KOG2076 895 consensus RNA polymerase III transcription factor 95.63
KOG4570 418 consensus Uncharacterized conserved protein [Funct 95.62
KOG2003 840 consensus TPR repeat-containing protein [General f 95.61
KOG0547 606 consensus Translocase of outer mitochondrial membr 95.61
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 95.5
KOG3060289 consensus Uncharacterized conserved protein [Funct 95.49
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.48
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.39
PRK14720 906 transcript cleavage factor/unknown domain fusion p 95.39
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.34
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.34
KOG1915 677 consensus Cell cycle control protein (crooked neck 95.32
KOG3941 406 consensus Intermediate in Toll signal transduction 95.26
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.24
PF12688120 TPR_5: Tetratrico peptide repeat 95.23
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 95.2
KOG2047 835 consensus mRNA splicing factor [RNA processing and 95.14
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 95.04
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 94.98
PRK14720 906 transcript cleavage factor/unknown domain fusion p 94.87
COG3629280 DnrI DNA-binding transcriptional activator of the 94.68
COG3898 531 Uncharacterized membrane-bound protein [Function u 94.62
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 94.52
PRK02603172 photosystem I assembly protein Ycf3; Provisional 94.5
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 94.46
PLN02789320 farnesyltranstransferase 94.4
KOG0495913 consensus HAT repeat protein [RNA processing and m 94.39
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 94.36
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.18
KOG3785557 consensus Uncharacterized conserved protein [Funct 94.09
KOG1128 777 consensus Uncharacterized conserved protein, conta 93.99
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 93.95
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.92
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.77
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 93.62
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 93.58
KOG2047 835 consensus mRNA splicing factor [RNA processing and 93.58
KOG1125579 consensus TPR repeat-containing protein [General f 93.57
CHL00033168 ycf3 photosystem I assembly protein Ycf3 93.52
PRK15331165 chaperone protein SicA; Provisional 93.5
KOG0553304 consensus TPR repeat-containing protein [General f 93.41
KOG2796366 consensus Uncharacterized conserved protein [Funct 93.38
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 93.09
PF1342844 TPR_14: Tetratricopeptide repeat 93.05
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.95
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.87
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 92.81
PF13512142 TPR_18: Tetratricopeptide repeat 92.77
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.74
KOG4340 459 consensus Uncharacterized conserved protein [Funct 92.73
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 92.72
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 92.63
PRK10803263 tol-pal system protein YbgF; Provisional 92.44
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.43
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 92.15
PF1343134 TPR_17: Tetratricopeptide repeat 91.96
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 91.96
KOG4162799 consensus Predicted calmodulin-binding protein [Si 91.87
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 91.69
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.5
smart00299140 CLH Clathrin heavy chain repeat homology. 91.48
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 91.23
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.07
KOG0495 913 consensus HAT repeat protein [RNA processing and m 91.03
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.92
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 90.81
COG1729262 Uncharacterized protein conserved in bacteria [Fun 90.69
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 90.08
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 90.04
PF13762145 MNE1: Mitochondrial splicing apparatus component 89.74
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 89.65
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.63
KOG3616 1636 consensus Selective LIM binding factor [Transcript 89.55
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 89.38
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 89.07
PF13512142 TPR_18: Tetratricopeptide repeat 88.95
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 88.59
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.15
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 87.87
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 87.75
PRK10564303 maltose regulon periplasmic protein; Provisional 87.71
COG3898 531 Uncharacterized membrane-bound protein [Function u 87.53
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 87.51
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 87.46
PF13929292 mRNA_stabil: mRNA stabilisation 87.45
COG3629280 DnrI DNA-binding transcriptional activator of the 87.41
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 87.33
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 87.24
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 86.85
COG4700251 Uncharacterized protein conserved in bacteria cont 86.83
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.63
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 86.39
PF13170 297 DUF4003: Protein of unknown function (DUF4003) 86.35
PRK15331165 chaperone protein SicA; Provisional 86.34
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 86.28
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 85.85
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 85.8
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 85.16
KOG3785557 consensus Uncharacterized conserved protein [Funct 84.3
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 84.26
KOG4648 536 consensus Uncharacterized conserved protein, conta 84.17
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 83.77
COG4105254 ComL DNA uptake lipoprotein [General function pred 83.42
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 83.4
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 83.26
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 83.19
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 83.09
KOG2376 652 consensus Signal recognition particle, subunit Srp 82.83
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.76
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 82.76
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 82.65
PF13762145 MNE1: Mitochondrial splicing apparatus component 82.28
KOG2376 652 consensus Signal recognition particle, subunit Srp 80.93
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 80.55
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=99.97  E-value=4.3e-30  Score=204.62  Aligned_cols=144  Identities=36%  Similarity=0.683  Sum_probs=137.6

Q ss_pred             CchHHHHhccCCCCchhhHHHHHHHHHHcCChHHHHHHHHHhHhhcCCCCcHHHHHHHHHHhhccchHHHHHHHHHHhhh
Q 047113            1 MDDAERIFGGIIDKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKPNNVTFLSILFACSYSGLIEEGIKVFDIMVH   80 (145)
Q Consensus         1 ~~~A~~~f~~m~~~~~~~~~~li~a~~~~g~~~~A~~~~~~m~~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~   80 (145)
                      +++|.++|++|.+||+++||+||.+|+++|+.++|.++|++|.+ .|++||..||+++|.+|++.|.+++|.++|+.|..
T Consensus       376 ~~~A~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~~-~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~  454 (697)
T PLN03081        376 MEDARNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIA-EGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSE  454 (697)
T ss_pred             HHHHHHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHHHH-hCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHH
Confidence            47899999999999999999999999999999999999999999 99999999999999999999999999999999986


Q ss_pred             hcCcCccHHHHHHHHHHHhcC---------------CCchhhHHHHHHHHHhccChhHHHHHHccCCCCCCCCCCCcccC
Q 047113           81 DFQLDLNLEHYGITVDLLATG---------------ETEPYVWGALLGACRIHHNVKIGELVAKDPFHLDPKNDAYYTSL  145 (145)
Q Consensus        81 ~~~~~~~~~~~~~li~~~~~~---------------~p~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~l  145 (145)
                      +.|+.|+..+|+++|++|++.               .|+..+|++|+.+|+..|+++.|..+++++.+++|++...|++|
T Consensus       455 ~~g~~p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~~~~~Ll~a~~~~g~~~~a~~~~~~l~~~~p~~~~~y~~L  534 (697)
T PLN03081        455 NHRIKPRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTACRIHKNLELGRLAAEKLYGMGPEKLNNYVVL  534 (697)
T ss_pred             hcCCCCCccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCcHHHHHHHHHHhCCCCCCCcchHHH
Confidence            789999999999999999998               78999999999999999999999999999999999888777653



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.94
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.87
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.83
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.56
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 99.54
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.22
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.03
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.03
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.0
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.98
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.98
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.97
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.97
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.96
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.96
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.94
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.94
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.92
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.9
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.89
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.87
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 98.86
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.81
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 98.8
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.78
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.76
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.74
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.74
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.74
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.71
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.71
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.71
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.7
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.69
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.68
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.68
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.66
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.66
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.65
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.65
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.65
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.63
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.63
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.62
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.62
2gw1_A514 Mitochondrial precursor proteins import receptor; 98.62
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.61
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.6
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.6
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.6
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.59
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.57
3u4t_A272 TPR repeat-containing protein; structural genomics 98.57
3u4t_A 272 TPR repeat-containing protein; structural genomics 98.56
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.54
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.53
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.52
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.52
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.51
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.51
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.51
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.5
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.49
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.48
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.47
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.44
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.44
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.43
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.42
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.42
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.41
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.4
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.37
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.35
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.31
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.31
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.28
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.27
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.26
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.26
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.26
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.23
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.2
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.19
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.18
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.18
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.17
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.17
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.16
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.16
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.15
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.15
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.1
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.1
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.1
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 98.09
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.08
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.08
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.05
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.03
3k9i_A117 BH0479 protein; putative protein binding protein, 98.02
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.01
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.0
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.99
3k9i_A117 BH0479 protein; putative protein binding protein, 97.99
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.98
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.93
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.89
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.87
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.86
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.85
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.84
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.83
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.81
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.79
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.78
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.76
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.76
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.75
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.75
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.74
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.73
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.73
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.69
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 97.69
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.68
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.68
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.68
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.67
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.67
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.66
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.66
4g1t_A472 Interferon-induced protein with tetratricopeptide 97.65
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.65
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.64
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.63
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.63
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.62
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.61
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.61
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.61
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.61
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.6
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.59
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.57
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.56
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.49
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.45
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.45
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.43
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.38
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.36
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.35
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.33
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.33
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 97.33
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.3
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.29
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 97.25
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.23
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.22
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.22
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.21
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.21
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.21
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.18
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.13
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.1
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.07
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.05
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.02
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.97
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.96
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.95
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 96.89
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 96.87
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.81
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.8
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.8
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 96.8
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 96.71
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.54
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.54
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 96.51
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.51
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 96.5
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 96.47
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 96.37
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.34
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.23
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.18
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.17
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.12
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.01
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 95.75
1klx_A138 Cysteine rich protein B; structural genomics, heli 95.65
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.55
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 95.39
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.34
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.26
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 95.22
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 95.12
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.1
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 95.07
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 95.02
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.82
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 94.59
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.25
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 93.97
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.93
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 93.85
1klx_A138 Cysteine rich protein B; structural genomics, heli 93.74
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.29
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.21
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.08
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 92.48
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 92.45
1pc2_A152 Mitochondria fission protein; unknown function; NM 87.34
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 87.17
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 86.01
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 84.75
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 83.86
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 82.87
3ygs_P97 Procaspase 9; apoptosis, caspase activation, caspa 82.11
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 82.04
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 81.45
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 81.13
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 80.15
2nsz_A129 Programmed cell death protein 4; PDCD4, tumor supp 80.13
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=99.97  E-value=1.1e-30  Score=200.25  Aligned_cols=136  Identities=14%  Similarity=0.066  Sum_probs=127.2

Q ss_pred             CchHHHHhccCCC----CchhhHHHHHHHHHHcCC---------hHHHHHHHHHhHhhcCCCCcHHHHHHHHHHhhccch
Q 047113            1 MDDAERIFGGIID----KNVVIWSGMIASHAIHGQ---------EREALEAFYLVIHCSDGKPNNVTFLSILFACSYSGL   67 (145)
Q Consensus         1 ~~~A~~~f~~m~~----~~~~~~~~li~a~~~~g~---------~~~A~~~~~~m~~~~~~~p~~~~~~~ll~~~~~~~~   67 (145)
                      +++|.++|++|+.    ||.+|||+||.+|++.+.         .++|.++|++|.. .|+.||..|||++|++|++.|+
T Consensus        42 ~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~-~G~~Pd~~tyn~lI~~~~~~g~  120 (501)
T 4g26_A           42 VLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQMIV-DKVVPNEATFTNGARLAVAKDD  120 (501)
T ss_dssp             HHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHH-TTCCCCHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHHHHHHHH-hCCCCCHHHHHHHHHHHHhcCC
Confidence            3689999999974    899999999999998765         6889999999999 9999999999999999999999


Q ss_pred             HHHHHHHHHHhhhhcCcCccHHHHHHHHHHHhcC------------------CCchhhHHHHHHHHHhccChhHHHHHHc
Q 047113           68 IEEGIKVFDIMVHDFQLDLNLEHYGITVDLLATG------------------ETEPYVWGALLGACRIHHNVKIGELVAK  129 (145)
Q Consensus        68 ~~~a~~~~~~m~~~~~~~~~~~~~~~li~~~~~~------------------~p~~~~~~~li~~~~~~g~~~~a~~~~~  129 (145)
                      ++.|.++|++|. +.|+.||..||++||.+|++.                  .||..+|++||++|++.|++++|.++++
T Consensus       121 ~~~A~~l~~~M~-~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~  199 (501)
T 4g26_A          121 PEMAFDMVKQMK-AFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNADKVYKTLQ  199 (501)
T ss_dssp             HHHHHHHHHHHH-HTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHH-HcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhCCCHHHHHHHHH
Confidence            999999999999 899999999999999999998                  9999999999999999999999999999


Q ss_pred             cCCC--CCCCC
Q 047113          130 DPFH--LDPKN  138 (145)
Q Consensus       130 ~~~~--~~~~~  138 (145)
                      +|.+  ..|+.
T Consensus       200 ~Mr~~g~~ps~  210 (501)
T 4g26_A          200 RLRDLVRQVSK  210 (501)
T ss_dssp             HHHHHTSSBCH
T ss_pred             HHHHhCCCcCH
Confidence            9988  55643



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3ygs_P Procaspase 9; apoptosis, caspase activation, caspase recruitment, recognition complex; 2.50A {Homo sapiens} SCOP: a.77.1.3 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.94
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.77
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.67
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.63
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.58
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.57
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.56
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.44
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.41
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.4
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.3
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.23
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.21
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.2
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 98.17
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.12
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.08
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.05
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.89
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.85
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.84
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.84
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.79
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.76
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.72
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.7
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.64
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.61
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.49
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.27
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.2
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.18
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.03
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.02
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.79
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.79
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.78
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.51
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 96.42
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.41
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.31
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.13
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.05
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 96.0
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 95.58
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 95.42
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.4
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.37
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 92.96
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 92.35
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 89.48
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 87.8
d2nsza1129 Programmed cell death 4, PDCD4 {Mouse (Mus musculu 85.28
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 85.23
d1ug3a1193 Eukaryotic initiation factor eIF4G {Human (Homo sa 85.06
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.94  E-value=5.4e-09  Score=73.38  Aligned_cols=136  Identities=10%  Similarity=0.108  Sum_probs=92.0

Q ss_pred             chHHHHhccCC---CCchhhHHHHHHHHHHcCChHHHHHHHHHhHhhcCCCC-cHHHHHHHHHHhhccchHHHHHHHHHH
Q 047113            2 DDAERIFGGII---DKNVVIWSGMIASHAIHGQEREALEAFYLVIHCSDGKP-NNVTFLSILFACSYSGLIEEGIKVFDI   77 (145)
Q Consensus         2 ~~A~~~f~~m~---~~~~~~~~~li~a~~~~g~~~~A~~~~~~m~~~~~~~p-~~~~~~~ll~~~~~~~~~~~a~~~~~~   77 (145)
                      ++|.+.|+...   ..+...|..+...+.+.|++++|...|++..+   +.| +...+..+...+...|++++|...++.
T Consensus       220 ~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~---~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~  296 (388)
T d1w3ba_         220 DRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE---LQPHFPDAYCNLANALKEKGSVAEAEDCYNT  296 (388)
T ss_dssp             THHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH---TCSSCHHHHHHHHHHHHHHSCHHHHHHHHHH
T ss_pred             HHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH---hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHh
Confidence            45555555442   23455677777777777777777777777654   234 456777777777777777777777777


Q ss_pred             hhhhcCcCccHHHHHHHHHHHhcC----------------CC-chhhHHHHHHHHHhccChhHHHHHHccCCCCCCCCCC
Q 047113           78 MVHDFQLDLNLEHYGITVDLLATG----------------ET-EPYVWGALLGACRIHHNVKIGELVAKDPFHLDPKNDA  140 (145)
Q Consensus        78 m~~~~~~~~~~~~~~~li~~~~~~----------------~p-~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~  140 (145)
                      .. . ..+.+...+..+...|.+.                .| +..+|..+-..|...|++++|...+++..+++|+++.
T Consensus       297 ~~-~-~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~  374 (388)
T d1w3ba_         297 AL-R-LCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFAD  374 (388)
T ss_dssp             HH-H-HCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHH
T ss_pred             hh-c-cCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHH
Confidence            66 2 2234556666666666655                33 4567777888888888888888888888888887665


Q ss_pred             Cc
Q 047113          141 YY  142 (145)
Q Consensus       141 ~~  142 (145)
                      .|
T Consensus       375 a~  376 (388)
T d1w3ba_         375 AY  376 (388)
T ss_dssp             HH
T ss_pred             HH
Confidence            44



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ug3a1 a.118.1.14 (A:1235-1427) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure