Citrus Sinensis ID: 047120


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630----
MFVSANYNQPCNSTQSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTPLTEFARYIFFKYHAFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKMGIRDSVSYNSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQFAWQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWANMIDGYAKLGRVDIARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVLSAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWNAMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHYGCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGEPVAKHLIGMDSSNSSSYVLLSNMFAGLGMWNDARRVRSMMKERNLKKLPGCSWIELEGVVHEFFVRDKSRLQVRDIYYMLDNMWTPDSVATSCTHYG
ccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHccccccccEEEHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHcHHccccccccccHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHccccccHHHHHHHHHHHHccccccccccEEEEccEEEEEEEcccccccHHHHHHHHHHccccccccccccccc
cHHHHHHccccccccHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEcHHHHHHEccccccHHHHHHHHHHHHcccccEEEEEEEccc
mfvsanynqpcnstQSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVAsfssspctplteFARYIFFKYHafrekkdpfLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKACSRLGLIEEGLQIHGLLrkvafgsdlFLQNCLISLYVRCGYLEFARQLFDkmgirdsvsyNSMIDGYVKSGNIESARELFdsmpirernliSWNSVLNGYAQLKSGLQFAWQIFEKMPERDLISWNSMLhgcvkcgkmDDAQAlfdkmpkrdvvSWANMIDGYAKLGRVDIARRLFDEMPKRDVVACNAMmggyvrngysmkALEIFDNMqcelylhpddASLVIVLSAIAQLGHIDKGVAIHRYlekdqfslngkHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWNAMINGLAIHGLGELAFDLLMEMErlsiepdditfTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHYGCMVDILGRAGHIEAARNLiedmpmepnDVIWRTLLSACRnyenlnvgepvakhligmdssnssSYVLLSNMFAGLGMWNDARRVRSMMKernlkklpgcswieleGVVHEffvrdksrlqVRDIYYMLdnmwtpdsvatscthyg
mfvsanynqpcnstQSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTPLTEFARYIFFKYHAFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKMGIRDSVSYNSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQFAWQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWANMIDGYAKLGRVDIARRLfdempkrdVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVLSAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWNAMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHYGCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGEPVAKHLIGMDSSNSSSYVLLSNMFAGLGMWNDARRVRSMMKErnlkklpgcswIELEGVVHEffvrdksrlqVRDIYYMldnmwtpdsvatscthyg
MFVSANYNQPCNSTQSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTPLTEFARYIFFKYHAFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKMGIRDSVSYNSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQFAWQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWANMIDGYAKLGRVDIARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVLSAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWNAMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHYGCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGEPVAKHLIGMDssnsssyvllsnMFAGLGMWNDARRVRSMMKERNLKKLPGCSWIELEGVVHEFFVRDKSRLQVRDIYYMLDNMWTPDSVATSCTHYG
**************QSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTPLTEFARYIFFKYHAFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKMGIRDSVSYNSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQFAWQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWANMIDGYAKLGRVDIARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVLSAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWNAMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHYGCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGEPVAKHLIGMDSSNSSSYVLLSNMFAGLGMWNDARRVRSMMKERNLKKLPGCSWIELEGVVHEFFVRDKSRLQVRDIYYMLDNMWTPDSVAT******
M*************QSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTPLTEFARYIFFKYHAFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKMGIRDSVSYNSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQFAWQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWANMIDGYAKLGRVDIARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVLSAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWNAMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHYGCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGEPVAKHLIGMDSSNSSSYVLLSNMFAGLGMWNDARRVRSMMKERNLKKLPGCSWIELEGVVHEFFVRDKSRLQVRDIYYMLDNMWTPDSVATSCTHY*
********QPCNSTQSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTPLTEFARYIFFKYHAFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKMGIRDSVSYNSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQFAWQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWANMIDGYAKLGRVDIARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVLSAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWNAMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHYGCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGEPVAKHLIGMDSSNSSSYVLLSNMFAGLGMWNDARRVRSMMKERNLKKLPGCSWIELEGVVHEFFVRDKSRLQVRDIYYMLDNMWTPDSV********
MFVSANYNQPCNSTQSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTPLTEFARYIFFKYHAFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKMGIRDSVSYNSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQFAWQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWANMIDGYAKLGRVDIARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVLSAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWNAMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHYGCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGEPVAKHLIGMDSSNSSSYVLLSNMFAGLGMWNDARRVRSMMKERNLKKLPGCSWIELEGVVHEFFVRDKSRLQVRDIYYMLDNMWTPDSVATSCTHYG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVSANYNQPCNSTQSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTPLTEFARYIFFKYHAFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKMGIRDSVSYNSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQFAWQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWANMIDGYAKLGRVDIARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVLSAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWNAMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHYGCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGEPVAKHLIGMDSSNSSSYVLLSNMFAGLGMWNDARRVRSMMKERNLKKLPGCSWIELEGVVHEFFVRDKSRLQVRDIYYMLDNMWTPDSVATSCTHYG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query634 2.2.26 [Sep-21-2011]
O22137613 Pentatricopeptide repeat- yes no 0.930 0.962 0.654 0.0
Q9SJZ3681 Pentatricopeptide repeat- no no 0.938 0.873 0.386 1e-116
O82380738 Pentatricopeptide repeat- no no 0.952 0.818 0.358 1e-113
Q9LS72600 Pentatricopeptide repeat- no no 0.883 0.933 0.355 1e-106
Q9LSB8687 Putative pentatricopeptid no no 0.943 0.870 0.356 1e-104
Q9SIT7697 Pentatricopeptide repeat- no no 0.922 0.839 0.350 1e-102
Q9SY02781 Pentatricopeptide repeat- no no 0.832 0.676 0.377 1e-102
Q9LN01741 Pentatricopeptide repeat- no no 0.914 0.782 0.332 1e-102
P0C8Q5578 Pentatricopeptide repeat- no no 0.888 0.974 0.342 2e-99
Q9LFL5850 Pentatricopeptide repeat- no no 0.938 0.7 0.339 5e-96
>sp|O22137|PP202_ARATH Pentatricopeptide repeat-containing protein At2g45350, chloroplastic OS=Arabidopsis thaliana GN=CRR4 PE=3 SV=2 Back     alignment and function desciption
 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/594 (65%), Positives = 480/594 (80%), Gaps = 4/594 (0%)

Query: 13  STQSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTPLTEFARYIF 72
           S  ST+ +L  CKT +DVNQIH R+I TG IKN++LTT++V +F+SS    L +FAR +F
Sbjct: 11  SISSTIHVLGSCKTSDDVNQIHGRLIKTGIIKNSNLTTRIVLAFASSRRPYLADFARCVF 70

Query: 73  FKYH----AFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKA 128
            +YH    +F E +DPFLWNA+IK++SHG DP++AL++ CLML+NGVSVDKFS SLVLKA
Sbjct: 71  HEYHVCSFSFGEVEDPFLWNAVIKSHSHGKDPRQALLLLCLMLENGVSVDKFSLSLVLKA 130

Query: 129 CSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKMGIRDSVSY 188
           CSRLG ++ G+QIHG L+K    SDLFLQNCLI LY++CG L  +RQ+FD+M  RDSVSY
Sbjct: 131 CSRLGFVKGGMQIHGFLKKTGLWSDLFLQNCLIGLYLKCGCLGLSRQMFDRMPKRDSVSY 190

Query: 189 NSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQFAWQIFEKMPER 248
           NSMIDGYVK G I SARELFD MP+  +NLISWNS+++GYAQ   G+  A ++F  MPE+
Sbjct: 191 NSMIDGYVKCGLIVSARELFDLMPMEMKNLISWNSMISGYAQTSDGVDIASKLFADMPEK 250

Query: 249 DLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWANMIDGYAKLGRVDIARRLFDEMP 308
           DLISWNSM+ G VK G+++DA+ LFD MP+RDVV+WA MIDGYAKLG V  A+ LFD+MP
Sbjct: 251 DLISWNSMIDGYVKHGRIEDAKGLFDVMPRRDVVTWATMIDGYAKLGFVHHAKTLFDQMP 310

Query: 309 KRDVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVLSAIAQLGHIDKGV 368
            RDVVA N+MM GYV+N Y M+ALEIF +M+ E +L PDD +LVIVL AIAQLG + K +
Sbjct: 311 HRDVVAYNSMMAGYVQNKYHMEALEIFSDMEKESHLLPDDTTLVIVLPAIAQLGRLSKAI 370

Query: 369 AIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWNAMINGLAIHG 428
            +H Y+ + QF L GK GVALIDMYSKCGSI++A+ VFE IE+ S+DHWNAMI GLAIHG
Sbjct: 371 DMHLYIVEKQFYLGGKLGVALIDMYSKCGSIQHAMLVFEGIENKSIDHWNAMIGGLAIHG 430

Query: 429 LGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHY 488
           LGE AFD+L+++ERLS++PDDITF G+LNAC+H+GLVKEGLLCFELMRR HK+EP LQHY
Sbjct: 431 LGESAFDMLLQIERLSLKPDDITFVGVLNACSHSGLVKEGLLCFELMRRKHKIEPRLQHY 490

Query: 489 GCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGEPVAKHLIGMDS 548
           GCMVDIL R+G IE A+NLIE+MP+EPNDVIWRT L+AC +++    GE VAKHLI    
Sbjct: 491 GCMVDILSRSGSIELAKNLIEEMPVEPNDVIWRTFLTACSHHKEFETGELVAKHLILQAG 550

Query: 549 SNSSSYVLLSNMFAGLGMWNDARRVRSMMKERNLKKLPGCSWIELEGVVHEFFV 602
            N SSYVLLSNM+A  GMW D RRVR+MMKER ++K+PGCSWIEL+G VHEFFV
Sbjct: 551 YNPSSYVLLSNMYASFGMWKDVRRVRTMMKERKIEKIPGCSWIELDGRVHEFFV 604




Plays a major role in chloroplast RNA editing. Acts as a site-recognition transacting factor to recruit C-deaminase.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SJZ3|PP169_ARATH Pentatricopeptide repeat-containing protein At2g22410, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E28 PE=2 SV=1 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9LS72|PP261_ARATH Pentatricopeptide repeat-containing protein At3g29230 OS=Arabidopsis thaliana GN=PCMP-E27 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSB8|PP235_ARATH Putative pentatricopeptide repeat-containing protein At3g15930 OS=Arabidopsis thaliana GN=PCMP-E51 PE=3 SV=2 Back     alignment and function description
>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=3 SV=1 Back     alignment and function description
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function description
>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1 Back     alignment and function description
>sp|P0C8Q5|PP336_ARATH Pentatricopeptide repeat-containing protein At4g22760 OS=Arabidopsis thaliana GN=PCMP-E6 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFL5|PP390_ARATH Pentatricopeptide repeat-containing protein At5g16860 OS=Arabidopsis thaliana GN=PCMP-H92 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query634
225453947635 PREDICTED: pentatricopeptide repeat-cont 0.996 0.995 0.683 0.0
224129982643 predicted protein [Populus trichocarpa] 0.996 0.982 0.690 0.0
147798551690 hypothetical protein VITISV_012899 [Viti 0.965 0.886 0.652 0.0
449432255638 PREDICTED: pentatricopeptide repeat-cont 0.993 0.987 0.625 0.0
345505208615 chlororespiratory reduction 4 [Arabis hi 0.949 0.978 0.646 0.0
345505216617 chlororespiratory reduction 4 [Capsella 0.930 0.956 0.653 0.0
345505230614 chlororespiratory reduction 4 [Nasturtiu 0.947 0.978 0.653 0.0
345505220612 chlororespiratory reduction 4 [Draba nem 0.949 0.983 0.639 0.0
345505218617 chlororespiratory reduction 4 [Crucihima 0.949 0.975 0.633 0.0
345505206594 chlororespiratory reduction 4, partial [ 0.911 0.973 0.654 0.0
>gi|225453947|ref|XP_002274056.1| PREDICTED: pentatricopeptide repeat-containing protein At2g45350, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/635 (68%), Positives = 532/635 (83%), Gaps = 3/635 (0%)

Query: 1   MFVSANYNQPCNSTQSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSP 60
           M +SA  NQP NST  TL+LL K KTL+DVNQIH+R+ITTGFI N  LTT+++ +FSSS 
Sbjct: 1   MLISATSNQPWNSTHPTLILLPKSKTLHDVNQIHSRLITTGFINNPSLTTRIILNFSSSS 60

Query: 61  CTPLTEFARYIFFKYH---AFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSV 117
             PL EFARY+F   H     R++ +PFLWNAIIK++SHG DP+EA V+F LML+NGV V
Sbjct: 61  HKPLVEFARYLFMSRHFGRKHRKQDNPFLWNAIIKSFSHGEDPREAFVIFNLMLENGVCV 120

Query: 118 DKFSASLVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLF 177
           DKFS SLVLKACSRLGLI+EG+QIHGLL ++  GSD+FLQNCL+ LY+RCG L  ARQLF
Sbjct: 121 DKFSFSLVLKACSRLGLIKEGMQIHGLLGRMEIGSDVFLQNCLMCLYLRCGCLGIARQLF 180

Query: 178 DKMGIRDSVSYNSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQF 237
           D+M  RDSVS+NSMIDGYVK G ++SARELFD MP+ ++NLISWNS+++GYA+ + GL+ 
Sbjct: 181 DRMMKRDSVSFNSMIDGYVKHGMVKSARELFDVMPMEQKNLISWNSMISGYARSEEGLRV 240

Query: 238 AWQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWANMIDGYAKLGRV 297
           AW++FE+MP+RDLISWNSM+ GCVKCGKM++A  LF++MPKRDVVSWANM+DGYAKLG +
Sbjct: 241 AWELFEEMPKRDLISWNSMIDGCVKCGKMENAHHLFNQMPKRDVVSWANMVDGYAKLGEI 300

Query: 298 DIARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVLSA 357
           DIAR LFDEMP+RDV++CNAMM GYV+NG+ M+AL  F +M     L PD+A+L+I LSA
Sbjct: 301 DIARGLFDEMPERDVISCNAMMAGYVQNGHLMEALNFFHDMLSRKELFPDNATLLITLSA 360

Query: 358 IAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHW 417
           IAQLGH D+GVA+H Y+E + FSL+ K GVALIDMY+KCGSI+NA+ VFE I+D S+DHW
Sbjct: 361 IAQLGHFDEGVALHCYIEDNGFSLSEKLGVALIDMYAKCGSIDNALSVFEDIDDKSIDHW 420

Query: 418 NAMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRR 477
           NA+I GLAIHGLGE+AF+L MEME+L ++PDDITF G+LNAC HAGLVKEGL+CFELMRR
Sbjct: 421 NAIIGGLAIHGLGEVAFELFMEMEKLFVKPDDITFIGVLNACNHAGLVKEGLMCFELMRR 480

Query: 478 IHKLEPELQHYGCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGE 537
           +HK+EP+LQHYGCMVDILGRAGH+E A+  +E MP+EPNDV+WRTLLSACRN+EN  +GE
Sbjct: 481 VHKVEPKLQHYGCMVDILGRAGHVEEAKKFVEKMPIEPNDVVWRTLLSACRNHENFTIGE 540

Query: 538 PVAKHLIGMDSSNSSSYVLLSNMFAGLGMWNDARRVRSMMKERNLKKLPGCSWIELEGVV 597
           PVAKHLI +DS N SSYVLLSN++AG GMWND  R+R MMK+R+LKK+PGCS IELEG V
Sbjct: 541 PVAKHLISVDSYNPSSYVLLSNIYAGFGMWNDVYRIRMMMKQRDLKKIPGCSQIELEGNV 600

Query: 598 HEFFVRDKSRLQVRDIYYMLDNMWTPDSVATSCTH 632
           HEFFVRDKS  QVR+IY MLD++   +S    C H
Sbjct: 601 HEFFVRDKSHPQVREIYSMLDSLSALNSEVAYCKH 635




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224129982|ref|XP_002320719.1| predicted protein [Populus trichocarpa] gi|222861492|gb|EEE99034.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147798551|emb|CAN72187.1| hypothetical protein VITISV_012899 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449432255|ref|XP_004133915.1| PREDICTED: pentatricopeptide repeat-containing protein At2g45350, chloroplastic-like [Cucumis sativus] gi|449480068|ref|XP_004155790.1| PREDICTED: pentatricopeptide repeat-containing protein At2g45350, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|345505208|gb|AEN99828.1| chlororespiratory reduction 4 [Arabis hirsuta] Back     alignment and taxonomy information
>gi|345505216|gb|AEN99832.1| chlororespiratory reduction 4 [Capsella bursa-pastoris] Back     alignment and taxonomy information
>gi|345505230|gb|AEN99839.1| chlororespiratory reduction 4 [Nasturtium officinale] Back     alignment and taxonomy information
>gi|345505220|gb|AEN99834.1| chlororespiratory reduction 4 [Draba nemorosa] Back     alignment and taxonomy information
>gi|345505218|gb|AEN99833.1| chlororespiratory reduction 4 [Crucihimalaya wallichii] Back     alignment and taxonomy information
>gi|345505206|gb|AEN99827.1| chlororespiratory reduction 4, partial [Aethionema grandiflorum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query634
TAIR|locus:2041198681 SLO1 "SLOW GROWTH 1" [Arabidop 0.938 0.873 0.381 1.6e-104
TAIR|locus:2205200741 OTP82 "AT1G08070" [Arabidopsis 0.963 0.824 0.350 3.7e-103
TAIR|locus:2060640738 OTP81 "ORGANELLE TRANSCRIPT PR 0.952 0.818 0.348 1.8e-101
TAIR|locus:2093920687 AT3G15930 "AT3G15930" [Arabido 0.946 0.873 0.351 1.3e-93
TAIR|locus:2054131697 SLO2 "AT2G13600" [Arabidopsis 0.847 0.770 0.358 3.1e-90
TAIR|locus:2140235781 AT4G02750 [Arabidopsis thalian 0.831 0.674 0.367 4e-90
TAIR|locus:2130354722 AT4G14820 "AT4G14820" [Arabido 0.949 0.833 0.320 1.2e-88
TAIR|locus:2206164570 AT1G31430 [Arabidopsis thalian 0.813 0.905 0.355 4.9e-85
TAIR|locus:2094812600 AT3G29230 "AT3G29230" [Arabido 0.695 0.735 0.378 2.4e-83
TAIR|locus:2154855620 AT5G66520 "AT5G66520" [Arabido 0.760 0.777 0.373 3.1e-83
TAIR|locus:2041198 SLO1 "SLOW GROWTH 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1035 (369.4 bits), Expect = 1.6e-104, P = 1.6e-104
 Identities = 236/619 (38%), Positives = 350/619 (56%)

Query:    12 NSTQSTLL------LLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTPLT 65
             NST S +L      LL KCK L  + QI A+MI  G I +   +++L+A F    C  L+
Sbjct:    45 NSTHSFVLHNPLLSLLEKCKLLLHLKQIQAQMIINGLILDPFASSRLIA-F----CA-LS 98

Query:    66 EFARYIFFKYHAFREKKDP--FLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSV---DKF 120
             E +RY+ +     +  ++P  F WN  I+ +S   +PKE+ +++  ML +G      D F
Sbjct:    99 E-SRYLDYSVKILKGIENPNIFSWNVTIRGFSESENPKESFLLYKQMLRHGCCESRPDHF 157

Query:   121 SASLVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKM 180
             +  ++ K C+ L L   G  I G + K+       + N  I ++  CG +E AR++FD+ 
Sbjct:   158 TYPVLFKVCADLRLSSLGHMILGHVLKLRLELVSHVHNASIHMFASCGDMENARKVFDES 217

Query:   181 GIRDSVSYNSMIDGYVKSGNIESA---RELFDSMPIR--ERNLISWNSVLNGYAQLKSGL 235
              +RD VS+N +I+GY K G  E A    +L +S  ++  +  +I   S  +    L  G 
Sbjct:   218 PVRDLVSWNCLINGYKKIGEAEKAIYVYKLMESEGVKPDDVTMIGLVSSCSMLGDLNRGK 277

Query:   236 QFAWQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWANMIDGYAKLG 295
             +F   + E      +   N+++    KCG + +A+ +FD + KR +VSW  MI GYA+ G
Sbjct:   278 EFYEYVKENGLRMTIPLVNALMDMFSKCGDIHEARRIFDNLEKRTIVSWTTMISGYARCG 337

Query:   296 RVDIARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVL 355
              +D++R+LFD+M ++DVV  NAM+GG V+      AL +F  MQ      PD+ +++  L
Sbjct:   338 LLDVSRKLFDDMEEKDVVLWNAMIGGSVQAKRGQDALALFQEMQTS-NTKPDEITMIHCL 396

Query:   356 SAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVD 415
             SA +QLG +D G+ IHRY+EK   SLN   G +L+DMY+KCG+I  A+ VF  I+  +  
Sbjct:   397 SACSQLGALDVGIWIHRYIEKYSLSLNVALGTSLVDMYAKCGNISEALSVFHGIQTRNSL 456

Query:   416 HWNAMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELM 475
              + A+I GLA+HG    A     EM    I PD+ITF GLL+AC H G+++ G   F  M
Sbjct:   457 TYTAIIGGLALHGDASTAISYFNEMIDAGIAPDEITFIGLLSACCHGGMIQTGRDYFSQM 516

Query:   476 RRIHKLEPELQHYGCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNV 535
             +    L P+L+HY  MVD+LGRAG +E A  L+E MPME +  +W  LL  CR + N+ +
Sbjct:   517 KSRFNLNPQLKHYSIMVDLLGRAGLLEEADRLMESMPMEADAAVWGALLFGCRMHGNVEL 576

Query:   536 GEPVAKHLIGMDXXXXXXXXXXXXMFAGLGMWNDARRVRSMMKERNLKKLPGCSWIELEG 595
             GE  AK L+ +D            M+    MW DA+R R MM ER ++K+PGCS IE+ G
Sbjct:   577 GEKAAKKLLELDPSDSGIYVLLDGMYGEANMWEDAKRARRMMNERGVEKIPGCSSIEVNG 636

Query:   596 VVHEFFVRDKSRLQVRDIY 614
             +V EF VRDKSR +   IY
Sbjct:   637 IVCEFIVRDKSRPESEKIY 655




GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060640 OTP81 "ORGANELLE TRANSCRIPT PROCESSING 81" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093920 AT3G15930 "AT3G15930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054131 SLO2 "AT2G13600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130354 AT4G14820 "AT4G14820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206164 AT1G31430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094812 AT3G29230 "AT3G29230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154855 AT5G66520 "AT5G66520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22137PP202_ARATHNo assigned EC number0.65480.93050.9624yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query634
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-105
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-88
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-51
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-38
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 7e-36
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-35
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-29
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-19
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-13
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-06
pfam0153531 pfam01535, PPR, PPR repeat 8e-06
pfam0153531 pfam01535, PPR, PPR repeat 3e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-05
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-05
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.003
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.003
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  338 bits (868), Expect = e-105
 Identities = 188/622 (30%), Positives = 313/622 (50%), Gaps = 55/622 (8%)

Query: 7   YNQPCNSTQSTLLLLRKCKTLNDV---NQIHARMITTGFIKNTHLTTKLVASFSSSPCTP 63
           Y  PC        +LR C  + D+    ++HA ++  GF  +  +   L+  +    C  
Sbjct: 188 YTFPC--------VLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVK--CGD 237

Query: 64  LTEFARYIFFKYHAFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSAS 123
           +   AR +F +      ++D   WNA+I  Y    +  E L +F  M +  V  D  + +
Sbjct: 238 VVS-ARLVFDRM----PRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTIT 292

Query: 124 LVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKMGIR 183
            V+ AC  LG    G ++HG + K  F  D+ + N LI +Y+  G    A ++F +M  +
Sbjct: 293 SVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETK 352

Query: 184 DSVSYNSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQFAWQIFE 243
           D+VS+ +MI GY K+G  + A E +  M          ++V                   
Sbjct: 353 DAVSWTAMISGYEKNGLPDKALETYALMEQ--------DNV------------------- 385

Query: 244 KMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPKRDVVSWA----NMIDGYAKLGRVDI 299
             P  D I+  S+L  C   G +D    L +   ++ ++S+      +I+ Y+K   +D 
Sbjct: 386 -SP--DEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDK 442

Query: 300 ARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFDNMQCELYLHPDDASLVIVLSAIA 359
           A  +F  +P++DV++  +++ G   N    +AL  F  M   L L P+  +L+  LSA A
Sbjct: 443 ALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQML--LTLKPNSVTLIAALSACA 500

Query: 360 QLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWNA 419
           ++G +  G  IH ++ +     +G    AL+D+Y +CG +  A   F   E   V  WN 
Sbjct: 501 RIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSHEK-DVVSWNI 559

Query: 420 MINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIH 479
           ++ G   HG G +A +L   M    + PD++TF  LL AC+ +G+V +GL  F  M   +
Sbjct: 560 LLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKY 619

Query: 480 KLEPELQHYGCMVDILGRAGHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGEPV 539
            + P L+HY C+VD+LGRAG +  A N I  MP+ P+  +W  LL+ACR + ++ +GE  
Sbjct: 620 SITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELA 679

Query: 540 AKHLIGMDSSNSSSYVLLSNMFAGLGMWNDARRVRSMMKERNLKKLPGCSWIELEGVVHE 599
           A+H+  +D ++   Y+LL N++A  G W++  RVR  M+E  L   PGCSW+E++G VH 
Sbjct: 680 AQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHA 739

Query: 600 FFVRDKSRLQVRDIYYMLDNMW 621
           F   D+S  Q+++I  +L+  +
Sbjct: 740 FLTDDESHPQIKEINTVLEGFY 761


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 634
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.94
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.93
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.93
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.86
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.86
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.86
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.83
PRK14574 822 hmsH outer membrane protein; Provisional 99.83
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.83
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.82
PRK14574 822 hmsH outer membrane protein; Provisional 99.78
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.78
KOG2003840 consensus TPR repeat-containing protein [General f 99.77
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.74
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.71
KOG2076895 consensus RNA polymerase III transcription factor 99.68
KOG2003840 consensus TPR repeat-containing protein [General f 99.67
KOG2076895 consensus RNA polymerase III transcription factor 99.65
KOG1915677 consensus Cell cycle control protein (crooked neck 99.65
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.64
KOG0547606 consensus Translocase of outer mitochondrial membr 99.64
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.63
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.62
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.58
KOG0547606 consensus Translocase of outer mitochondrial membr 99.56
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.55
KOG1126638 consensus DNA-binding cell division cycle control 99.55
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.55
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.55
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.54
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.51
KOG1915677 consensus Cell cycle control protein (crooked neck 99.51
KOG1126638 consensus DNA-binding cell division cycle control 99.48
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.48
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.47
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.47
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.46
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.46
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.46
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.44
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.41
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.4
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.39
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.39
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.33
KOG2376652 consensus Signal recognition particle, subunit Srp 99.32
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.32
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.32
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.31
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.29
PF1304150 PPR_2: PPR repeat family 99.29
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.27
PRK12370553 invasion protein regulator; Provisional 99.26
KOG1129478 consensus TPR repeat-containing protein [General f 99.25
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.25
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.24
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.23
KOG1129478 consensus TPR repeat-containing protein [General f 99.21
PRK11189296 lipoprotein NlpI; Provisional 99.18
PRK12370553 invasion protein regulator; Provisional 99.18
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.17
PRK11189296 lipoprotein NlpI; Provisional 99.16
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.15
PF1304150 PPR_2: PPR repeat family 99.15
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.15
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.14
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.11
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.1
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.07
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.06
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.06
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.05
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.05
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.03
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.98
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.98
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.97
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.96
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.95
KOG1125579 consensus TPR repeat-containing protein [General f 98.92
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.9
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.89
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.88
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.87
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.82
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.81
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.77
PRK10370198 formate-dependent nitrite reductase complex subuni 98.77
PRK04841903 transcriptional regulator MalT; Provisional 98.74
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.7
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.67
PRK15359144 type III secretion system chaperone protein SscB; 98.64
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.61
KOG1125579 consensus TPR repeat-containing protein [General f 98.6
PRK15359144 type III secretion system chaperone protein SscB; 98.6
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.59
PLN02789320 farnesyltranstransferase 98.53
PF1285434 PPR_1: PPR repeat 98.53
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.52
PF1285434 PPR_1: PPR repeat 98.52
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.52
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.51
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.48
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.47
PRK04841 903 transcriptional regulator MalT; Provisional 98.47
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.46
PRK10370198 formate-dependent nitrite reductase complex subuni 98.46
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.44
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.41
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.4
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.38
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.37
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.37
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.36
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.34
PLN02789320 farnesyltranstransferase 98.34
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.33
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.28
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.27
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.24
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.24
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.23
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.17
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.14
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.1
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.1
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.08
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.08
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.07
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.05
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.04
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.01
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.0
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.99
KOG0553304 consensus TPR repeat-containing protein [General f 97.95
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.94
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.92
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.92
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.89
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.85
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.84
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.83
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.83
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.83
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.81
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.8
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.75
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.74
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.74
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.71
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.7
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.67
KOG0553304 consensus TPR repeat-containing protein [General f 97.64
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.61
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.6
PF1337173 TPR_9: Tetratricopeptide repeat 97.59
PRK15331165 chaperone protein SicA; Provisional 97.57
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.55
COG4700251 Uncharacterized protein conserved in bacteria cont 97.51
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.51
PF12688120 TPR_5: Tetratrico peptide repeat 97.5
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.47
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.46
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.45
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.45
PF1343134 TPR_17: Tetratricopeptide repeat 97.45
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.43
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.42
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.42
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.42
PRK10803263 tol-pal system protein YbgF; Provisional 97.4
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.39
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.39
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.39
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.38
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.36
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.29
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.29
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.29
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.28
COG3898531 Uncharacterized membrane-bound protein [Function u 97.28
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.27
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.22
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.21
KOG1258577 consensus mRNA processing protein [RNA processing 97.18
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.17
PF1342844 TPR_14: Tetratricopeptide repeat 97.16
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.09
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.08
KOG20411189 consensus WD40 repeat protein [General function pr 97.04
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.03
PF12688120 TPR_5: Tetratrico peptide repeat 97.02
KOG20411189 consensus WD40 repeat protein [General function pr 97.01
COG3898531 Uncharacterized membrane-bound protein [Function u 96.99
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.98
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.98
COG4700251 Uncharacterized protein conserved in bacteria cont 96.97
PRK10803263 tol-pal system protein YbgF; Provisional 96.96
PF1337173 TPR_9: Tetratricopeptide repeat 96.9
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.88
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.82
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.79
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.76
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.72
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.69
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.67
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.67
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.64
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.56
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.51
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.51
KOG1585308 consensus Protein required for fusion of vesicles 96.5
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.43
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.43
KOG4555175 consensus TPR repeat-containing protein [Function 96.39
KOG1258577 consensus mRNA processing protein [RNA processing 96.28
PRK11906458 transcriptional regulator; Provisional 96.25
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.18
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.17
PF13512142 TPR_18: Tetratricopeptide repeat 96.16
PRK11906458 transcriptional regulator; Provisional 95.97
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.93
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.92
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.8
PRK09687280 putative lyase; Provisional 95.7
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.66
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.62
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.57
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.53
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.51
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.42
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.4
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.4
PF13512142 TPR_18: Tetratricopeptide repeat 95.39
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.38
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.34
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.27
smart00299140 CLH Clathrin heavy chain repeat homology. 95.08
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.98
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.84
PRK15331165 chaperone protein SicA; Provisional 94.84
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.76
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.73
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.61
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.58
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.57
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.53
KOG1941518 consensus Acetylcholine receptor-associated protei 94.41
smart00299140 CLH Clathrin heavy chain repeat homology. 94.34
KOG4234271 consensus TPR repeat-containing protein [General f 94.3
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.29
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 94.12
KOG4555175 consensus TPR repeat-containing protein [Function 93.92
KOG3941406 consensus Intermediate in Toll signal transduction 93.88
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.83
PRK11619 644 lytic murein transglycosylase; Provisional 93.63
KOG3941406 consensus Intermediate in Toll signal transduction 93.57
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.32
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.27
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.16
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.14
PRK09687280 putative lyase; Provisional 93.06
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.87
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 92.83
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.66
PF1342844 TPR_14: Tetratricopeptide repeat 92.55
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.38
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 92.29
COG2976207 Uncharacterized protein conserved in bacteria [Fun 92.17
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.16
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.12
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.07
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.06
KOG1586288 consensus Protein required for fusion of vesicles 91.97
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 91.95
KOG4648 536 consensus Uncharacterized conserved protein, conta 91.93
COG3629280 DnrI DNA-binding transcriptional activator of the 91.18
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 90.96
KOG2062 929 consensus 26S proteasome regulatory complex, subun 90.84
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 90.79
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 90.67
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.6
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.48
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 90.39
COG4649221 Uncharacterized protein conserved in bacteria [Fun 89.77
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.76
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 89.68
COG4649221 Uncharacterized protein conserved in bacteria [Fun 89.26
KOG1585308 consensus Protein required for fusion of vesicles 89.24
COG3629280 DnrI DNA-binding transcriptional activator of the 88.71
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.63
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.5
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.45
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 88.35
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 87.88
KOG1586288 consensus Protein required for fusion of vesicles 87.84
PF13170297 DUF4003: Protein of unknown function (DUF4003) 87.81
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 87.81
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.3
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 87.13
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 86.93
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 86.92
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 86.89
KOG4234271 consensus TPR repeat-containing protein [General f 86.59
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.15
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 86.1
KOG4648 536 consensus Uncharacterized conserved protein, conta 85.82
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 85.59
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.42
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 85.31
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 85.2
KOG1550552 consensus Extracellular protein SEL-1 and related 85.09
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 84.86
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 84.35
COG4105254 ComL DNA uptake lipoprotein [General function pred 84.08
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 84.06
COG3947361 Response regulator containing CheY-like receiver a 83.86
PF06552186 TOM20_plant: Plant specific mitochondrial import r 83.77
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 83.66
PRK10941269 hypothetical protein; Provisional 83.62
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 83.34
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.24
KOG4570418 consensus Uncharacterized conserved protein [Funct 82.84
PRK11619644 lytic murein transglycosylase; Provisional 82.79
KOG1550552 consensus Extracellular protein SEL-1 and related 82.34
PF1343134 TPR_17: Tetratricopeptide repeat 82.14
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 81.77
COG4455 273 ImpE Protein of avirulence locus involved in tempe 81.15
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 80.85
PF09986214 DUF2225: Uncharacterized protein conserved in bact 80.83
KOG4570418 consensus Uncharacterized conserved protein [Funct 80.8
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 80.19
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 80.08
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 80.07
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.8e-85  Score=717.95  Aligned_cols=601  Identities=31%  Similarity=0.580  Sum_probs=565.2

Q ss_pred             hhHHHHHHhccCchHHHHHHHHHHHhCCCCchhhhhHHHHHhhcCCCCCCHHHHHHHHHhccccCCCCCcccHHHHHHHH
Q 047120           15 QSTLLLLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTPLTEFARYIFFKYHAFREKKDPFLWNAIIKTY   94 (634)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~   94 (634)
                      ..++..+...+.+..+.+++.++++.|..+++.++|.||.+|+++|+.   ..|+++|++|+    +||..+||.+|.+|
T Consensus        90 ~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~li~~~~~~g~~---~~A~~~f~~m~----~~d~~~~n~li~~~  162 (857)
T PLN03077         90 VALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNAMLSMFVRFGEL---VHAWYVFGKMP----ERDLFSWNVLVGGY  162 (857)
T ss_pred             HHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHHHHhCCCh---HHHHHHHhcCC----CCCeeEHHHHHHHH
Confidence            333344444455666778888888888888888999999999999998   99999999997    68999999999999


Q ss_pred             HcCCCcchHHHHHHHHHHCCCCCCcchHHHHHHHHhccCChHHHHHHHHHHHHhcCCCChhHHHHHHHHHHhcCCHHHHH
Q 047120           95 SHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKACSRLGLIEEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFAR  174 (634)
Q Consensus        95 ~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~  174 (634)
                      ++.|++++|+++|++|...|+.||..||+.++++|+..+++..+.+++..+.+.|+.||..++++|+.+|++.|+++.|.
T Consensus       163 ~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~  242 (857)
T PLN03077        163 AKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSAR  242 (857)
T ss_pred             HhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhCCCCChhHHHHHHHHHHhCCChHHHHHHHhhCccC--C-----------------------------------CC
Q 047120          175 QLFDKMGIRDSVSYNSMIDGYVKSGNIESARELFDSMPIR--E-----------------------------------RN  217 (634)
Q Consensus       175 ~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~--~-----------------------------------p~  217 (634)
                      ++|++|+.+|..+||++|.+|++.|++++|+++|.+|...  .                                   ||
T Consensus       243 ~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d  322 (857)
T PLN03077        243 LVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVD  322 (857)
T ss_pred             HHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccc
Confidence            9999999999999999999999999999999999999764  3                                   45


Q ss_pred             hhHHHHHHHHHHhcCCcHHHHHHHHhhCCCCCchHHHHHHHHHHhcCChHHHHHHHhhCCC-------------------
Q 047120          218 LISWNSVLNGYAQLKSGLQFAWQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPK-------------------  278 (634)
Q Consensus       218 ~~~~~~ll~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~-------------------  278 (634)
                      ..+|+.++.+|++.|+ ++.|.++|++|..||..+|+.++.+|.+.|++++|+++|++|.+                   
T Consensus       323 ~~~~n~Li~~y~k~g~-~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~  401 (857)
T PLN03077        323 VSVCNSLIQMYLSLGS-WGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACAC  401 (857)
T ss_pred             hHHHHHHHHHHHhcCC-HHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhc
Confidence            6667777777888888 99999999999999999999999999999999999999998842                   


Q ss_pred             --------------------CChhHHHHHHHHHHHcCChHHHHHHhhhCCCCChhhHHHHHHHHHHcCCchHHHHHHHHH
Q 047120          279 --------------------RDVVSWANMIDGYAKLGRVDIARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFDNM  338 (634)
Q Consensus       279 --------------------~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~m  338 (634)
                                          ++..+++.|+++|+++|++++|.++|++|.++|..+|+.++.+|++.|+.++|+.+|++|
T Consensus       402 ~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m  481 (857)
T PLN03077        402 LGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQM  481 (857)
T ss_pred             cchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHHH
Confidence                                456677889999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCCCCCHhHHHHHHHHHHccCChHHHHHHHHHHHHcCCCCchhHHHHHHHHhHhcCCHHHHHHHHHhccCCChhHHH
Q 047120          339 QCELYLHPDDASLVIVLSAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIEDGSVDHWN  418 (634)
Q Consensus       339 ~~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~  418 (634)
                      ..  ++.||..||+.++.+|++.|+++.+.+++..+.+.|+.++..++++++++|+++|++++|.++|+.+ .+|..+||
T Consensus       482 ~~--~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n  558 (857)
T PLN03077        482 LL--TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-EKDVVSWN  558 (857)
T ss_pred             Hh--CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-CCChhhHH
Confidence            84  5899999999999999999999999999999999999999999999999999999999999999999 89999999


Q ss_pred             HHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCCHHHHHHHHHHhHHhcCcccChhHHHHHHHHHhcc
Q 047120          419 AMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHYGCMVDILGRA  498 (634)
Q Consensus       419 ~li~~~~~~~~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  498 (634)
                      ++|.+|++.|+.++|+++|++|.+.|+.||..||+.++.+|++.|.+++|.++|+.|.+.+|+.|+..+|++++++|++.
T Consensus       559 ~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~  638 (857)
T PLN03077        559 ILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRA  638 (857)
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999999999999996689999999999999999999


Q ss_pred             CCHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHhccCCCCCchHHHHHHHHhcCCCchHHHHHHHHHH
Q 047120          499 GHIEAARNLIEDMPMEPNDVIWRTLLSACRNYENLNVGEPVAKHLIGMDSSNSSSYVLLSNMFAGLGMWNDARRVRSMMK  578 (634)
Q Consensus       499 g~~~~A~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~  578 (634)
                      |++++|.+++++|+++||..+|++|+.+|...|+.+.++...+++++++|+++..|..|+++|...|+|++|.++.+.|+
T Consensus       639 G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~  718 (857)
T PLN03077        639 GKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMR  718 (857)
T ss_pred             CCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hCCCccCCceeEEEEcCEEEEEEeCCCCCcchhHHHHHHH--------hcccCccc
Q 047120          579 ERNLKKLPGCSWIELEGVVHEFFVRDKSRLQVRDIYYMLD--------NMWTPDSV  626 (634)
Q Consensus       579 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~  626 (634)
                      +.|+++.||+||+++.+.+|.|+.++++||+..+.|.+++        .++.||..
T Consensus       719 ~~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~g~~~~~~  774 (857)
T PLN03077        719 ENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGLAGSES  774 (857)
T ss_pred             HcCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHHHHHHHHHHhCCcCCCcc
Confidence            9999999999999999999999999999999999887555        36778743



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query634
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 62.6 bits (151), Expect = 3e-10
 Identities = 78/618 (12%), Positives = 174/618 (28%), Gaps = 202/618 (32%)

Query: 7   YNQPCNSTQSTLL---LLRKCKTLNDVNQIHARMITTGFIKNTHLTTKLVASFSSSPCTP 63
                  + +  L   LL K +      ++  + +      N      L++   +    P
Sbjct: 55  IMSKDAVSGTLRLFWTLLSKQE------EMVQKFVEEVLRINYKF---LMSPIKTEQRQP 105

Query: 64  LTEFARYI------------FFKYHAFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLML 111
                 YI            F KY+  R +    L  A+++     L P + +++   +L
Sbjct: 106 SMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLE-----LRPAKNVLIDG-VL 159

Query: 112 DNGVSVDKFSASLVLKACSRLGLIEE-GLQIHGL-LRKVAFGSDLF--LQN-CL------ 160
            +G +       + L  C    +  +   +I  L L+       +   LQ          
Sbjct: 160 GSGKTW------VALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNW 213

Query: 161 ---------ISLYVRCGYLEFARQLFDKMGIR-----DSVSYNSMIDGY-------VKSG 199
                    I L +     E  R L  K          +V      + +       + + 
Sbjct: 214 TSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTR 273

Query: 200 NIESARELFDSMPIRERNLISWNSVLNGYAQLKS-GL--QFAWQIFEKMPE--------- 247
                +++ D +       IS +         +   L  ++     + +P          
Sbjct: 274 F----KQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRR 329

Query: 248 --------RDLIS-WN-----------SMLHGCVKCGKMDDAQALFDKM---PKRDV--- 281
                   RD ++ W+           +++   +   +  + + +FD++   P       
Sbjct: 330 LSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPP-SAHIP 388

Query: 282 -----VSWANMIDGYAKLGRVDIARRLFDEMPKRDVVACNAMMGGYVRNGYSMKALEIFD 336
                + W ++I              + +++ K  +V                       
Sbjct: 389 TILLSLIWFDVIK--------SDVMVVVNKLHKYSLVEKQPKESTI-------------- 426

Query: 337 NMQCELYLHPDDASLVIVLSAIAQLGHIDKGVAIHR-----YLEKDQFSLNGKHGVALID 391
                  +     S+ + L        ++   A+HR     Y     F  +      L D
Sbjct: 427 ------SIP----SIYLELKV-----KLENEYALHRSIVDHYNIPKTFDSDDLIPPYL-D 470

Query: 392 MY---------SKCGSIENAIKVFEQIEDGSVD-HW--NAMIN-GLAIHGLGELAFDLLM 438
            Y               E  + +F  +    +D  +    + +   A +  G +  + L 
Sbjct: 471 QYFYSHIGHHLKNIEHPER-MTLFRMV---FLDFRFLEQKIRHDSTAWNASGSIL-NTLQ 525

Query: 439 EME--RLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIHKLEPELQHYGCMVDILG 496
           +++  +  I  +D  +  L+NA               ++  + K+E  L       D+L 
Sbjct: 526 QLKFYKPYICDNDPKYERLVNA---------------ILDFLPKIEENLICSKYT-DLLR 569

Query: 497 RA-----GHI--EAARNL 507
            A       I  EA + +
Sbjct: 570 IALMAEDEAIFEEAHKQV 587


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query634
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.95
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.83
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.82
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.8
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.78
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.78
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.77
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.75
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.75
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.74
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.74
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.73
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.67
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.67
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.66
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.65
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.62
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.62
3u4t_A272 TPR repeat-containing protein; structural genomics 99.6
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.6
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.59
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.57
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.55
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.55
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.54
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.54
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.54
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.54
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.54
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.54
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.53
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.52
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.52
3u4t_A272 TPR repeat-containing protein; structural genomics 99.52
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.51
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.51
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.5
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.49
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.48
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.47
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.46
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.45
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.41
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.41
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.4
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.39
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.38
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.38
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.37
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.34
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.33
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.32
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.32
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.32
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.31
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.3
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.29
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.28
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.26
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.25
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.22
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.2
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.17
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.15
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.1
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.09
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.08
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.08
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.06
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.06
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.04
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.0
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.0
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.0
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.96
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.95
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.93
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.89
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.88
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.88
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.87
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.86
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.85
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.84
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.84
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.83
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.83
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.82
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.81
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.8
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.79
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.77
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.77
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.76
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.76
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.72
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.72
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.7
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.69
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.67
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.67
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.67
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.67
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.67
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.67
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.65
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.64
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.64
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.63
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.62
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.61
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.6
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.59
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.56
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.55
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.55
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.54
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.54
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.53
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.51
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.5
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.5
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.5
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.48
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.48
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.47
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.46
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.46
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.45
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.44
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.43
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.43
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.42
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.41
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.4
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.35
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.35
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.35
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.34
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.32
3k9i_A117 BH0479 protein; putative protein binding protein, 98.31
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.29
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.29
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.28
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.28
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.28
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.26
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.26
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.24
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.24
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.24
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.24
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.24
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.23
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.23
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.22
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.21
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.18
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.16
3k9i_A117 BH0479 protein; putative protein binding protein, 98.16
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.14
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.12
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.12
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.11
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.07
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.05
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.03
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.97
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.97
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.9
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.88
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.87
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.85
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.83
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.75
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.71
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.7
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.69
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.61
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.59
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.54
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.53
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.48
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.38
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.31
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.13
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.13
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.12
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.1
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.06
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 97.03
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.01
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.65
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.61
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.59
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.58
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.56
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.49
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.44
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.24
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.19
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.84
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.77
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.56
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.96
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.93
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.33
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.12
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.91
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 93.53
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.28
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 93.06
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 92.97
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 92.03
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 91.88
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 91.63
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.34
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 91.25
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.04
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.03
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 90.97
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 90.48
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 90.44
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 89.19
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.95
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.61
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 88.4
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 88.23
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 87.85
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 87.62
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 87.37
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 87.27
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 85.15
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 84.68
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 83.74
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 83.3
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 82.87
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 82.76
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 82.67
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.3e-41  Score=364.04  Aligned_cols=489  Identities=9%  Similarity=-0.017  Sum_probs=308.4

Q ss_pred             hhcCCCCCCHHHHHHHHHhccccCCCCCcccHHHHHHHHHcCCCcchHHHHHHHHHHCCCCCCcchHHHHHHHHhccCCh
Q 047120           56 FSSSPCTPLTEFARYIFFKYHAFREKKDPFLWNAIIKTYSHGLDPKEALVMFCLMLDNGVSVDKFSASLVLKACSRLGLI  135 (634)
Q Consensus        56 ~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~  135 (634)
                      +.+.|..   ..+...|+.++    .++...|+.++..|.+.|++++|+.+|++|.+  ..|+..++..++.+|.+.|++
T Consensus        63 ~~~~~~~---~~~~~~~~~~~----~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~  133 (597)
T 2xpi_A           63 TSTDGSF---LKERNAQNTDS----LSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDY  133 (597)
T ss_dssp             --------------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCH
T ss_pred             ccccCcc---CCCCCccccch----HHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcH
Confidence            4556666   67777777664    56889999999999999999999999999996  568889999999999999999


Q ss_pred             HHHHHHHHHHHHhcCCCChhHHHHHHHHHHhcCCHHHHHHHHhhCCCC-------------------ChhHHHHHHHHHH
Q 047120          136 EEGLQIHGLLRKVAFGSDLFLQNCLISLYVRCGYLEFARQLFDKMGIR-------------------DSVSYNSMIDGYV  196 (634)
Q Consensus       136 ~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~-------------------~~~~~~~li~~~~  196 (634)
                      ++|..+++.+...  .+++.+++.++.+|.+.|++++|.++|+++...                   +..+|+.++.+|.
T Consensus       134 ~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  211 (597)
T 2xpi_A          134 ARAKCLLTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYT  211 (597)
T ss_dssp             HHHHHHHHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHH
Confidence            9999999988653  678899999999999999999999999965433                   3779999999999


Q ss_pred             hCCChHHHHHHHhhCccCCCChhH-HHHHHHHHHhcCCcHHHHHHHHhhC-----CC----CCchHHHHHHHHHHhcCCh
Q 047120          197 KSGNIESARELFDSMPIRERNLIS-WNSVLNGYAQLKSGLQFAWQIFEKM-----PE----RDLISWNSMLHGCVKCGKM  266 (634)
Q Consensus       197 ~~g~~~~A~~~~~~m~~~~p~~~~-~~~ll~~~~~~~~~~~~a~~~~~~~-----~~----~~~~~~~~l~~~~~~~g~~  266 (634)
                      +.|++++|++.|++|....|+... +..+...+...+   .........+     ..    ....+|+.++..|.+.|++
T Consensus       212 ~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~---~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~  288 (597)
T 2xpi_A          212 NLSNFDRAKECYKEALMVDAKCYEAFDQLVSNHLLTA---DEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDEL  288 (597)
T ss_dssp             HTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTCSCH---HHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHH
T ss_pred             HcCCHHHHHHHHHHHHHhCchhhHHHHHHHHhhcccc---hhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchH
Confidence            999999999999999887666443 333333222221   1111111211     11    1223344445556666666


Q ss_pred             HHHHHHHhhCCC--CChhHHHHHHHHHHHcCChHHHHHHhhhCCC---CChhhHHHHHHHHHHcCCchHHHHHHHHHHhc
Q 047120          267 DDAQALFDKMPK--RDVVSWANMIDGYAKLGRVDIARRLFDEMPK---RDVVACNAMMGGYVRNGYSMKALEIFDNMQCE  341 (634)
Q Consensus       267 ~~A~~~~~~~~~--~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~  341 (634)
                      ++|.++|+++.+  ++..+++.++.+|.+.|++++|..+|+++.+   .+..+|+.++.++.+.|++++|..+++++...
T Consensus       289 ~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~  368 (597)
T 2xpi_A          289 RRAEDYLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYLISNDLVDR  368 (597)
T ss_dssp             HHHHHHHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhh
Confidence            666666666665  5666666666666666666666666666542   34556666666666666666666666666532


Q ss_pred             CCCCCCHhHHHHHHHHHHccCChHHHHHHHHHHHHcCCCCchhHHHHHHHHhHhcCCHHHHHHHHHhcc---CCChhHHH
Q 047120          342 LYLHPDDASLVIVLSAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALIDMYSKCGSIENAIKVFEQIE---DGSVDHWN  418 (634)
Q Consensus       342 ~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~---~~~~~~~~  418 (634)
                        .+.+..++..++..+.+.|++++|..+|+.+.+.. +.+..++..++.+|.+.|++++|+++|+++.   ..+..+|+
T Consensus       369 --~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~  445 (597)
T 2xpi_A          369 --HPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYL  445 (597)
T ss_dssp             --CTTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHH
T ss_pred             --CcccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHH
Confidence              22345556666666666666666666666665532 2345566666666666666666666666543   23455566


Q ss_pred             HHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCCHHHHHHHHHHhHHhc---CcccC--hhHHHHHHH
Q 047120          419 AMINGLAIHGLGELAFDLLMEMERLSIEPDDITFTGLLNACAHAGLVKEGLLCFELMRRIH---KLEPE--LQHYGCMVD  493 (634)
Q Consensus       419 ~li~~~~~~~~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~---~~~~~--~~~~~~l~~  493 (634)
                      .++.+|.+.|++++|.++|+++.+.. ..+..+|..++..|.+.|++++|.++|+++.+..   +..|+  ..+|..++.
T Consensus       446 ~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~  524 (597)
T 2xpi_A          446 FLGMQHMQLGNILLANEYLQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGH  524 (597)
T ss_dssp             HHHHHHHHHTCHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHH
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHH
Confidence            66666666666666666666665532 2235566666666666666666666666655421   33444  455666666


Q ss_pred             HHhccCCHHHHHHHHHhC-CC-CCCHHHHHHHHHHHHhcCChhHHHHHHHHHhccCCCCCchHHHHHHHHh
Q 047120          494 ILGRAGHIEAARNLIEDM-PM-EPNDVIWRTLLSACRNYENLNVGEPVAKHLIGMDSSNSSSYVLLSNMFA  562 (634)
Q Consensus       494 ~~~~~g~~~~A~~~~~~~-~~-~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~  562 (634)
                      +|.+.|++++|.+.++++ .. +.+..+|..++.+|...|++++|.+.++++++.+|.++..+..++.+|.
T Consensus       525 ~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~  595 (597)
T 2xpi_A          525 AYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALE  595 (597)
T ss_dssp             HHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTC
T ss_pred             HHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCCChHHHHHHHHHHh
Confidence            666666666666666655 22 2245566666666666666666666666666666666666666655553



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query634
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.62
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.56
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.22
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.12
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.09
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.05
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.04
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.03
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.03
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.03
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.03
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.9
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.71
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.64
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.63
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.61
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.59
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.56
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.52
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.5
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.49
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.46
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.46
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.4
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.27
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.26
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.21
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.2
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.12
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.11
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.1
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.03
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.98
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.98
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.87
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.83
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.82
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.79
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.71
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.68
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.67
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.55
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.53
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.44
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.19
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.18
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.07
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.76
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.11
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.99
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.72
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.7
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.04
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.14
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 92.85
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 87.16
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=3.6e-21  Score=190.74  Aligned_cols=366  Identities=12%  Similarity=0.069  Sum_probs=265.4

Q ss_pred             HHHHhcCCHHHHHHHHhhCCC--C-ChhHHHHHHHHHHhCCChHHHHHHHhhCccCCCChhHHHHHHHHHHhcCCcHHHH
Q 047120          162 SLYVRCGYLEFARQLFDKMGI--R-DSVSYNSMIDGYVKSGNIESARELFDSMPIRERNLISWNSVLNGYAQLKSGLQFA  238 (634)
Q Consensus       162 ~~~~~~g~~~~A~~~~~~~~~--~-~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~p~~~~~~~ll~~~~~~~~~~~~a  238 (634)
                      ..+.+.|++++|++.++++.+  | +...+..+...+.+.|++++|++.|+++.+..|+                     
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~---------------------   65 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL---------------------   65 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT---------------------
T ss_pred             HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC---------------------
Confidence            344455566666655555431  2 3445555555555555555555555555443332                     


Q ss_pred             HHHHhhCCCCCchHHHHHHHHHHhcCChHHHHHHHhhCCC---CChhHHHHHHHHHHHcCChHHHHHHhhhCC---CCCh
Q 047120          239 WQIFEKMPERDLISWNSMLHGCVKCGKMDDAQALFDKMPK---RDVVSWANMIDGYAKLGRVDIARRLFDEMP---KRDV  312 (634)
Q Consensus       239 ~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~---~~~~  312 (634)
                                +..++..+...|.+.|++++|+..+....+   .+..............+....+........   ....
T Consensus        66 ----------~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  135 (388)
T d1w3ba_          66 ----------LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLY  135 (388)
T ss_dssp             ----------CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCT
T ss_pred             ----------CHHHHHHHHHHhhhhccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                      233455555566666666666666665543   233333344444444444444443333222   2344


Q ss_pred             hhHHHHHHHHHHcCCchHHHHHHHHHHhcCCCCC-CHhHHHHHHHHHHccCChHHHHHHHHHHHHcCCCCchhHHHHHHH
Q 047120          313 VACNAMMGGYVRNGYSMKALEIFDNMQCELYLHP-DDASLVIVLSAIAQLGHIDKGVAIHRYLEKDQFSLNGKHGVALID  391 (634)
Q Consensus       313 ~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~p-~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~  391 (634)
                      .............+....+...+......   .| +...+..+...+...|+++.|...+..+.+.. +.+...+..+..
T Consensus       136 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~  211 (388)
T d1w3ba_         136 CVRSDLGNLLKALGRLEEAKACYLKAIET---QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGN  211 (388)
T ss_dssp             HHHHHHHHHHHTTSCHHHHHHHHHHHHHH---CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHH
T ss_pred             cccccccccccccchhhhhHHHHHHhhcc---CcchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhh
Confidence            45555666677778888888888877744   34 44667777788888999999999998888754 445678888899


Q ss_pred             HhHhcCCHHHHHHHHHhcc---CCChhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHhccCCHHH
Q 047120          392 MYSKCGSIENAIKVFEQIE---DGSVDHWNAMINGLAIHGLGELAFDLLMEMERLSIEPD-DITFTGLLNACAHAGLVKE  467 (634)
Q Consensus       392 ~~~~~~~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~g~~p~-~~~~~~ll~~~~~~g~~~~  467 (634)
                      .+...|++++|...+++..   ..+...+..+...+.+.|++++|+..|++..+.  .|+ ..++..+...+...|++++
T Consensus       212 ~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~~~~~  289 (388)
T d1w3ba_         212 VLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANALKEKGSVAE  289 (388)
T ss_dssp             HHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHHHHHHSCHHH
T ss_pred             hhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHH
Confidence            9999999999999998765   346667888999999999999999999999875  555 5688899999999999999


Q ss_pred             HHHHHHHhHHhcCcccChhHHHHHHHHHhccCCHHHHHHHHHhC-CCCCC-HHHHHHHHHHHHhcCChhHHHHHHHHHhc
Q 047120          468 GLLCFELMRRIHKLEPELQHYGCMVDILGRAGHIEAARNLIEDM-PMEPN-DVIWRTLLSACRNYENLNVGEPVAKHLIG  545 (634)
Q Consensus       468 a~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~-~~~p~-~~~~~~l~~~~~~~g~~~~a~~~~~~~~~  545 (634)
                      |...++.+...  .+.+...+..+...+.+.|++++|++.++++ ...|+ ..++..+...+...|++++|+..++++++
T Consensus       290 A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  367 (388)
T d1w3ba_         290 AEDCYNTALRL--CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR  367 (388)
T ss_dssp             HHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT
T ss_pred             HHHHHHhhhcc--CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence            99999998773  3456677889999999999999999999986 55665 66888899999999999999999999999


Q ss_pred             cCCCCCchHHHHHHHHhcCCC
Q 047120          546 MDSSNSSSYVLLSNMFAGLGM  566 (634)
Q Consensus       546 ~~p~~~~~~~~l~~~~~~~g~  566 (634)
                      ++|.++.+|..++.+|.+.|+
T Consensus       368 l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         368 ISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             TCTTCHHHHHHHHHHHHHTCC
T ss_pred             hCCCCHHHHHHHHHHHHHcCC
Confidence            999999999999999998885



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure