Citrus Sinensis ID: 047185
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| 255575744 | 315 | DNA binding protein, putative [Ricinus c | 0.934 | 0.634 | 0.632 | 5e-60 | |
| 224138024 | 314 | predicted protein [Populus trichocarpa] | 0.925 | 0.630 | 0.623 | 7e-60 | |
| 388496118 | 303 | unknown [Medicago truncatula] | 0.892 | 0.630 | 0.590 | 2e-56 | |
| 357519859 | 349 | DnaJ homolog subfamily C member [Medicag | 0.892 | 0.547 | 0.590 | 2e-56 | |
| 356512815 | 303 | PREDICTED: uncharacterized protein LOC10 | 0.813 | 0.574 | 0.627 | 5e-55 | |
| 449461543 | 309 | PREDICTED: dnaJ homolog subfamily C memb | 0.897 | 0.621 | 0.537 | 2e-51 | |
| 225427302 | 299 | PREDICTED: uncharacterized protein LOC10 | 0.728 | 0.521 | 0.621 | 9e-50 | |
| 296087952 | 255 | unnamed protein product [Vitis vinifera] | 0.757 | 0.635 | 0.608 | 9e-50 | |
| 18422552 | 309 | duplicated SANT DNA-binding domain-conta | 0.677 | 0.469 | 0.621 | 1e-48 | |
| 9758732 | 352 | unnamed protein product [Arabidopsis tha | 0.677 | 0.411 | 0.621 | 2e-48 |
| >gi|255575744|ref|XP_002528771.1| DNA binding protein, putative [Ricinus communis] gi|223531774|gb|EEF33593.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 236 bits (602), Expect = 5e-60, Method: Compositional matrix adjust.
Identities = 131/207 (63%), Positives = 153/207 (73%), Gaps = 7/207 (3%)
Query: 12 KNRSLANKSPDFIPGSVPIVENSNGSIGNESKGE---KVEVLQRKSEEEKEWNEEDIEIL 68
K RS +S + + GS P+VE +NG E K E K E +E EKEWNEED+EIL
Sbjct: 112 KKRSKQIRSEETVMGSAPVVETTNGLSIKERKIEPLTKSENWVVANEVEKEWNEEDLEIL 171
Query: 69 KKQMVKNPVGKPKRWEVIAEAFNGRHRVESVIKKAKELGEKKIDDSDSYNQFLKNRKAID 128
KKQMVKNPVGKP+RWEVIAEAF GRH+VESVIK AKE+GE+K+DD+DSY +FLKNRK +D
Sbjct: 172 KKQMVKNPVGKPRRWEVIAEAFKGRHKVESVIKMAKEMGERKLDDNDSYARFLKNRKPLD 231
Query: 129 MRVVQENCEDSKKESQENVVVGGGGGV-WNAGEDIALLNALKAFPKDVPLRWEKIAAAVP 187
R E S ES GGV WNA EDIALLNALKAFPKD+P+RWEKIAAAVP
Sbjct: 232 TRA---QAEISGIESGAEARKDNDGGVGWNAVEDIALLNALKAFPKDIPMRWEKIAAAVP 288
Query: 188 GRSKAACMKRFSDLKRDFRSSKAGDEA 214
+SKAACMKR ++LK+DFRSSKA E+
Sbjct: 289 TKSKAACMKRIAELKKDFRSSKAAAES 315
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224138024|ref|XP_002326499.1| predicted protein [Populus trichocarpa] gi|222833821|gb|EEE72298.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388496118|gb|AFK36125.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357519859|ref|XP_003630218.1| DnaJ homolog subfamily C member [Medicago truncatula] gi|357519879|ref|XP_003630228.1| DnaJ homolog subfamily C member [Medicago truncatula] gi|355524240|gb|AET04694.1| DnaJ homolog subfamily C member [Medicago truncatula] gi|355524250|gb|AET04704.1| DnaJ homolog subfamily C member [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356512815|ref|XP_003525111.1| PREDICTED: uncharacterized protein LOC100780658 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449461543|ref|XP_004148501.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Cucumis sativus] gi|449510794|ref|XP_004163760.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225427302|ref|XP_002279131.1| PREDICTED: uncharacterized protein LOC100255727 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296087952|emb|CBI35235.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|18422552|ref|NP_568645.1| duplicated SANT DNA-binding domain-containing protein [Arabidopsis thaliana] gi|13605893|gb|AAK32932.1|AF367345_1 AT5g45420/MFC19_9 [Arabidopsis thaliana] gi|18491137|gb|AAL69537.1| AT5g45420/MFC19_9 [Arabidopsis thaliana] gi|26450023|dbj|BAC42132.1| unknown protein [Arabidopsis thaliana] gi|332007865|gb|AED95248.1| duplicated SANT DNA-binding domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|9758732|dbj|BAB09170.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| TAIR|locus:2163573 | 309 | maMYB "membrane anchored MYB" | 0.649 | 0.449 | 0.636 | 2.2e-43 | |
| UNIPROTKB|Q6P2Y3 | 620 | dnajc2 "DnaJ homolog subfamily | 0.640 | 0.220 | 0.368 | 1e-14 | |
| UNIPROTKB|F1P3V8 | 621 | DNAJC2 "Uncharacterized protei | 0.640 | 0.220 | 0.349 | 2.2e-14 | |
| UNIPROTKB|Q99543 | 621 | DNAJC2 "DnaJ homolog subfamily | 0.640 | 0.220 | 0.349 | 7.6e-14 | |
| UNIPROTKB|Q4R8H2 | 621 | DNAJC2 "DnaJ homolog subfamily | 0.640 | 0.220 | 0.349 | 7.6e-14 | |
| UNIPROTKB|Q1RMH9 | 621 | DNAJC2 "DnaJ homolog subfamily | 0.640 | 0.220 | 0.349 | 9.7e-14 | |
| UNIPROTKB|F1SB54 | 621 | DNAJC2 "Uncharacterized protei | 0.640 | 0.220 | 0.349 | 9.7e-14 | |
| UNIPROTKB|E2RS54 | 627 | DNAJC2 "Uncharacterized protei | 0.640 | 0.218 | 0.349 | 9.9e-14 | |
| RGD|620524 | 621 | Dnajc2 "DnaJ (Hsp40) homolog, | 0.640 | 0.220 | 0.349 | 1.2e-13 | |
| MGI|MGI:99470 | 621 | Dnajc2 "DnaJ (Hsp40) homolog, | 0.640 | 0.220 | 0.342 | 2.6e-13 |
| TAIR|locus:2163573 maMYB "membrane anchored MYB" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 458 (166.3 bits), Expect = 2.2e-43, P = 2.2e-43
Identities = 91/143 (63%), Positives = 109/143 (76%)
Query: 67 ILKKQMVKNPVGKPKRWEVIAEAFNGRHRVESVIKKAKELGEKKIDDSDSYNQFLKNRKA 126
ILKKQ++K+P GKP RWE +A AF GR++ E+VIKKAKE+GEKKI +SD Y QFLKNRKA
Sbjct: 167 ILKKQLIKHPAGKPGRWETVASAFGGRYKTENVIKKAKEIGEKKIYESDDYAQFLKNRKA 226
Query: 127 IDMRVVQENCEDSKKESQENXXXXXXXXXWNAGEDIALLNALKAFPKDVPLRWEKIAAAV 186
D R+V EN E+S W+ GEDIALLNALKAFPK+ +RWEKIAAAV
Sbjct: 227 SDPRLVDENEENSGAGGDAEGTKEI----WSNGEDIALLNALKAFPKEAAMRWEKIAAAV 282
Query: 187 PGRSKAACMKRFSDLKRDFRSSK 209
PG+SKAACMKR ++LK+ FRSSK
Sbjct: 283 PGKSKAACMKRVTELKKGFRSSK 305
|
|
| UNIPROTKB|Q6P2Y3 dnajc2 "DnaJ homolog subfamily C member 2" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3V8 DNAJC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q99543 DNAJC2 "DnaJ homolog subfamily C member 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R8H2 DNAJC2 "DnaJ homolog subfamily C member 2" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1RMH9 DNAJC2 "DnaJ homolog subfamily C member 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SB54 DNAJC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RS54 DNAJC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|620524 Dnajc2 "DnaJ (Hsp40) homolog, subfamily C, member 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:99470 Dnajc2 "DnaJ (Hsp40) homolog, subfamily C, member 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0029014701 | hypothetical protein (314 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 7e-05 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 1e-04 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 3e-04 |
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
Score = 38.7 bits (91), Expect = 7e-05
Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%)
Query: 153 GGVWNAGEDIALLNALKAFPKDVPLRWEKIAAAVPGRSKAACMKRFSDLKR 203
G W ED L+ +K + K+ WEKIA +PGR+ C +R+ +L +
Sbjct: 1 KGEWTEEEDELLIELVKKYGKN---NWEKIAKELPGRTAEQCRERWRNLLK 48
|
Length = 49 |
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.9 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.88 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.86 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.82 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.38 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 99.32 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.32 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.25 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.19 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.16 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.05 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 99.04 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 98.94 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.88 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 98.86 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 98.77 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.76 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 98.56 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 98.55 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 97.92 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.9 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.81 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.62 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.52 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 97.49 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.34 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 97.29 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.27 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 97.15 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 97.05 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 97.04 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 97.0 | |
| PF13325 | 199 | MCRS_N: N-terminal region of micro-spherule protei | 96.38 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 96.37 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 96.34 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 95.77 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 95.09 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 95.07 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 94.99 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 94.19 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 94.0 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 93.89 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 92.94 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 92.12 | |
| KOG2656 | 445 | consensus DNA methyltransferase 1-associated prote | 91.18 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 91.04 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 90.44 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 90.42 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 89.75 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 89.48 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 89.07 | |
| smart00595 | 89 | MADF subfamily of SANT domain. | 87.93 | |
| KOG3841 | 455 | consensus TEF-1 and related transcription factor, | 87.19 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 85.37 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 84.63 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 84.05 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 83.96 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 83.77 | |
| KOG2656 | 445 | consensus DNA methyltransferase 1-associated prote | 83.58 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 83.58 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 83.09 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 82.34 | |
| PF10545 | 85 | MADF_DNA_bdg: Alcohol dehydrogenase transcription | 82.31 |
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
Probab=99.90 E-value=3.6e-23 Score=198.60 Aligned_cols=162 Identities=20% Similarity=0.291 Sum_probs=129.4
Q ss_pred ccccCCCcCCCCchhhhHhhhhhc----cCCCCCCHHHHHHHHHHHHhCCCCCCcchhhHHHHcCCCCCHHHHHHHHHH-
Q 047185 31 VENSNGSIGNESKGEKVEVLQRKS----EEEKEWNEEDIEILKKQMVKNPVGKPKRWEVIAEAFNGRHRVESVIKKAKE- 105 (214)
Q Consensus 31 ~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~WT~EE~~lL~kav~kyP~Gt~~RWe~IA~~lg~~RT~~qc~~k~k~- 105 (214)
..|||+||+|.++..++++||+|+ .++..|+.||++.|..+..-+ |. ..|++||..||++|+..||+.+++.
T Consensus 223 ~~ISn~dfEgsrS~~~~~~~W~n~l~P~~nk~~WS~EE~E~L~AiA~A~--~~-~~W~~IA~~Lgt~RS~yQC~~kF~t~ 299 (939)
T KOG0049|consen 223 TAISNFDFEGSRSEWAVKSKWYNELNPKWNKEHWSNEEVEKLKALAEAP--KF-VSWPMIALNLGTNRSSYQCMEKFKTE 299 (939)
T ss_pred HHhccccccccCCHHHHHHHHhhhcCCccchhccChHHHHHHHHHHhcc--cc-ccHHHHHHHhCCCcchHHHHHHHHHH
Confidence 349999999999999999999999 689999999999998877665 33 5899999999988999999999975
Q ss_pred ---hhhcccCCchhHHHHhhhhcccchhhhhc-------ccccccc-----ccccccc-CCCCCCCCCHHHHHHHHHHHH
Q 047185 106 ---LGEKKIDDSDSYNQFLKNRKAIDMRVVQE-------NCEDSKK-----ESQENVV-VGGGGGVWNAGEDIALLNALK 169 (214)
Q Consensus 106 ---l~~~~~~~~~~~~~~l~~~~~l~~r~~~~-------~~~~~~s-----~~~~~~~-~~~~~~~WT~eED~~L~~al~ 169 (214)
|++..|. +..|..|... +..+++.++ +++++.+ ++++.++ +++++++||.+||.+|..|+.
T Consensus 300 ~~~L~ekeWs--EEed~kL~al-V~~~~~nShI~w~kVV~Ympgr~~~qLI~R~~~~LdPsikhg~wt~~ED~~L~~AV~ 376 (939)
T KOG0049|consen 300 VSQLSEKEWS--EEEDTKLIAL-VKITSINSHIQWDKVVQYMPGRTRQQLITRFSHTLDPSVKHGRWTDQEDVLLVCAVS 376 (939)
T ss_pred HHHHHhhhcc--hhhhHHHHHH-HHHhhccCccchHHHHHhcCCcchhhhhhhheeccCccccCCCCCCHHHHHHHHHHH
Confidence 5555563 3444555443 112333222 2333322 5677664 789999999999999999999
Q ss_pred hCCCCCCCcHHHHHhhCCCCCHHHHHHHHHHH
Q 047185 170 AFPKDVPLRWEKIAAAVPGRSKAACMKRFSDL 201 (214)
Q Consensus 170 ~~p~~~~~rW~kIA~~vPGRT~~qc~~Ry~~L 201 (214)
+|+. ..|.+|-..|||||+.||+.||...
T Consensus 377 ~Yg~---kdw~k~R~~vPnRSdsQcR~RY~nv 405 (939)
T KOG0049|consen 377 RYGA---KDWAKVRQAVPNRSDSQCRERYTNV 405 (939)
T ss_pred HhCc---cchhhHHHhcCCccHHHHHHHHHHH
Confidence 9974 8999999999999999999999763
|
|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PF13325 MCRS_N: N-terminal region of micro-spherule protein | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >smart00595 MADF subfamily of SANT domain | Back alignment and domain information |
|---|
| >KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
| >PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 214 | ||||
| 2m2e_A | 73 | Solution Nmr Structure Of The Sant Domain Of Human | 2e-09 |
| >pdb|2M2E|A Chain A, Solution Nmr Structure Of The Sant Domain Of Human Dnajc2, Northeast Structural Genomics Consortium Target Hr8254a Length = 73 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 3e-16 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 5e-14 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 3e-04 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 2e-13 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 1e-12 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 1e-04 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 4e-06 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 5e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-06 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 4e-04 |
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 | Back alignment and structure |
|---|
Score = 69.9 bits (171), Expect = 3e-16
Identities = 22/61 (36%), Positives = 31/61 (50%)
Query: 151 GGGGVWNAGEDIALLNALKAFPKDVPLRWEKIAAAVPGRSKAACMKRFSDLKRDFRSSKA 210
G G W+A E+ A AL + KD P RW +A AV GR+ K + L D + ++
Sbjct: 6 GSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIES 65
Query: 211 G 211
G
Sbjct: 66 G 66
|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.94 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.93 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.93 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.93 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.92 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.9 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.87 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.72 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.72 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.64 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.62 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.6 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.57 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.53 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 99.52 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.52 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.52 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.49 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.49 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.48 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.47 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.46 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.46 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.44 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.42 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.42 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.38 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.38 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.38 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.37 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.37 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.35 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 99.34 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.34 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.3 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.26 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.91 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.24 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.24 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.22 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.21 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.19 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.18 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.18 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.15 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.14 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.12 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.12 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.1 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.07 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.05 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.03 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.03 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 98.97 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 98.96 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 98.9 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 98.87 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 98.86 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 98.83 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.83 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 98.81 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 98.8 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 98.8 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.23 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 98.66 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 98.6 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.57 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.53 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 98.42 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.35 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 98.32 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.31 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 98.28 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.26 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 97.57 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 98.24 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.12 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.1 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.09 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 98.05 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 97.95 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 97.7 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.66 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.53 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.41 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 97.35 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.31 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 97.13 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 95.92 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 96.87 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 96.79 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 96.4 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 95.88 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 94.24 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 94.1 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 90.46 |
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
Probab=99.94 E-value=1.8e-26 Score=176.93 Aligned_cols=103 Identities=17% Similarity=0.263 Sum_probs=91.2
Q ss_pred CCCCCHHHHHHHHHHHHhCCCCCCcchhhHHHHcCCCCCHHHHHHHHHHhhhcccCCchhHHHHhhhhcccchhhhhccc
Q 047185 57 EKEWNEEDIEILKKQMVKNPVGKPKRWEVIAEAFNGRHRVESVIKKAKELGEKKIDDSDSYNQFLKNRKAIDMRVVQENC 136 (214)
Q Consensus 57 ~~~WT~EE~~lL~kav~kyP~Gt~~RWe~IA~~lg~~RT~~qc~~k~k~l~~~~~~~~~~~~~~l~~~~~l~~r~~~~~~ 136 (214)
++.||.|||.+|.++|.+||. .+|..||.+|+ +||+.||.++|..++ +|
T Consensus 1 K~~Wt~eED~~L~~~v~~~g~---~~W~~Ia~~~~-~Rt~~qcr~Rw~~~L--------------------~p------- 49 (107)
T 2k9n_A 1 KVKFTEEEDLKLQQLVMRYGA---KDWIRISQLMI-TRNPRQCRERWNNYI--------------------NP------- 49 (107)
T ss_dssp CCSSCHHHHHHHHHHHHHHCS---SCHHHHHHHTT-TSCHHHHHHHHHHHS--------------------SS-------
T ss_pred CCCCCHHHHHHHHHHHHHHCC---CCHHHHhhhcC-CCCHHHHHHHHHHHH--------------------cc-------
Confidence 478999999999999999953 58999999998 799999999997653 23
Q ss_pred ccccccccccccCCCCCCCCCHHHHHHHHHHHHhCCCCCCCcHHHHHhhCCCCCHHHHHHHHHHHHHHHhc
Q 047185 137 EDSKKESQENVVVGGGGGVWNAGEDIALLNALKAFPKDVPLRWEKIAAAVPGRSKAACMKRFSDLKRDFRS 207 (214)
Q Consensus 137 ~~~~s~~~~~~~~~~~~~~WT~eED~~L~~al~~~p~~~~~rW~kIA~~vPGRT~~qc~~Ry~~L~~~v~~ 207 (214)
.+..++||+|||.+|+.++..|+ .+|..||.+|||||+.||++||..|.....+
T Consensus 50 -------------~i~~~~WT~eEd~~L~~~~~~~G----~~W~~Ia~~l~gRt~~~~k~rw~~l~r~~~~ 103 (107)
T 2k9n_A 50 -------------ALRTDPWSPEEDMLLDQKYAEYG----PKWNKISKFLKNRSDNNIRNRWMMIARHRAK 103 (107)
T ss_dssp -------------CCTTCCCCHHHHHHHHHHHHHTC----SCHHHHHHHHSSSCHHHHHHHHHHHHHHHHS
T ss_pred -------------cccccccCHHHHHHHHHHHHHhC----cCHHHHHHHCCCCCHHHHHHHHHHHHhhHHH
Confidence 47889999999999999999995 5999999999999999999999988766543
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 214 | ||||
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 1e-09 | |
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 3e-09 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 1e-09 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 2e-06 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 2e-04 |
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: DnaJ homolog subfamily C member 1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 50.2 bits (120), Expect = 1e-09
Identities = 17/54 (31%), Positives = 22/54 (40%), Gaps = 1/54 (1%)
Query: 156 WNAGEDIALLNALKAFPKDVPLRWEKIAAAVPGRSKAACMKRFSDLKRDFRSSK 209
W + L ++ FP P RWEKIA + GRS + LK S
Sbjct: 4 WTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL-GRSVTDVTTKAKQLKDSVTCSP 56
|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.75 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.67 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.65 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.57 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.52 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.52 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.51 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.46 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.41 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.38 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.32 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.31 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.31 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.27 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.26 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.25 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.22 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.22 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.13 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 99.12 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.11 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.09 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.06 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.03 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.02 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 98.94 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 98.93 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 98.81 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 98.72 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 98.53 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.46 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 98.29 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 98.25 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 97.95 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 96.75 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 96.01 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 95.6 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 95.39 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 94.98 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 94.21 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 91.93 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 91.68 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 84.91 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 81.23 |
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: Radialis species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]
Probab=99.75 E-value=9.6e-19 Score=121.12 Aligned_cols=58 Identities=34% Similarity=0.595 Sum_probs=55.7
Q ss_pred CCCCHHHHHHHHHHHHhCCCCCCCcHHHHHhhCCCCCHHHHHHHHHHHHHHHhchhcc
Q 047185 154 GVWNAGEDIALLNALKAFPKDVPLRWEKIAAAVPGRSKAACMKRFSDLKRDFRSSKAG 211 (214)
Q Consensus 154 ~~WT~eED~~L~~al~~~p~~~~~rW~kIA~~vPGRT~~qc~~Ry~~L~~~v~~~k~~ 211 (214)
.+||++||.+|+.||..|+.+.+++|.+||..|||||..||++||+.|.++|+.++++
T Consensus 2 ~~WT~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~gRt~~qc~~r~~~L~~dik~iesg 59 (63)
T d2cjja1 2 RPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESG 59 (63)
T ss_dssp CSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHS
T ss_pred cCCCHHHHHHHHHHHHHHCCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHHhhccccC
Confidence 5899999999999999999988889999999999999999999999999999999876
|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|