>gi|224077554|ref|XP_002305300.1| predicted protein [Populus trichocarpa] gi|224077558|ref|XP_002305301.1| predicted protein [Populus trichocarpa] gi|222848264|gb|EEE85811.1| predicted protein [Populus trichocarpa] gi|222848265|gb|EEE85812.1| predicted protein [Populus trichocarpa]
>gi|15240998|ref|NP_198692.1| Late embryogenesis abundant protein (LEA) family protein [Arabidopsis thaliana] gi|10176901|dbj|BAB10133.1| pollen coat protein-like [Arabidopsis thaliana] gi|91806948|gb|ABE66201.1| unknown [Arabidopsis thaliana] gi|111074248|gb|ABH04497.1| At5g38760 [Arabidopsis thaliana] gi|332006974|gb|AED94357.1| Late embryogenesis abundant protein (LEA) family protein [Arabidopsis thaliana]
>gi|224075477|ref|XP_002335853.1| predicted protein [Populus trichocarpa] gi|224077548|ref|XP_002305297.1| predicted protein [Populus trichocarpa] gi|224077562|ref|XP_002305303.1| predicted protein [Populus trichocarpa] gi|222835948|gb|EEE74369.1| predicted protein [Populus trichocarpa] gi|222848261|gb|EEE85808.1| predicted protein [Populus trichocarpa] gi|222848267|gb|EEE85814.1| predicted protein [Populus trichocarpa]
Score = 92 (37.4 bits), Expect = 0.00013, P = 0.00013
Identities = 23/61 (37%), Positives = 36/61 (59%)
Query: 6 QKMSYQAGEAKGQAQEKANTMMDKAGNAAQSAKDSMNQAGEQVKAKAQGAADSVKNATGM 65
++ S +AG+ GQA K N N++Q A + Q GE+VK+ A A+++VKN G+
Sbjct: 7 EEFSVRAGQIVGQAHVKEND----CNNSSQ-ASGFLQQKGEKVKSMAHDASEAVKNKLGI 61
Query: 66 N 66
N
Sbjct: 62 N 62
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.296 0.107 0.265 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 67 67 0.00091 102 3 10 24 0.38 29
29 0.49 28
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 9
No. of states in DFA: 397 (42 KB)
Total size of DFA: 82 KB (2067 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 11.25u 0.11s 11.36t Elapsed: 00:00:01
Total cpu time: 11.25u 0.11s 11.36t Elapsed: 00:00:01
Start: Sat May 11 04:46:07 2013 End: Sat May 11 04:46:08 2013
>PF02987 LEA_4: Late embryogenesis abundant protein; InterPro: IPR004238 Different types of late embryogenesis abundant (LEA) proteins are expressed at different stages of late embryogenesis in higher plant seed embryos and under conditions of dehydration stress
The function of these proteins is unknown. This entry represents a repeat characteristic of some LEA proteins, including LEA3 [, ].
>PF02987 LEA_4: Late embryogenesis abundant protein; InterPro: IPR004238 Different types of late embryogenesis abundant (LEA) proteins are expressed at different stages of late embryogenesis in higher plant seed embryos and under conditions of dehydration stress
>PF05957 DUF883: Bacterial protein of unknown function (DUF883); InterPro: IPR010279 This family consists of several bacterial proteins of unknown function that include the Escherichia coli genes for ElaB, YgaM and YqjD