Citrus Sinensis ID: 047386

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-

MEDLNDYTIIKEGEAEILMHAKNEVFYNKTQVNNRDISIAVMRAFISKRNQEHEAMLSKRTTSAPKASEKDGEEEAPDESVVNENSNGEIERPAEISQDEPCCISEEAVKPTERNVLRQLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNIKFNGSVACSKVESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGNGEVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTSASAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSLHNLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVKNHPVKAQLPDQPGSVILAKEPTLQANFARAVASLSKAQAKKVARFLPNPEKHWGPKPRAGRQITSKHISLLGAEAVNGHLSLEDGEEPDAKRQKTEDTTQKTEDATPSS

cccccccEEEEEEcEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHccccHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHcccccccEEEEcHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHcccEEEEEEEccccccccccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccEEEEEEEEEccHHHHHcccccccEEEEccccccEEEEccccccccccccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccEEHHHHHHHcccccccHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccHHHHccccccccccccHHHHccccHHHcccccccccc

cccccccEEEEEccEEEEEcccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEcccccccccccccccccHcccccccccccHHHHccHHHcHcccccccHHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHcccccccEEEccHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHcccEEEEEEccHHHHcccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEEEEEEEEccHHHHHHHHHccEEEEEEcccccEEEEEccEEEccccccEEEccccccccccccHHccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccEEEcHHHHHHHcccccccHHHHHHHHHHcccEEEccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHcccccEEEEccccccccHHHHHHccEEccccccccccccccccccccccccHHccHHHHHcccccccccccHHHHccccccccccccccccc

medlndytIIKEGEAEILMHAKNEvfynktqvnnrDISIAVMRAFISKRNQEHEAMLskrttsapkasekdgeeeapdesvvnensngeierpaeisqdepcciseeavkpternvlrqlkpprVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNIKFNGSVACSKVESHLADARVYMlthpkefdvvdldpygspsvfldSAIQSVADGGMLMCTATDMAvlcggngevcyskygsyplrgkyCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTSasamkstplKLSYVYqcigcdsfhlqpvgrtasnknnsvrylpgfgpvvpqlcsdcgkkfnmggpiwsgrihdqEWVNSILGEVksmkdrypayDRISAVLTTIseelpdvplflSLHNlcstlkctspsavMFRSAVINagyrvsgthvnplglktdapmgVIWDIMRCwvknhpvkaqlpdqpgsvilakeptlQANFARAVASLSKAQAKKVARflpnpekhwgpkpragrqiTSKHISLLGAEavnghlsledgeepdakrqktedttqktedatpss

MEDLNDYTIIKEGEAEILMHAKNEVFynktqvnnrDISIAVMRAFISKRNQEHEamlskrttsapkasekdgeeeapdesvvnensngeierpaeisqdepCCISEeavkpternvlrqlkpprvLEALSASGLRALRYAREVEGIgqvvaldndkASVEACRRNIkfngsvacsKVESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGNGEVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTsasamkstPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSLHNLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVKNHPVKAQLPDQPGSVILAKEPTLQANFARAVASLSKAQAKKVArflpnpekhwgpkpragrQITSKHISLLGAEAVNGHLsledgeepdakrqktedttqktedatpss

******YTIIKEGEAEILMHAKNEVFYNKTQVNNRDISIAVMRAFI******************************************************************************VLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNIKFNGSVACSKVESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGNGEVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTSASAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSLHNLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVKNHPVKAQL*****SVILAKEPTLQANFARAV******************************************************************************

*****DY*IIKEGEAEILMHAKNEVFYNKTQVNNRDISIAVMRAFISKRNQEHE*******************************************QDEPCCISEEAVKPTERNVLRQLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNIKFNGSVACSKVESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGNGEVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTSASAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSLHNLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVK*************SVILAKEPTLQANF*****************FLPNPEKHWG*******************************************************

MEDLNDYTIIKEGEAEILMHAKNEVFYNKTQVNNRDISIAVMRAFISKRN***************************************IERPAEISQDEPCCISEEAVKPTERNVLRQLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNIKFNGSVACSKVESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGNGEVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTSASAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSLHNLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVKNHPVKAQLPDQPGSVILAKEPTLQANFARA**********KVARFLPNPEKHWGPKPRAGRQITSKHISLLGAEAVNGHLSLE**************************

****NDYTIIKEGEAEILMHAKNEVFYNKTQVNNRDISIAVMRAFISKRNQEHEAMLS**************EEEA***********GEIER**********************N**RQLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNIKFNGSVACSKVESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGNGEVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTSASAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSLHNLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVKNHPVKAQLPDQPGSVILAKEPTLQANFARAVASLSKAQAKKVARFLPNPEKHWGPK*****************************************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		581	2.2.26 [Sep-21-2011]
Q9SRU7		589	Probable tRNA (guanine(26	yes	no	0.936	0.923	0.796	0.0
Q9LFU5		593	Probable tRNA (guanine(26	no	no	0.939	0.920	0.792	0.0
Q3TX08		663	tRNA (guanine(26)-N(2))-d	yes	no	0.850	0.745	0.420	1e-117
Q9NXH9		659	tRNA (guanine(26)-N(2))-d	yes	no	0.862	0.760	0.410	1e-113
Q9VK89		578	Probable tRNA (guanine(26	yes	no	0.912	0.916	0.396	1e-107
Q23270		526	tRNA (guanine(26)-N(2))-d	yes	no	0.831	0.918	0.373	4e-90
Q9P804		548	tRNA (guanine(26)-N(2))-d	yes	no	0.872	0.925	0.346	3e-89
P15565		570	tRNA (guanine(26)-N(2))-d	yes	no	0.862	0.878	0.320	3e-74
O27258		380	tRNA (guanine(26)-N(2))-d	yes	no	0.550	0.842	0.320	2e-46
Q2NI56		390	tRNA (guanine(26)-N(2))-d	yes	no	0.542	0.807	0.285	3e-46

>sp\|Q9SRU7\|TRM2_ARATH Probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 OS=Arabidopsis thaliana GN=At3g02320 PE=2 SV=3	Back alignment and function desciption

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/555 (79%), Positives = 483/555 (87%), Gaps = 11/555 (1%)

Query: 3   DLNDYTIIKEGEAEILMHAKNEVFYNKTQVNNRDISIAVMRAFISKRNQEHEAMLSKRTT 62
           DLNDYT+IKEGEAEILMH KN+VF+NK QVNNRD+SIAV+R F+SKR QEHEA  SKRT 
Sbjct: 4   DLNDYTVIKEGEAEILMHKKNQVFFNKAQVNNRDMSIAVLREFLSKRKQEHEAKSSKRTR 63

Query: 63  SAPKASEKDG----EEEAPDESVVNENSNGEIERPAEISQDEPCCISEEAVKPTERNVLR 118
            A K  EKD     +EE P E+ +N   NG+ E  +E   D P  +S++  K TER   R
Sbjct: 64  PASKVIEKDASEASKEETPSENGMN---NGDHEVASE---DGPSSVSKDPAKTTERFAPR 117

Query: 119 QLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNIKFNGSVACSKVE 178
           + KPP+VLEALSASGLRALRYARE+EGIGQVVALDND ASVEAC+RNIKFNGSVA SKVE
Sbjct: 118 EPKPPKVLEALSASGLRALRYAREIEGIGQVVALDNDLASVEACQRNIKFNGSVAISKVE 177

Query: 179 SHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGNG 238
           SH  DARV+MLTHPKEFDVVDLDPYGSPS+FLDSAIQSV DGG+LMCTATDMAVLCGGNG
Sbjct: 178 SHHTDARVHMLTHPKEFDVVDLDPYGSPSIFLDSAIQSVTDGGLLMCTATDMAVLCGGNG 237

Query: 239 EVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYT 298
           EVCYSKYGSYPLR KYCHEMALRILLA IESHANRYKRYI PVLSVQMDFYVRVFVR+YT
Sbjct: 238 EVCYSKYGSYPLRAKYCHEMALRILLASIESHANRYKRYIVPVLSVQMDFYVRVFVRVYT 297

Query: 299 SASAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKK 358
           SASAMK+TPLKLSYVYQCIGCDSFHLQPVGR+   KNNSVRYLP  GPVV Q C+ CGKK
Sbjct: 298 SASAMKNTPLKLSYVYQCIGCDSFHLQPVGRSLP-KNNSVRYLPAIGPVVKQDCNHCGKK 356

Query: 359 FNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSLHN 418
           +NMGGPIWS  +HD EWV SIL  VKSMKDRYPAYDRISAVLTT+SEEL DVPLFLSLHN
Sbjct: 357 YNMGGPIWSAPMHDPEWVTSILNSVKSMKDRYPAYDRISAVLTTVSEELLDVPLFLSLHN 416

Query: 419 LCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVKNHPVKA 478
           LC+TLKC SPSA MFRSAVINA YR+SGTHVNPLG+KTDAPM VIWDIMRCWVKNHP+KA
Sbjct: 417 LCATLKCISPSAAMFRSAVINANYRISGTHVNPLGMKTDAPMEVIWDIMRCWVKNHPIKA 476

Query: 479 QLPDQPGSVILAKEPTLQANFARAVASLSKAQAKKVARFLPNPEKHWGPKPRAGRQITSK 538
           Q P+QPGSVIL+KEP+ + +F+R + SLSKAQAKKVARFLPNPEKHWGPK RAGRQITSK
Sbjct: 477 QSPEQPGSVILSKEPSHEVDFSRHIGSLSKAQAKKVARFLPNPEKHWGPKLRAGRQITSK 536

Query: 539 HISLLGAEAVNGHLS 553
           H+SL+G EAVNGHLS
Sbjct: 537 HVSLIGHEAVNGHLS 551

Dimethylates a single guanine residue at position 26 of most tRNAs using S-adenosyl-L-methionine as donor of the methyl groups.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 1EC: 6

>sp\|Q9LFU5\|TRM1_ARATH Probable tRNA (guanine(26)-N(2))-dimethyltransferase 1 OS=Arabidopsis thaliana GN=At5g15810 PE=2 SV=3	Back alignment and function description

>sp\|Q3TX08\|TRM1_MOUSE tRNA (guanine(26)-N(2))-dimethyltransferase OS=Mus musculus GN=Trmt1 PE=1 SV=2	Back alignment and function description

>sp\|Q9NXH9\|TRM1_HUMAN tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens GN=TRMT1 PE=1 SV=1	Back alignment and function description

>sp\|Q9VK89\|TRM1_DROME Probable tRNA (guanine(26)-N(2))-dimethyltransferase OS=Drosophila melanogaster GN=CG6388 PE=2 SV=1	Back alignment and function description

>sp\|Q23270\|TRM1_CAEEL tRNA (guanine(26)-N(2))-dimethyltransferase OS=Caenorhabditis elegans GN=trm-1 PE=1 SV=1	Back alignment and function description

>sp\|Q9P804\|TRM1_SCHPO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm1 PE=1 SV=1	Back alignment and function description

>sp\|P15565\|TRM1_YEAST tRNA (guanine(26)-N(2))-dimethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM1 PE=1 SV=1	Back alignment and function description

>sp\|O27258\|TRM1_METTH tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trm1 PE=3 SV=1	Back alignment and function description

>sp\|Q2NI56\|TRM1_METST tRNA (guanine(26)-N(2))-dimethyltransferase OS=Methanosphaera stadtmanae (strain DSM 3091) GN=trm1 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		581
224080223		582	predicted protein [Populus trichocarpa]	0.984	0.982	0.840	0.0
225451808		579	PREDICTED: probable N(2),N(2)-dimethylgu	0.972	0.975	0.851	0.0
224120786		583	predicted protein [Populus trichocarpa]	0.979	0.975	0.831	0.0
356573625		645	PREDICTED: probable N(2),N(2)-dimethylgu	0.977	0.880	0.828	0.0
356573623		638	PREDICTED: probable N(2),N(2)-dimethylgu	0.967	0.880	0.827	0.0
356551281		582	PREDICTED: probable N(2),N(2)-dimethylgu	0.958	0.957	0.807	0.0
449447430		581	PREDICTED: probable tRNA (guanine(26)-N(	0.974	0.974	0.809	0.0
79386788		589	putative N(2),N(2)-dimethylguanosine tRN	0.936	0.923	0.796	0.0
51968968		589	hypothetical protein [Arabidopsis thalia	0.936	0.923	0.796	0.0
297828680		589	RNA binding protein [Arabidopsis lyrata	0.974	0.960	0.775	0.0

>gi\|224080223\|ref\|XP_002306060.1\| predicted protein [Populus trichocarpa] gi\|222849024\|gb\|EEE86571.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score = 1006 bits (2600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/578 (84%), Positives = 522/578 (90%), Gaps = 6/578 (1%)

Query: 2   EDLNDYTIIKEGEAEILMHAKNEVFYNKTQVNNRDISIAVMRAFISKRNQEHEAMLSKRT 61
           EDL DYTIIKEGEA+ILM+ KN+VF+NK QVNNRD+SIAV+R FISKR +EHEAMLSKRT
Sbjct: 3   EDLQDYTIIKEGEADILMNVKNQVFFNKAQVNNRDLSIAVLRTFISKRQEEHEAMLSKRT 62

Query: 62  TSAPKASEKDG-----EEEAPDESVVNENSNGEIERPAEISQDEPCCISEEAVKPTERNV 116
            SA KASEKD      EE +   ++ NE SNGE E   EISQ+EPC ISEE+VK TE N 
Sbjct: 63  KSAKKASEKDASGPAVEEASTGSALDNEKSNGECEVHEEISQNEPCSISEESVKNTEGNH 122

Query: 117 LRQLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNIKFNGSVACSK 176
             +LKPP+VLEALSASGLRALRYAREVEGIG+VVALDNDKASVEAC++NIKFNGSVA SK
Sbjct: 123 HGELKPPKVLEALSASGLRALRYAREVEGIGKVVALDNDKASVEACQKNIKFNGSVAISK 182

Query: 177 VESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGG 236
           VESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSA+QSV DGGMLMCTATDMAVLCGG
Sbjct: 183 VESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAVQSVVDGGMLMCTATDMAVLCGG 242

Query: 237 NGEVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRI 296
           NGEVCYSKYGSYPLRGKYCHEMALRILLA IESHANRYKRYI PVLSVQM+FYVRVFVR+
Sbjct: 243 NGEVCYSKYGSYPLRGKYCHEMALRILLASIESHANRYKRYIVPVLSVQMNFYVRVFVRV 302

Query: 297 YTSASAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCG 356
           YTSASAMK+TPLKLSYVYQCIGCDS+HLQP+GRT S K +SVR+LPGFGPVVPQ CSDCG
Sbjct: 303 YTSASAMKNTPLKLSYVYQCIGCDSYHLQPIGRTMS-KGSSVRHLPGFGPVVPQECSDCG 361

Query: 357 KKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSL 416
           KK+NMGGPIWS  IHDQEWV S+L  VKSMKDRYPAYDRISAVLTTISEELPDVPLFLSL
Sbjct: 362 KKYNMGGPIWSAPIHDQEWVTSVLDGVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSL 421

Query: 417 HNLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVKNHPV 476
           HNLC+TLKCTSPSAV+FRSAVINAGYR+SGTHVNPLGLK+DAPM VIWDIMRCWVKNHPV
Sbjct: 422 HNLCATLKCTSPSAVIFRSAVINAGYRISGTHVNPLGLKSDAPMDVIWDIMRCWVKNHPV 481

Query: 477 KAQLPDQPGSVILAKEPTLQANFARAVASLSKAQAKKVARFLPNPEKHWGPKPRAGRQIT 536
           KAQ PDQPGS+ILAKEP LQANFARAVASLSKAQAKKVARFLPNPE+HWGPK RAGRQIT
Sbjct: 482 KAQAPDQPGSIILAKEPVLQANFARAVASLSKAQAKKVARFLPNPERHWGPKLRAGRQIT 541

Query: 537 SKHISLLGAEAVNGHLSLEDGEEPDAKRQKTEDTTQKT 574
           +KHISLLG EAVNGHL+ E+ EE  AKR KT DT   T
Sbjct: 542 TKHISLLGPEAVNGHLNHENSEETKAKRPKTGDTNDPT 579

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225451808\|ref\|XP_002281380.1\| PREDICTED: probable N(2),N(2)-dimethylguanosine tRNA methyltransferase 2 [Vitis vinifera] gi\|147815608\|emb\|CAN65976.1\| hypothetical protein VITISV_036159 [Vitis vinifera] gi\|298204459\|emb\|CBI16939.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224120786\|ref\|XP_002330951.1\| predicted protein [Populus trichocarpa] gi\|222873145\|gb\|EEF10276.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356573625\|ref\|XP_003554958.1\| PREDICTED: probable N(2),N(2)-dimethylguanosine tRNA methyltransferase 1-like isoform 2 [Glycine max]	Back alignment and taxonomy information

>gi\|356573623\|ref\|XP_003554957.1\| PREDICTED: probable N(2),N(2)-dimethylguanosine tRNA methyltransferase 1-like isoform 1 [Glycine max]	Back alignment and taxonomy information

>gi\|356551281\|ref\|XP_003544005.1\| PREDICTED: probable N(2),N(2)-dimethylguanosine tRNA methyltransferase 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|449447430\|ref\|XP_004141471.1\| PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase 2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|79386788|ref|NP_186881.2| putative N(2),N(2)-dimethylguanosine tRNA methyltransferase 2 [Arabidopsis thaliana] gi|209572713|sp|Q9SRU7.3|TRM2_ARATH RecName: Full=Probable tRNA (guanine(26)-N(2))-dimethyltransferase 2; AltName: Full=tRNA 2,2-dimethylguanosine-26 methyltransferase 2; AltName: Full=tRNA(guanine-26,N(2)-N(2)) methyltransferase 2; AltName: Full=tRNA(m(2,2)G26)dimethyltransferase 2 gi|332640271|gb|AEE73792.1| putative N(2),N(2)-dimethylguanosine tRNA methyltransferase 2 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|51968968\|dbj\|BAD43176.1\| hypothetical protein [Arabidopsis thaliana] gi\|51969038\|dbj\|BAD43211.1\| hypothetical protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297828680\|ref\|XP_002882222.1\| RNA binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297328062\|gb\|EFH58481.1\| RNA binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		581
TAIR\|locus:2074552		589	AT3G02320 [Arabidopsis thalian	0.981	0.967	0.774	3.2e-239
UNIPROTKB\|F1SD98		542	TRMT1 "Uncharacterized protein	0.697	0.747	0.478	5.6e-109
UNIPROTKB\|F6R277		662	TRMT1 "Uncharacterized protein	0.867	0.761	0.433	5.7e-107
UNIPROTKB\|E2QUE2		694	TRMT1 "Uncharacterized protein	0.867	0.726	0.433	9.2e-107
UNIPROTKB\|J9P9R4		637	TRMT1 "Uncharacterized protein	0.867	0.791	0.433	9.2e-107
UNIPROTKB\|Q9NXH9		659	TRMT1 "tRNA (guanine(26)-N(2))	0.869	0.766	0.424	1.6e-104
ZFIN\|ZDB-GENE-060810-40		672	trmt1 "tRNA methyltransferase	0.879	0.760	0.420	8.6e-104
FB\|FBgn0032430		578	CG6388 [Drosophila melanogaste	0.765	0.769	0.440	7.4e-103
MGI\|MGI:1289155		663	Trmt1 "tRNA methyltransferase	0.831	0.728	0.438	2e-102
DICTYBASE\|DDB_G0284575		604	DDB_G0284575 "N(2),N(2)-dimeth	0.786	0.756	0.401	2.5e-102

TAIR\|locus:2074552 AT3G02320 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2306 (816.8 bits), Expect = 3.2e-239, P = 3.2e-239
 Identities = 450/581 (77%), Positives = 497/581 (85%)

Query:     1 ME-DLNDYTIIKEGEAEILMHAKNEVFYNKTQVNNRDISIAVMRAFISKRNQEHEAMLSK 59
             ME DLNDYT+IKEGEAEILMH KN+VF+NK QVNNRD+SIAV+R F+SKR QEHEA  SK
Sbjct:     1 METDLNDYTVIKEGEAEILMHKKNQVFFNKAQVNNRDMSIAVLREFLSKRKQEHEAKSSK 60

Query:    60 RTTSAPKASEKDGEEEAPDESVVNEN--SNGEIERPAEISQDEPCCISEEAVKPTERNVL 117
             RT  A K  EKD  E + +E+  +EN  +NG+ E     S+D P  +S++  K TER   
Sbjct:    61 RTRPASKVIEKDASEASKEETP-SENGMNNGDHE---VASEDGPSSVSKDPAKTTERFAP 116

Query:   118 RQLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNIKFNGSVACSKV 177
             R+ KPP+VLEALSASGLRALRYARE+EGIGQVVALDND ASVEAC+RNIKFNGSVA SKV
Sbjct:   117 REPKPPKVLEALSASGLRALRYAREIEGIGQVVALDNDLASVEACQRNIKFNGSVAISKV 176

Query:   178 ESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGN 237
             ESH  DARV+MLTHPKEFDVVDLDPYGSPS+FLDSAIQSV DGG+LMCTATDMAVLCGGN
Sbjct:   177 ESHHTDARVHMLTHPKEFDVVDLDPYGSPSIFLDSAIQSVTDGGLLMCTATDMAVLCGGN 236

Query:   238 GEVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIY 297
             GEVCYSKYGSYPLR KYCHEMALRILLA IESHANRYKRYI PVLSVQMDFYVRVFVR+Y
Sbjct:   237 GEVCYSKYGSYPLRAKYCHEMALRILLASIESHANRYKRYIVPVLSVQMDFYVRVFVRVY 296

Query:   298 TSASAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGK 357
             TSASAMK+TPLKLSYVYQCIGCDSFHLQPVGR+   KNNSVRYLP  GPVV Q C+ CGK
Sbjct:   297 TSASAMKNTPLKLSYVYQCIGCDSFHLQPVGRSLP-KNNSVRYLPAIGPVVKQDCNHCGK 355

Query:   358 KFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSLH 417
             K+NMGGPIWS  +HD EWV SIL  VKSMKDRYPAYDRISAVLTT+SEEL DVPLFLSLH
Sbjct:   356 KYNMGGPIWSAPMHDPEWVTSILNSVKSMKDRYPAYDRISAVLTTVSEELLDVPLFLSLH 415

Query:   418 NLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVKNHPVK 477
             NLC+TLKC SPSA MFRSAVINA YR+SGTHVNPLG+KTDAPM VIWDIMRCWVKNHP+K
Sbjct:   416 NLCATLKCISPSAAMFRSAVINANYRISGTHVNPLGMKTDAPMEVIWDIMRCWVKNHPIK 475

Query:   478 AQLPDQPGSVILAKEPTLQANFARAVASLSKAQAKKVARFLPNPEKHWGPKPRAGRQITS 537
             AQ P+QPGSVIL+KEP+ + +F+R + SLSKAQAKKVARFLPNPEKHWGPK RAGRQITS
Sbjct:   476 AQSPEQPGSVILSKEPSHEVDFSRHIGSLSKAQAKKVARFLPNPEKHWGPKLRAGRQITS 535

Query:   538 KHISLLGAEAVNGHLSL--EDGEEPDAKRQKTEDTTQKTED 576
             KH+SL+G EAVNGHLS   E+ +E D + +  ED  Q   D
Sbjct:   536 KHVSLIGHEAVNGHLSQHHEELKEEDEEAEP-EDNVQDKVD 575

GO:0003723 "RNA binding" evidence=IEA;ISS

GO:0004809 "tRNA (guanine-N2-)-methyltransferase activity" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISM

GO:0008033 "tRNA processing" evidence=IEA;ISS

UNIPROTKB\|F1SD98 TRMT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F6R277 TRMT1 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QUE2 TRMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|J9P9R4 TRMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9NXH9 TRMT1 "tRNA (guanine(26)-N(2))-dimethyltransferase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-060810-40 trmt1 "tRNA methyltransferase 1 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

FB\|FBgn0032430 CG6388 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

MGI\|MGI:1289155 Trmt1 "tRNA methyltransferase 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0284575 DDB_G0284575 "N(2),N(2)-dimethylguanosine tRNA methyltransferase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9SRU7	TRM2_ARATH	2, ., 1, ., 1, ., 2, 1, 6	0.7963	0.9363	0.9235	yes	no
Q9LFU5	TRM1_ARATH	2, ., 1, ., 1, ., 2, 1, 6	0.7920	0.9397	0.9207	no	no
Q23270	TRM1_CAEEL	2, ., 1, ., 1, ., 2, 1, 6	0.3731	0.8313	0.9182	yes	no
Q9P804	TRM1_SCHPO	2, ., 1, ., 1, ., 2, 1, 6	0.3464	0.8726	0.9251	yes	no
Q9VK89	TRM1_DROME	2, ., 1, ., 1, ., 2, 1, 6	0.3961	0.9122	0.9169	yes	no
P15565	TRM1_YEAST	2, ., 1, ., 1, ., 2, 1, 6	0.3201	0.8623	0.8789	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.1.1	0.766
3rd Layer	2.1.1.32	0.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		581
pfam02005		375	pfam02005, TRM, N2,N2-dimethylguanosine tRNA methy	1e-124
COG1867		380	COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyl	3e-91
PRK04338		382	PRK04338, PRK04338, N(2),N(2)-dimethylguanosine tR	9e-85
TIGR00308		374	TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltran	1e-84
PRK04338		382	PRK04338, PRK04338, N(2),N(2)-dimethylguanosine tR	2e-05
TIGR00308		374	TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltran	3e-05
cd02440		107	cd02440, AdoMet_MTases, S-adenosylmethionine-depen	5e-05
pfam12847		104	pfam12847, Methyltransf_18, Methyltransferase doma	2e-04
COG1867		380	COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyl	3e-04
COG0742		187	COG0742, COG0742, N6-adenine-specific methylase [D	3e-04
COG2265		432	COG2265, TrmA, SAM-dependent methyltransferases re	0.001
COG0421		282	COG0421, SpeE, Spermidine synthase [Amino acid tra	0.001
pfam03602		183	pfam03602, Cons_hypoth95, Conserved hypothetical p	0.003

>gnl\|CDD\|216840 pfam02005, TRM, N2,N2-dimethylguanosine tRNA methyltransferase	Back alignment and domain information

 Score =  369 bits (950), Expect = e-124
 Identities = 154/348 (44%), Positives = 211/348 (60%), Gaps = 23/348 (6%)

Query: 122 PPRVLEALSASGLRALRYAREVEGIGQVVALD-NDKASVEACRRNIKFNGSVACSKVESH 180
              VL+ALSASG+RA+R+A EV G+ +V A D + KA VE  + N+K N  V  + V  +
Sbjct: 50  GIIVLDALSASGIRAIRFALEVPGVEEVFANDISPKA-VELIKENVKLN-EVE-NIVVIN 106

Query: 181 LADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGNGEV 240
             DA + M  + + FDV+DLDP+GSP+ FLDSA+QSV  GG+L  TATD AVLCG   E 
Sbjct: 107 GDDANMLMRENHRRFDVIDLDPFGSPAPFLDSAVQSVKRGGLLCVTATDTAVLCGAYPEA 166

Query: 241 CYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTSA 300
           C  KYG+ PLRG++CHE+ LRILL  I  +A +Y + IEP+LS  +D YVRVFV++   A
Sbjct: 167 CLRKYGAVPLRGEFCHEVGLRILLGFIARYAAKYDKAIEPLLSYSIDHYVRVFVKVKRGA 226

Query: 301 SAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKKFN 360
           + +     KL YVY C GC                 +   + G      + C  CG +F+
Sbjct: 227 AKVDKVIEKLGYVYHCSGC----------------MNREVVTGIAKFKAE-CPHCGGRFH 269

Query: 361 MGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSLHNLC 420
           + GP+W G +HD+E+V  +L   +S  + +    RI  +L  I EEL DVPL+  LH L 
Sbjct: 270 LAGPLWLGPLHDKEFVEEMLEIAESPPEEF--SKRILGLLKLIKEELLDVPLYYDLHQLA 327

Query: 421 STLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMR 468
           S LK + P      SA++NAG+ VS TH NP G+KT+AP  V+W++MR
Sbjct: 328 SVLKLSVPPLQDVVSALLNAGFEVSRTHANPTGIKTNAPWEVVWEVMR 375

This enzyme EC:2.1.1.32 used S-AdoMet to methylate tRNA. The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs. The enzyme is found in both eukaryotes and archaebacteria. Length = 375

>gnl\|CDD\|224780 COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|235286 PRK04338, PRK04338, N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|232913 TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltransferase	Back alignment and domain information

>gnl\|CDD\|235286 PRK04338, PRK04338, N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|232913 TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltransferase	Back alignment and domain information

>gnl\|CDD\|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy)	Back alignment and domain information

>gnl\|CDD\|221804 pfam12847, Methyltransf_18, Methyltransferase domain	Back alignment and domain information

>gnl\|CDD\|224780 COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|223813 COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|225174 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|223498 COG0421, SpeE, Spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|202698 pfam03602, Cons_hypoth95, Conserved hypothetical protein 95	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		581
KOG1253		525	consensus tRNA methyltransferase [Translation, rib	100.0
COG1867		380	TRM1 N2,N2-dimethylguanosine tRNA methyltransferas	100.0
PF02005		377	TRM: N2,N2-dimethylguanosine tRNA methyltransferas	100.0
TIGR00308		374	TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi	100.0
PRK04338		382	N(2),N(2)-dimethylguanosine tRNA methyltransferase	100.0
COG1092		393	Predicted SAM-dependent methyltransferases [Genera	99.82
PF03602		183	Cons_hypoth95: Conserved hypothetical protein 95;	99.74
PRK15128		396	23S rRNA m(5)C1962 methyltransferase; Provisional	99.74
PF10672		286	Methyltrans_SAM: S-adenosylmethionine-dependent me	99.73
COG0742		187	N6-adenine-specific methylase [DNA replication, re	99.71
PF02475		200	Met_10: Met-10+ like-protein; InterPro: IPR003402	99.66
TIGR00095		189	RNA methyltransferase, RsmD family. This model rep	99.63
COG2520		341	Predicted methyltransferase [General function pred	99.62
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	99.61
PRK10909		199	rsmD 16S rRNA m(2)G966-methyltransferase; Provisio	99.52
PF13659		117	Methyltransf_26: Methyltransferase domain; PDB: 3G	99.41
PRK05031		362	tRNA (uracil-5-)-methyltransferase; Validated	99.32
TIGR02143		353	trmA_only tRNA (uracil-5-)-methyltransferase. This	99.3
TIGR02085		374	meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer	99.29
COG2265		432	TrmA SAM-dependent methyltransferases related to t	99.26
PRK03522		315	rumB 23S rRNA methyluridine methyltransferase; Rev	99.19
TIGR00446		264	nop2p NOL1/NOP2/sun family putative RNA methylase.	99.18
PF05175		170	MTS: Methyltransferase small domain; InterPro: IPR	99.15
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	99.15
TIGR00479		431	rumA 23S rRNA (uracil-5-)-methyltransferase RumA.	99.15
COG2263		198	Predicted RNA methylase [Translation, ribosomal st	99.13
PRK00377		198	cbiT cobalt-precorrin-6Y C(15)-methyltransferase;	99.13
PLN02781		234	Probable caffeoyl-CoA O-methyltransferase	99.11
TIGR03533		284	L3_gln_methyl protein-(glutamine-N5) methyltransfe	99.11
TIGR03704		251	PrmC_rel_meth putative protein-(glutamine-N5) meth	99.09
PRK13168		443	rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe	99.09
PRK14902		444	16S rRNA methyltransferase B; Provisional	99.08
TIGR02469		124	CbiT precorrin-6Y C5,15-methyltransferase (decarbo	99.07
PF05958		352	tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas	99.07
PRK14903		431	16S rRNA methyltransferase B; Provisional	99.07
PLN02476		278	O-methyltransferase	99.05
COG4123		248	Predicted O-methyltransferase [General function pr	99.05
TIGR00138		181	gidB 16S rRNA methyltransferase GidB. GidB (glucos	99.05
PRK14901		434	16S rRNA methyltransferase B; Provisional	99.05
PRK14967		223	putative methyltransferase; Provisional	99.04
PRK14904		445	16S rRNA methyltransferase B; Provisional	99.03
PRK10901		427	16S rRNA methyltransferase B; Provisional	99.01
PRK07402		196	precorrin-6B methylase; Provisional	99.01
PRK11805		307	N5-glutamine S-adenosyl-L-methionine-dependent met	98.99
PRK00811		283	spermidine synthase; Provisional	98.94
TIGR00536		284	hemK_fam HemK family putative methylases. The gene	98.94
TIGR01177		329	conserved hypothetical protein TIGR01177. This fam	98.93
PRK08287		187	cobalt-precorrin-6Y C(15)-methyltransferase; Valid	98.91
PRK04457		262	spermidine synthase; Provisional	98.91
PF01170		179	UPF0020: Putative RNA methylase family UPF0020; In	98.91
PRK15001		378	SAM-dependent 23S ribosomal RNA mG1835 methyltrans	98.91
PF13847		152	Methyltransf_31: Methyltransferase domain; PDB: 3T	98.9
COG2264		300	PrmA Ribosomal protein L11 methylase [Translation,	98.9
PRK00107		187	gidB 16S rRNA methyltransferase GidB; Reviewed	98.89
PRK11933		470	yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF;	98.88
TIGR00537		179	hemK_rel_arch HemK-related putative methylase. The	98.88
PRK10742		250	putative methyltransferase; Provisional	98.88
TIGR00563		426	rsmB ribosomal RNA small subunit methyltransferase	98.88
PF09445		163	Methyltransf_15: RNA cap guanine-N2 methyltransfer	98.87
TIGR00406		288	prmA ribosomal protein L11 methyltransferase. Ribo	98.86
PF06325		295	PrmA: Ribosomal protein L11 methyltransferase (Prm	98.85
PRK00121		202	trmB tRNA (guanine-N(7)-)-methyltransferase; Revie	98.84
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	98.83
TIGR03534		251	RF_mod_PrmC protein-(glutamine-N5) methyltransfera	98.82
COG2242		187	CobL Precorrin-6B methylase 2 [Coenzyme metabolism	98.82
COG2890		280	HemK Methylase of polypeptide chain release factor	98.82
PRK03612		521	spermidine synthase; Provisional	98.8
PRK14966		423	unknown domain/N5-glutamine S-adenosyl-L-methionin	98.78
TIGR00080		215	pimt protein-L-isoaspartate(D-aspartate) O-methylt	98.77
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	98.75
PRK01581		374	speE spermidine synthase; Validated	98.75
TIGR00417		270	speE spermidine synthase. the SpeE subunit of sper	98.74
PRK14968		188	putative methyltransferase; Provisional	98.74
PRK09489		342	rsmC 16S ribosomal RNA m2G1207 methyltransferase;	98.73
PF01596		205	Methyltransf_3: O-methyltransferase; InterPro: IPR	98.72
TIGR02752		231	MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me	98.7
COG4122		219	Predicted O-methyltransferase [General function pr	98.69
PRK09328		275	N5-glutamine S-adenosyl-L-methionine-dependent met	98.69
PRK13944		205	protein-L-isoaspartate O-methyltransferase; Provis	98.69
COG2813		300	RsmC 16S RNA G1207 methylase RsmC [Translation, ri	98.68
PLN02366		308	spermidine synthase	98.67
PRK11036		255	putative S-adenosyl-L-methionine-dependent methylt	98.66
PLN02823		336	spermine synthase	98.65
PLN02589		247	caffeoyl-CoA O-methyltransferase	98.64
COG2227		243	UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-	98.63
TIGR00091		194	tRNA (guanine-N(7)-)-methyltransferase. In E. coli	98.61
COG1041		347	Predicted DNA modification methylase [DNA replicat	98.61
KOG3420		185	consensus Predicted RNA methylase [Translation, ri	98.6
COG0144		355	Sun tRNA and rRNA cytosine-C5-methylases [Translat	98.58
PHA03412		241	putative methyltransferase; Provisional	98.57
PRK13942		212	protein-L-isoaspartate O-methyltransferase; Provis	98.56
cd02440		107	AdoMet_MTases S-adenosylmethionine-dependent methy	98.55
PF01189		283	Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR	98.51
PF01564		246	Spermine_synth: Spermine/spermidine synthase; Inte	98.49
KOG1663		237	consensus O-methyltransferase [Secondary metabolit	98.48
KOG2187		534	consensus tRNA uracil-5-methyltransferase and rela	98.47
smart00650		169	rADc Ribosomal RNA adenine dimethylases.	98.46
PLN02396		322	hexaprenyldihydroxybenzoate methyltransferase	98.46
PHA03411		279	putative methyltransferase; Provisional	98.46
PF08704		247	GCD14: tRNA methyltransferase complex GCD14 subuni	98.45
PLN02672		1082	methionine S-methyltransferase	98.45
PRK11207		197	tellurite resistance protein TehB; Provisional	98.42
PRK11873		272	arsM arsenite S-adenosylmethyltransferase; Reviewe	98.4
PRK13943		322	protein-L-isoaspartate O-methyltransferase; Provis	98.39
PLN02244		340	tocopherol O-methyltransferase	98.38
PRK14121		390	tRNA (guanine-N(7)-)-methyltransferase; Provisiona	98.36
PRK00312		212	pcm protein-L-isoaspartate O-methyltransferase; Re	98.36
TIGR00477		195	tehB tellurite resistance protein TehB. Part of a	98.34
COG2519		256	GCD14 tRNA(1-methyladenosine) methyltransferase an	98.3
PRK12335		287	tellurite resistance protein TehB; Provisional	98.3
PF01209		233	Ubie_methyltran: ubiE/COQ5 methyltransferase famil	98.29
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	98.29
PRK05134		233	bifunctional 3-demethylubiquinone-9 3-methyltransf	98.29
smart00828		224	PKS_MT Methyltransferase in polyketide synthase (P	98.27
PRK04266		226	fibrillarin; Provisional	98.27
COG2226		238	UbiE Methylase involved in ubiquinone/menaquinone	98.26
PLN02233		261	ubiquinone biosynthesis methyltransferase	98.24
COG2521		287	Predicted archaeal methyltransferase [General func	98.22
PRK00216		239	ubiE ubiquinone/menaquinone biosynthesis methyltra	98.22
PRK15451		247	tRNA cmo(5)U34 methyltransferase; Provisional	98.21
KOG1122		460	consensus tRNA and rRNA cytosine-C5-methylase (nuc	98.2
COG0116		381	Predicted N6-adenine-specific DNA methylase [DNA r	98.2
KOG2904		328	consensus Predicted methyltransferase [General fun	98.19
TIGR01983		224	UbiG ubiquinone biosynthesis O-methyltransferase.	98.18
PRK01683		258	trans-aconitate 2-methyltransferase; Provisional	98.16
PF02384		311	N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T	98.15
PF05185		448	PRMT5: PRMT5 arginine-N-methyltransferase; InterPr	98.14
PLN03075		296	nicotianamine synthase; Provisional	98.13
KOG1270		282	consensus Methyltransferases [Coenzyme transport a	98.12
PF10294		173	Methyltransf_16: Putative methyltransferase; Inter	98.12
COG0421		282	SpeE Spermidine synthase [Amino acid transport and	98.1
KOG1499		346	consensus Protein arginine N-methyltransferase PRM	98.09
PLN02336		475	phosphoethanolamine N-methyltransferase	98.09
PRK15068		322	tRNA mo(5)U34 methyltransferase; Provisional	98.06
PRK08317		241	hypothetical protein; Provisional	98.06
TIGR01934		223	MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis	98.05
TIGR00740		239	methyltransferase, putative. A simple BLAST search	98.05
PRK14103		255	trans-aconitate 2-methyltransferase; Provisional	98.04
COG4262		508	Predicted spermidine synthase with an N-terminal m	98.04
TIGR02021		219	BchM-ChlM magnesium protoporphyrin O-methyltransfe	98.02
TIGR00452		314	methyltransferase, putative. Known examples to dat	97.98
PTZ00146		293	fibrillarin; Provisional	97.98
PLN02490		340	MPBQ/MSBQ methyltransferase	97.96
PRK10258		251	biotin biosynthesis protein BioC; Provisional	97.96
KOG2078		495	consensus tRNA modification enzyme [RNA processing	97.96
PRK11727		321	23S rRNA mA1618 methyltransferase; Provisional	97.96
PF01135		209	PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl	97.96
PTZ00098		263	phosphoethanolamine N-methyltransferase; Provision	97.96
PRK06922		677	hypothetical protein; Provisional	97.96
TIGR03840		213	TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d	97.94
TIGR02072		240	BioC biotin biosynthesis protein BioC. This enzyme	97.92
PRK13255		218	thiopurine S-methyltransferase; Reviewed	97.92
PRK11188		209	rrmJ 23S rRNA methyltransferase J; Provisional	97.89
PF08241		95	Methyltransf_11: Methyltransferase domain; InterPr	97.88
TIGR00438		188	rrmJ cell division protein FtsJ.	97.87
PF03848		192	TehB: Tellurite resistance protein TehB; InterPro:	97.86
COG3897		218	Predicted methyltransferase [General function pred	97.84
PF02353		273	CMAS: Mycolic acid cyclopropane synthetase; InterP	97.83
PRK11705		383	cyclopropane fatty acyl phospholipid synthase; Pro	97.83
KOG1227		351	consensus Putative methyltransferase [General func	97.83
KOG2730		263	consensus Methylase [General function prediction o	97.82
KOG1500		517	consensus Protein arginine N-methyltransferase CAR	97.79
PF05401		201	NodS: Nodulation protein S (NodS); InterPro: IPR00	97.78
PF13649		101	Methyltransf_25: Methyltransferase domain; PDB: 3B	97.78
TIGR02987		524	met_A_Alw26 type II restriction m6 adenine DNA met	97.74
TIGR02716		306	C20_methyl_CrtF C-20 methyltransferase BchU. Membe	97.71
PRK07580		230	Mg-protoporphyrin IX methyl transferase; Validated	97.71
KOG1271		227	consensus Methyltransferases [General function pre	97.62
COG2230		283	Cfa Cyclopropane fatty acid synthase and related m	97.59
COG2518		209	Pcm Protein-L-isoaspartate carboxylmethyltransfera	97.57
PLN02336		475	phosphoethanolamine N-methyltransferase	97.56
PTZ00338		294	dimethyladenosine transferase-like protein; Provis	97.55
PLN02585		315	magnesium protoporphyrin IX methyltransferase	97.55
TIGR03438		301	probable methyltransferase. This model represents	97.54
COG4076		252	Predicted RNA methylase [General function predicti	97.53
KOG3191		209	consensus Predicted N6-DNA-methyltransferase [Tran	97.43
PF01861		243	DUF43: Protein of unknown function DUF43; InterPro	97.42
PRK00536		262	speE spermidine synthase; Provisional	97.41
cd00315		275	Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth	97.34
TIGR03587		204	Pse_Me-ase pseudaminic acid biosynthesis-associate	97.3
PRK11088		272	rrmA 23S rRNA methyltransferase A; Provisional	97.3
PRK14896		258	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	97.29
smart00138		264	MeTrc Methyltransferase, chemotaxis proteins. Meth	97.26
COG4976		287	Predicted methyltransferase (contains TPR repeat)	97.25
PF02390		195	Methyltransf_4: Putative methyltransferase ; Inter	97.24
PF08003		315	Methyltransf_9: Protein of unknown function (DUF16	97.23
PRK00050		296	16S rRNA m(4)C1402 methyltranserfase; Provisional	97.21
PF13489		161	Methyltransf_23: Methyltransferase domain; PDB: 3J	97.19
PRK00274		272	ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1	97.15
KOG1540		296	consensus Ubiquinone biosynthesis methyltransferas	97.13
PF08242		99	Methyltransf_12: Methyltransferase domain; InterPr	97.09
PF03291		331	Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971	96.91
PRK13256		226	thiopurine S-methyltransferase; Reviewed	96.88
PRK06202		232	hypothetical protein; Provisional	96.84
TIGR00755		253	ksgA dimethyladenosine transferase. Alternate name	96.81
PF05724		218	TPMT: Thiopurine S-methyltransferase (TPMT); Inter	96.8
PF06080		204	DUF938: Protein of unknown function (DUF938); Inte	96.8
PF12147		311	Methyltransf_20: Putative methyltransferase; Inter	96.66
PHA01634		156	hypothetical protein	96.65
PF04445		234	SAM_MT: Putative SAM-dependent methyltransferase;	96.58
KOG2899		288	consensus Predicted methyltransferase [General fun	96.52
PF13578		106	Methyltransf_24: Methyltransferase domain; PDB: 3S	96.5
TIGR01444		143	fkbM_fam methyltransferase, FkbM family. Members o	96.4
TIGR00478		228	tly hemolysin TlyA family protein. Hemolysins are	96.36
KOG2915		314	consensus tRNA(1-methyladenosine) methyltransferas	96.33
COG0220		227	Predicted S-adenosylmethionine-dependent methyltra	96.23
PF02527		184	GidB: rRNA small subunit methyltransferase G; Inte	96.13
PRK05785		226	hypothetical protein; Provisional	96.11
COG0357		215	GidB Predicted S-adenosylmethionine-dependent meth	96.09
PF00145		335	DNA_methylase: C-5 cytosine-specific DNA methylase	96.05
TIGR02081		194	metW methionine biosynthesis protein MetW. This pr	96.03
KOG2198		375	consensus tRNA cytosine-5-methylases and related e	95.87
COG3286		204	Uncharacterized protein conserved in archaea [Func	95.81
COG1568		354	Predicted methyltransferases [General function pre	95.75
COG0270		328	Dcm Site-specific DNA methylase [DNA replication,	95.65
PF09840		190	DUF2067: Uncharacterized protein conserved in arch	95.63
TIGR00675		315	dcm DNA-methyltransferase (dcm). All proteins in t	95.57
PF07021		193	MetW: Methionine biosynthesis protein MetW; InterP	95.46
PF11599		246	AviRa: RRNA methyltransferase AviRa; InterPro: IPR	95.43
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	95.31
PF04816		205	DUF633: Family of unknown function (DUF633) ; Inte	95.2
PF00891		241	Methyltransf_2: O-methyltransferase; InterPro: IPR	95.1
PF01728		181	FtsJ: FtsJ-like methyltransferase; InterPro: IPR00	95.04
KOG2671		421	consensus Putative RNA methylase [Replication, rec	94.99
PF05430		124	Methyltransf_30: S-adenosyl-L-methionine-dependent	94.96
TIGR00006		305	S-adenosyl-methyltransferase MraW. Genetics paper	94.61
KOG1661		237	consensus Protein-L-isoaspartate(D-aspartate) O-me	94.51
PRK11760		357	putative 23S rRNA C2498 ribose 2'-O-ribose methylt	94.46
PF06962		140	rRNA_methylase: Putative rRNA methylase; InterPro:	94.43
PF05971		299	Methyltransf_10: Protein of unknown function (DUF8	94.36
PRK11524		284	putative methyltransferase; Provisional	94.24
PRK10458		467	DNA cytosine methylase; Provisional	93.95
PLN02232		160	ubiquinone biosynthesis methyltransferase	93.94
PF01555		231	N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th	93.92
PF03059		276	NAS: Nicotianamine synthase protein; InterPro: IPR	93.91
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	93.46
PRK04148		134	hypothetical protein; Provisional	93.24
KOG1562		337	consensus Spermidine synthase [Amino acid transpor	92.94
KOG1975		389	consensus mRNA cap methyltransferase [RNA processi	92.61
PF05219		265	DREV: DREV methyltransferase; InterPro: IPR007884	92.27
COG1189		245	Predicted rRNA methylase [Translation, ribosomal s	92.15
PF01269		229	Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr	92.1
COG0030		259	KsgA Dimethyladenosine transferase (rRNA methylati	91.9
COG0286		489	HsdM Type I restriction-modification system methyl	91.68
PF02086		260	MethyltransfD12: D12 class N6 adenine-specific DNA	91.62
PRK13699		227	putative methylase; Provisional	91.6
PF00398		262	RrnaAD: Ribosomal RNA adenine dimethylase; InterPr	91.27
PRK09880		343	L-idonate 5-dehydrogenase; Provisional	91.05
COG3963		194	Phospholipid N-methyltransferase [Lipid metabolism	90.77
KOG1501		636	consensus Arginine N-methyltransferase [General fu	90.69
COG2384		226	Predicted SAM-dependent methyltransferase [General	90.66
PF05891		218	Methyltransf_PK: AdoMet dependent proline di-methy	90.62
PRK11524		284	putative methyltransferase; Provisional	90.59
PRK13699		227	putative methylase; Provisional	89.76
COG4106		257	Tam Trans-aconitate methyltransferase [General fun	89.48
PF00107		130	ADH_zinc_N: Zinc-binding dehydrogenase; InterPro:	89.17
PRK10611		287	chemotaxis methyltransferase CheR; Provisional	89.08
PF08123		205	DOT1: Histone methylation protein DOT1 ; InterPro:	88.89
KOG0820		315	consensus Ribosomal RNA adenine dimethylase [RNA p	88.64
PF01795		310	Methyltransf_5: MraW methylase family; InterPro: I	88.55
KOG2361		264	consensus Predicted methyltransferase [General fun	87.86
KOG3201		201	consensus Uncharacterized conserved protein [Funct	87.54
COG0293		205	FtsJ 23S rRNA methylase [Translation, ribosomal st	86.82
COG1439		177	Predicted nucleic acid-binding protein, consists o	86.7
PF04378		245	RsmJ: Ribosomal RNA small subunit methyltransferas	86.62
TIGR00497		501	hsdM type I restriction system adenine methylase (	85.71
PF09723		42	Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134	85.57
KOG0024		354	consensus Sorbitol dehydrogenase [Secondary metabo	85.44
PF10609		81	ParA: ParA/MinD ATPase like; InterPro: IPR019591 T	85.16
COG0500		257	SmtA SAM-dependent methyltransferases [Secondary m	84.98
COG0275		314	Predicted S-adenosylmethionine-dependent methyltra	84.68
PF07942		270	N2227: N2227-like protein; InterPro: IPR012901 Thi	84.51
KOG3010		261	consensus Methyltransferase [General function pred	84.39
PRK12380		113	hydrogenase nickel incorporation protein HybF; Pro	84.26
PRK00398		46	rpoP DNA-directed RNA polymerase subunit P; Provis	84.07
KOG4300		252	consensus Predicted methyltransferase [General fun	83.82
PRK03681		114	hypA hydrogenase nickel incorporation protein; Val	83.74
COG1064		339	AdhP Zn-dependent alcohol dehydrogenases [General	83.74
KOG2793		248	consensus Putative N2,N2-dimethylguanosine tRNA me	83.72
smart00834		41	CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C	83.62
TIGR01202		308	bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl	82.74
TIGR00100		115	hypA hydrogenase nickel insertion protein HypA. In	82.62
PF01155		113	HypA: Hydrogenase expression/synthesis hypA family	81.35
PRK00564		117	hypA hydrogenase nickel incorporation protein; Pro	81.16
TIGR03451		358	mycoS_dep_FDH mycothiol-dependent formaldehyde deh	80.28

>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Probab=100.00  E-value=3.9e-141  Score=1124.34  Aligned_cols=503  Identities=53%  Similarity=0.883  Sum_probs=455.9

Q ss_pred             CCCCCceEEEeeeEEEEecCCCCccccccchhhhhHHHHHHHHHHHHhHHHHHHhhhhccCCCCCCCccCCCCCCCCccc
Q 047386            2 EDLNDYTIIKEGEAEILMHAKNEVFYNKTQVNNRDISIAVMRAFISKRNQEHEAMLSKRTTSAPKASEKDGEEEAPDESV   81 (581)
Q Consensus         2 ~~~~~~~~i~EG~a~I~~p~~~~VFYNPvq~fNRDlSV~vi~~f~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~   81 (581)
                      .+.+++.+|+||.|.|.+++.++|||||+|+|||||||.+|++|.+.|.+++.++...+..      .++.+|      .
T Consensus        16 ~d~e~~~~v~Eg~a~i~~~~~~~vFynp~Q~FNRdlSi~vir~~~~~~~~~~~~~~~~~~~------~~~~se------~   83 (525)
T KOG1253|consen   16 LDLEAFATVTEGQAEILKNKKNCVFYNPKQKFNRDLSITVVRAFSNLRFKEGVAKTFSKKI------LKRGSE------T   83 (525)
T ss_pred             cccccceeeecCccccccCCCCceecCHHHHhchhhHHHHHHHHHHHHHHhhhhhhhhHHH------HHhhhc------c
Confidence            4788999999999999999999999999999999999999999999988776543111100      000000      0


Q ss_pred             cccCCCCCcCCcccccCCCCccccccccCccchhcccCCCCCeEEEecCcccHHHHHHhhhcCCccEEEEEeCCHHHHHH
Q 047386           82 VNENSNGEIERPAEISQDEPCCISEEAVKPTERNVLRQLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEA  161 (581)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLDafsgSG~rgIr~a~E~~Ga~~V~anD~s~~Ave~  161 (581)
                      ..++     -+.+....+.+.         +.....++.++.+|||+|||||+||||||+|++|+..|++||.|+.||++
T Consensus        84 ~~e~-----~~~~~~~~~~~~---------t~~~~~~~~~~l~vLealsAtGlrslRya~El~~v~~v~AnD~~~~aV~~  149 (525)
T KOG1253|consen   84 GKES-----LKETDSYNDSPK---------TAALLKREEKSLRVLEALSATGLRSLRYAKELPGVRQVVANDLNENAVTS  149 (525)
T ss_pred             cccc-----cccccccCCCcc---------ccchhhhccCcchHHHHhhhhhHHHHHHHHHhcchhhhcccCCCHHHHHH
Confidence            0000     000001111111         12223345567899999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCCCcEEEEehhHHHHHhhCC---CcccEEeeCCCCCChHhHHHHHHhccCCCeEEEEeccchhhcCCCc
Q 047386          162 CRRNIKFNGSVACSKVESHLADARVYMLTHP---KEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGNG  238 (581)
Q Consensus       162 i~~Ni~~N~~~~~~~v~v~~~DA~~~l~~~~---~~fDvIdLDPyGs~~~fld~A~~~l~~gGlL~vTaTD~a~Lcg~~~  238 (581)
                      |++|+++|+++  +.++++++||+.+|+++.   ++||||||||||++++|||+|+|+|++||||||||||+++|||+.|
T Consensus       150 i~~Nv~~N~v~--~ive~~~~DA~~lM~~~~~~~~~FDvIDLDPyGs~s~FLDsAvqav~~gGLL~vT~TD~aVL~gn~p  227 (525)
T KOG1253|consen  150 IQRNVELNGVE--DIVEPHHSDANVLMYEHPMVAKFFDVIDLDPYGSPSPFLDSAVQAVRDGGLLCVTCTDMAVLAGNAP  227 (525)
T ss_pred             HHhhhhhcCch--hhcccccchHHHHHHhccccccccceEecCCCCCccHHHHHHHHHhhcCCEEEEEecchHhhccCCh
Confidence            99999999987  789999999999999987   8999999999999999999999999999999999999999999999


Q ss_pred             chhhhhccCccCCCccchhhhHHHHHHHHHHHHHHcCCceEEEeecccCceEEEEEEEEcChhhhccccccceEEEEcCC
Q 047386          239 EVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTSASAMKSTPLKLSYVYQCIG  318 (581)
Q Consensus       239 ~~c~rkYG~~~~k~~~~hE~~lRill~~i~~~Aa~~~r~i~Plls~s~dhY~RvfVrV~~~~~~~k~~~~k~g~v~~C~~  318 (581)
                      ++||++||+++++++|||||||||||+.|+++|++|+|+|+||||+++|||+||||||++|+.++|++.++++|||||.+
T Consensus       228 e~C~~kYG~~~lr~~~chE~aLRill~~i~~~Aary~r~IePLlSis~DFYVRVFVRV~t~~~~~k~~~~k~~~v~hC~g  307 (525)
T KOG1253|consen  228 EKCYSKYGASILRMKYCHEMALRILLAAIARAAARYGRYVEPLLSLSIDFYVRVFVRVYTGPPKVKNTRSKYGLVYHCSG  307 (525)
T ss_pred             hhHHHhcCcccccchhhhHHHHHHHHHHHHHHHHHhCCcceeeEEEEeeeEEEEEEEEEccCchhhccccceeEEEEecC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceeEeeccccccCCCCcccccCCCCCCCCCcCCCCCCcccccccccccCCCCHHHHHHHHHHhhhcccC-CCcHHHHH
Q 047386          319 CDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDR-YPAYDRIS  397 (581)
Q Consensus       319 C~~~~~q~lgr~~~~~~~~~~~~~~~~~~~~~~C~~Cg~~~~~~GPlW~GpLhd~~fv~~ml~~~~~~~~~-~~t~~ri~  397 (581)
                      ||+||+||+||.. .+++..+|.++.||++++.|.|||++++++||||+|||||.+||++||..++++++. ++|.+||.
T Consensus       308 C~s~~~q~lg~~~-~~~~~~~~~~~~gp~v~~~C~hcg~~~~l~GP~W~~PlHd~~fv~~mL~~~k~~~~~~~~t~kri~  386 (525)
T KOG1253|consen  308 CGSFHLQPLGRTS-PNPGSTKFSEAGGPPVPCNCEHCGKRLHLGGPMWSGPLHDAEFVTEMLEIAKEVSEDTYGTDKRLS  386 (525)
T ss_pred             cchhhcccccccC-CCCccceeccCCCCCCCcccccccccccccCccccCccccHHHHHHHHHHhhcCCccccchhhhhe
Confidence            9999999999998 477889999999999999999999999999999999999999999999999886544 55999999


Q ss_pred             HHHHHHHhhCCCCCceeeHHHHhhhcCCCCCCHHHHHHHHHHCCceEEecccCCCccccCCCHHHHHHHHHHHHHhCCCC
Q 047386          398 AVLTTISEELPDVPLFLSLHNLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVKNHPVK  477 (581)
Q Consensus       398 ~lL~~~~eEl~~~P~yy~l~~l~~~lk~~~P~~~~~~~aL~~~GY~aSrTH~~p~~iKTdAP~~~i~di~r~w~~~~p~k  477 (581)
                      +||+++.|||+|+||||++++||+.+|+++|+++.|++||.++||+||+||+.|+||||||||+.||||||+|++.||+|
T Consensus       387 g~L~~~~eeL~dvp~y~~~~~l~s~lk~~~p~~~~~~sAllnaGyrvS~sH~~~naiKTnAP~s~iwdi~r~~~k~h~vk  466 (525)
T KOG1253|consen  387 GMLELVDEELPDVPLYYSLNQLCSVLKCNSPPLKKFRSALLNAGYRVSGSHANPNAIKTNAPMSHIWDILRCWIKDHPVK  466 (525)
T ss_pred             ehhhcccccccCCccccchhhhhhhhcccCCcHHHHHHHHHhccceeccccccccccccCCCHHHHHHHHHHhhccCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CC--CCCCccccccccCccccccccchhccchHHhhcCccccCCCCCCCCCCCCCCCC
Q 047386          478 AQ--LPDQPGSVILAKEPTLQANFARAVASLSKAQAKKVARFLPNPEKHWGPKPRAGR  533 (581)
Q Consensus       478 ~~--~~~~p~~~il~~~~~~~~~f~~~~~~~~~~~~~~~~r~~~NP~~nWGPk~ra~~  533 (581)
                      .+  ++.+|+.+||+++|+.+++|+.++++.+++|+++++|||+|||+||||+.||++
T Consensus       467 ~e~m~~~s~~~~iLs~ep~~~~~F~~~~~~~p~~~~~~~~rfq~nPt~~wGp~~ra~~  524 (525)
T KOG1253|consen  467 LENMSKTSPGSAILSKEPTSQVDFTLHPGANPKSRKKKIVRFQENPTKNWGPKERAGQ  524 (525)
T ss_pred             HhhcCCCCCceEEEecCCcceeeeeecCCCChhhhhhhhhhhccCCCCCCCCCCCCCC
Confidence            87  799999999999999999999999999999999999999999999999999975

>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2	Back alignment and domain information

>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase	Back alignment and domain information

>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional	Back alignment and domain information

>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only]	Back alignment and domain information

>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH	Back alignment and domain information

>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional	Back alignment and domain information

>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species	Back alignment and domain information

>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family	Back alignment and domain information

>TIGR00095 RNA methyltransferase, RsmD family	Back alignment and domain information

>COG2520 Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional	Back alignment and domain information

>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A	Back alignment and domain information

>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated	Back alignment and domain information

>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase	Back alignment and domain information

>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB	Back alignment and domain information

>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed	Back alignment and domain information

>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase	Back alignment and domain information

>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA	Back alignment and domain information

>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional	Back alignment and domain information

>PLN02781 Probable caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific	Back alignment and domain information

>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific	Back alignment and domain information

>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed	Back alignment and domain information

>PRK14902 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit	Back alignment and domain information

>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2	Back alignment and domain information

>PRK14903 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PLN02476 O-methyltransferase	Back alignment and domain information

>COG4123 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR00138 gidB 16S rRNA methyltransferase GidB	Back alignment and domain information

>PRK14901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK14967 putative methyltransferase; Provisional	Back alignment and domain information

>PRK14904 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK10901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK07402 precorrin-6B methylase; Provisional	Back alignment and domain information

>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>TIGR00536 hemK_fam HemK family putative methylases	Back alignment and domain information

>TIGR01177 conserved hypothetical protein TIGR01177	Back alignment and domain information

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated	Back alignment and domain information

>PRK04457 spermidine synthase; Provisional	Back alignment and domain information

>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase	Back alignment and domain information

>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional	Back alignment and domain information

>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A	Back alignment and domain information

>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed	Back alignment and domain information

>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed	Back alignment and domain information

>TIGR00537 hemK_rel_arch HemK-related putative methylase	Back alignment and domain information

>PRK10742 putative methyltransferase; Provisional	Back alignment and domain information

>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB	Back alignment and domain information

>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ]

Back alignment and domain information

>TIGR00406 prmA ribosomal protein L11 methyltransferase	Back alignment and domain information

>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences	Back alignment and domain information

>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific	Back alignment and domain information

>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]	Back alignment and domain information

>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK03612 spermidine synthase; Provisional	Back alignment and domain information

>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional	Back alignment and domain information

>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

>PRK01581 speE spermidine synthase; Validated	Back alignment and domain information

>TIGR00417 speE spermidine synthase	Back alignment and domain information

>PRK14968 putative methyltransferase; Provisional	Back alignment and domain information

>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional	Back alignment and domain information

>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases	Back alignment and domain information

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase	Back alignment and domain information

>COG4122 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02366 spermidine synthase	Back alignment and domain information

>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PLN02823 spermine synthase	Back alignment and domain information

>PLN02589 caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]	Back alignment and domain information

>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase	Back alignment and domain information

>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PHA03412 putative methyltransferase; Provisional	Back alignment and domain information

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy)	Back alignment and domain information

>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins	Back alignment and domain information

>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2	Back alignment and domain information

>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>smart00650 rADc Ribosomal RNA adenine dimethylases	Back alignment and domain information

>PLN02396 hexaprenyldihydroxybenzoate methyltransferase	Back alignment and domain information

>PHA03411 putative methyltransferase; Provisional	Back alignment and domain information

>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA []	Back alignment and domain information

>PLN02672 methionine S-methyltransferase	Back alignment and domain information

>PRK11207 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed	Back alignment and domain information

>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PLN02244 tocopherol O-methyltransferase	Back alignment and domain information

>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional	Back alignment and domain information

>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed	Back alignment and domain information

>TIGR00477 tehB tellurite resistance protein TehB	Back alignment and domain information

>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12335 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional	Back alignment and domain information

>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes	Back alignment and domain information

>PRK04266 fibrillarin; Provisional	Back alignment and domain information

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PLN02233 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>COG2521 Predicted archaeal methyltransferase [General function prediction only]	Back alignment and domain information

>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed	Back alignment and domain information

>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification]	Back alignment and domain information

>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG2904 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase	Back alignment and domain information

>PRK01683 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2	Back alignment and domain information

>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase []	Back alignment and domain information

>PLN03075 nicotianamine synthase; Provisional	Back alignment and domain information

>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism]	Back alignment and domain information

>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases	Back alignment and domain information

>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms]	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PRK08317 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases	Back alignment and domain information

>TIGR00740 methyltransferase, putative	Back alignment and domain information

>PRK14103 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only]	Back alignment and domain information

>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase	Back alignment and domain information

>TIGR00452 methyltransferase, putative	Back alignment and domain information

>PTZ00146 fibrillarin; Provisional	Back alignment and domain information

>PLN02490 MPBQ/MSBQ methyltransferase	Back alignment and domain information

>PRK10258 biotin biosynthesis protein BioC; Provisional	Back alignment and domain information

>KOG2078 consensus tRNA modification enzyme [RNA processing and modification]	Back alignment and domain information

>PRK11727 23S rRNA mA1618 methyltransferase; Provisional	Back alignment and domain information

>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2	Back alignment and domain information

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional	Back alignment and domain information

>PRK06922 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family	Back alignment and domain information

>TIGR02072 BioC biotin biosynthesis protein BioC	Back alignment and domain information

>PRK13255 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional	Back alignment and domain information

>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>TIGR00438 rrmJ cell division protein FtsJ	Back alignment and domain information

>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB	Back alignment and domain information

>COG3897 Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4)	Back alignment and domain information

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional	Back alignment and domain information

>KOG1227 consensus Putative methyltransferase [General function prediction only]	Back alignment and domain information

>KOG2730 consensus Methylase [General function prediction only]	Back alignment and domain information

>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription]	Back alignment and domain information

>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins	Back alignment and domain information

>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A	Back alignment and domain information

>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family	Back alignment and domain information

>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU	Back alignment and domain information

>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated	Back alignment and domain information

>KOG1271 consensus Methyltransferases [General function prediction only]	Back alignment and domain information

>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PTZ00338 dimethyladenosine transferase-like protein; Provisional	Back alignment and domain information

>PLN02585 magnesium protoporphyrin IX methyltransferase	Back alignment and domain information

>TIGR03438 probable methyltransferase	Back alignment and domain information

>COG4076 Predicted RNA methylase [General function prediction only]	Back alignment and domain information

>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised	Back alignment and domain information

>PRK00536 speE spermidine synthase; Provisional	Back alignment and domain information

>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology	Back alignment and domain information

>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase	Back alignment and domain information

>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional	Back alignment and domain information

>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional	Back alignment and domain information

>smart00138 MeTrc Methyltransferase, chemotaxis proteins	Back alignment and domain information

>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]	Back alignment and domain information

>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2	Back alignment and domain information

>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional	Back alignment and domain information

>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C	Back alignment and domain information

>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed	Back alignment and domain information

>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism]	Back alignment and domain information

>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes	Back alignment and domain information

>PRK13256 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>PRK06202 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00755 ksgA dimethyladenosine transferase	Back alignment and domain information

>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes	Back alignment and domain information

>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length	Back alignment and domain information

>PHA01634 hypothetical protein	Back alignment and domain information

>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised	Back alignment and domain information

>KOG2899 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D	Back alignment and domain information

>TIGR01444 fkbM_fam methyltransferase, FkbM family	Back alignment and domain information

>TIGR00478 tly hemolysin TlyA family protein	Back alignment and domain information

>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only]	Back alignment and domain information

>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G	Back alignment and domain information

>PRK05785 hypothetical protein; Provisional	Back alignment and domain information

>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2	Back alignment and domain information

>TIGR02081 metW methionine biosynthesis protein MetW	Back alignment and domain information

>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG3286 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>COG1568 Predicted methyltransferases [General function prediction only]	Back alignment and domain information

>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF09840 DUF2067: Uncharacterized protein conserved in archaea (DUF2067); InterPro: IPR019202 This family of archaeal proteins, have no known function	Back alignment and domain information

>TIGR00675 dcm DNA-methyltransferase (dcm)	Back alignment and domain information

>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins	Back alignment and domain information

>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins	Back alignment and domain information

>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes	Back alignment and domain information

>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair]	Back alignment and domain information

>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function	Back alignment and domain information

>TIGR00006 S-adenosyl-methyltransferase MraW	Back alignment and domain information

>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional	Back alignment and domain information

>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases	Back alignment and domain information

>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes	Back alignment and domain information

>PRK11524 putative methyltransferase; Provisional	Back alignment and domain information

>PRK10458 DNA cytosine methylase; Provisional	Back alignment and domain information

>PLN02232 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases	Back alignment and domain information

>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification]	Back alignment and domain information

>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes	Back alignment and domain information

>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ]	Back alignment and domain information

>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms]	Back alignment and domain information

>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes	Back alignment and domain information

>PRK13699 putative methylase; Provisional	Back alignment and domain information

>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e	Back alignment and domain information

>PRK09880 L-idonate 5-dehydrogenase; Provisional	Back alignment and domain information

>COG3963 Phospholipid N-methyltransferase [Lipid metabolism]	Back alignment and domain information

>KOG1501 consensus Arginine N-methyltransferase [General function prediction only]	Back alignment and domain information

>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only]	Back alignment and domain information

>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like	Back alignment and domain information

>PRK11524 putative methyltransferase; Provisional	Back alignment and domain information

>PRK13699 putative methylase; Provisional	Back alignment and domain information

>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only]	Back alignment and domain information

>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1	Back alignment and domain information

>PRK10611 chemotaxis methyltransferase CheR; Provisional	Back alignment and domain information

>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 []	Back alignment and domain information

>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification]	Back alignment and domain information

>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria	Back alignment and domain information

>KOG2361 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>KOG3201 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]	Back alignment and domain information

>PF04378 RsmJ: Ribosomal RNA small subunit methyltransferase D, RsmJ; InterPro: IPR007473 This is a bacterial protein of unknown function, possibly secreted	Back alignment and domain information

>TIGR00497 hsdM type I restriction system adenine methylase (hsdM)	Back alignment and domain information

>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria	Back alignment and domain information

>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning []	Back alignment and domain information

>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]	Back alignment and domain information

>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT)	Back alignment and domain information

>KOG3010 consensus Methyltransferase [General function prediction only]	Back alignment and domain information

>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional	Back alignment and domain information

>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional	Back alignment and domain information

>KOG4300 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PRK03681 hypA hydrogenase nickel incorporation protein; Validated	Back alignment and domain information

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]	Back alignment and domain information

>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification]	Back alignment and domain information

>smart00834 CxxC_CXXC_SSSS Putative regulatory protein	Back alignment and domain information

>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase	Back alignment and domain information

>TIGR00100 hypA hydrogenase nickel insertion protein HypA	Back alignment and domain information

>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation	Back alignment and domain information

>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional	Back alignment and domain information

>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		581
2dul_A		378	Crystal Structure Of Trna G26 Methyltransferase Trm		4e-43
3axs_A		392	Complex Structure Of Trna Methyltransferase Trm1 Fr		3e-30

>pdb|2DUL|A Chain A, Crystal Structure Of Trna G26 Methyltransferase Trm1 In Apo Form From Pyrococcus Horikoshii Length = 378

Back alignment and structure

Iteration: 1

Score = 172 bits (437), Expect = 4e-43, Method: Compositional matrix adjust. Identities = 116/365 (31%), Positives = 176/365 (48%), Gaps = 42/365 (11%) Query: 116 VLRQLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNI--KFNGSVA 173 +L L P VL+ALSA+G+R +R+A E +V D + + E +RN+ F+G + Sbjct: 42 LLNILNPKIVLDALSATGIRGIRFALETPA-EEVWLNDISEDAYELMKRNVMLNFDGELR 100 Query: 174 CSKVESHLADARVYMLTHP----------KEFDVVDLDPYGSPSVFLDSAIQSVADGGML 223 SK + L + ++ H + F +DLDP+GSP FLD+A++S G+L Sbjct: 101 ESKGRAILKGEKTIVINHDDANRLMAERHRYFHFIDLDPFGSPMEFLDTALRSAKRRGIL 160 Query: 224 MCTATDMAVLCGGNGEVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLS 283 TATD A LCG + C KY + PLRG+ CHE+ RIL+ I +A +Y I+ +L+ Sbjct: 161 GVTATDGAPLCGAHPRACLRKYLAVPLRGELCHEVGTRILVGVIARYAAKYDLGIDVILA 220 Query: 284 VQMDFYVRVFVRIYTSASAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPG 343 D Y R FV++ A T KL Y+Y F L+ G Sbjct: 221 YYKDHYFRAFVKLKDGARKGDETLEKLGYIYFDDKTGKFELE----------------QG 264 Query: 344 FGPVVPQLCSDCGKKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTI 403 F P P N GP+W G + D++ V+ ++ E +S+ + +L I Sbjct: 265 FLPTRP----------NAYGPVWLGPLKDEKIVSKMVKEAESLS--LARKKQALKLLKMI 312 Query: 404 SEELPDVPLFLSLHNLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVI 463 +EL D+PLF H + LK + SA+ GY + TH +P G+KT AP V Sbjct: 313 DQEL-DIPLFYDTHAIGRRLKIETKKVEEIISALREQGYEATRTHFSPTGIKTSAPYEVF 371 Query: 464 WDIMR 468 + ++ Sbjct: 372 IETIK 376

PyMOL of 2dul

>pdb|3AXS|A Chain A, Complex Structure Of Trna Methyltransferase Trm1 From Aquifex Aeolicus With Sinefungin Length = 392

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		581
3axs_A		392	Probable N(2),N(2)-dimethylguanosine tRNA methylt	1e-113
3axs_A		392	Probable N(2),N(2)-dimethylguanosine tRNA methylt	4e-07
2dul_A		378	N(2),N(2)-dimethylguanosine tRNA methyltransferas;	1e-107
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	2e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-05
2yx1_A		336	Hypothetical protein MJ0883; methyl transferase, t	4e-07
2esr_A		177	Methyltransferase; structural genomics, hypothetic	4e-07
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	6e-07
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	7e-07
2i7c_A		283	Spermidine synthase; transferase, structural genom	3e-06
2pt6_A		321	Spermidine synthase; transferase, structural genom	4e-06
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	4e-06
2frn_A		278	Hypothetical protein PH0793; structural genomics,	6e-06
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	6e-06
4dmg_A		393	Putative uncharacterized protein TTHA1493; rRNA, m	1e-05
2b78_A		385	Hypothetical protein SMU.776; structure genomics,	2e-05
2o07_A		304	Spermidine synthase; structural genomics, structur	2e-05
1ws6_A		171	Methyltransferase; structural genomics, riken stru	2e-05
3ocj_A		305	Putative exported protein; structural genomics, PS	4e-05
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	7e-05
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	7e-05
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	8e-05
3c0k_A		396	UPF0064 protein YCCW; PUA domain, adoMet dependent	1e-04
3c3p_A		210	Methyltransferase; NP_951602.1, structural genomic	1e-04
3bwc_A		304	Spermidine synthase; SAM, SGPP, structura genomics	1e-04
3lpm_A		259	Putative methyltransferase; structural genomics, p	1e-04
1wxx_A		382	TT1595, hypothetical protein TTHA1280; thermus the	1e-04
3dr5_A		221	Putative O-methyltransferase; Q8NRD3, CGL1119, PF0	3e-04
3a27_A		272	TYW2, uncharacterized protein MJ1557; wybutosine m	3e-04
2ozv_A		260	Hypothetical protein ATU0636; structural genomics,	5e-04
2fhp_A		187	Methylase, putative; alpha-beta-alpha sandwich, st	6e-04

>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Length = 392	Back alignment and structure

 Score =  341 bits (876), Expect = e-113
 Identities = 87/364 (23%), Positives = 152/364 (41%), Gaps = 25/364 (6%)

Query: 121 KPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNIKFNGSVACSKVESH 180
           +P +V + LSASG+RA+R+  E   + +  A D    ++E  + N K N  +   + E H
Sbjct: 52  RPVKVADPLSASGIRAIRFLLETSCVEKAYANDISSKAIEIMKENFKLNN-IPEDRYEIH 110

Query: 181 LADARVYMLTHPKE-FDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGNGE 239
             +A  ++       FD VDLDP+G+P  F++S   S+  GG+L  TATD A L G   +
Sbjct: 111 GMEANFFLRKEWGFGFDYVDLDPFGTPVPFIESVALSMKRGGILSLTATDTAPLSGTYPK 170

Query: 240 VCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTS 299
            C  +Y + PLR ++ HE+ +RIL+  +   A +Y   + P+ +     Y ++F      
Sbjct: 171 TCMRRYMARPLRNEFKHEVGIRILIKKVIELAAQYDIAMIPIFAYSHLHYFKLFFVKERG 230

Query: 300 ASAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKKF 359
              +     +  Y+  C  C +  +                         + C  CG KF
Sbjct: 231 VEKVDKLIEQFGYIQYCFNCMNREVVT-----------------DLYKFKEKCPHCGSKF 273

Query: 360 NMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTISEELPDVPLFLSLHNL 419
           ++GGP+W G++ D+E+ N +  E +  ++      RI  ++    E       F  L  L
Sbjct: 274 HIGGPLWIGKLWDEEFTNFLYEEAQKREEIEKETKRILKLIK--EESQLQTVGFYVLSKL 331

Query: 420 CSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVKNHPVKAQ 479
              +K  +         +    +    TH    G +T+     +   M    +      +
Sbjct: 332 AEKVKLPAQP----PIRIAVKFFNGVRTHFVGDGFRTNLSFEEVMKKMEELKEKQKEFLE 387

Query: 480 LPDQ 483
              Q
Sbjct: 388 KKKQ 391

PyMOL of 3axs

>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Length = 392	Back alignment and structure

>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Length = 378	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Length = 189	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Length = 336	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Length = 177	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Length = 202	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Length = 296	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Length = 283	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Length = 321	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Length = 314	Back alignment and structure

>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} SCOP: c.66.1.47 PDB: 3k6r_A 3a25_A* 3a26_A* Length = 278	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Length = 275	Back alignment and structure

>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Length = 393	Back alignment and structure

>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Length = 385	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Length = 304	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Length = 171	Back alignment and structure

>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Length = 314	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Length = 201	Back alignment and structure

>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Length = 396	Back alignment and structure

>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210	Back alignment and structure

>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Length = 304	Back alignment and structure

>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259	Back alignment and structure

>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Length = 382	Back alignment and structure

>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Length = 221	Back alignment and structure

>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Length = 272	Back alignment and structure

>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260	Back alignment and structure

>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Length = 187	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		581
3axs_A		392	Probable N(2),N(2)-dimethylguanosine tRNA methylt	100.0
2dul_A		378	N(2),N(2)-dimethylguanosine tRNA methyltransferas;	100.0
3k6r_A		278	Putative transferase PH0793; structural genomics,	99.79
2b78_A		385	Hypothetical protein SMU.776; structure genomics,	99.72
4dmg_A		393	Putative uncharacterized protein TTHA1493; rRNA, m	99.69
2frn_A		278	Hypothetical protein PH0793; structural genomics,	99.65
2igt_A		332	SAM dependent methyltransferase; alpha-beta sandwi	99.64
3c0k_A		396	UPF0064 protein YCCW; PUA domain, adoMet dependent	99.64
2as0_A		396	Hypothetical protein PH1915; RNA methyltransferase	99.61
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	99.57
2yx1_A		336	Hypothetical protein MJ0883; methyl transferase, t	99.55
1wxx_A		382	TT1595, hypothetical protein TTHA1280; thermus the	99.54
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	99.47
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	99.43
3a27_A		272	TYW2, uncharacterized protein MJ1557; wybutosine m	99.42
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	99.36
3lpm_A		259	Putative methyltransferase; structural genomics, p	99.31
2esr_A		177	Methyltransferase; structural genomics, hypothetic	99.31
3ajd_A		274	Putative methyltransferase MJ0026; tRNA, M5C, ross	99.27
3bt7_A		369	TRNA (uracil-5-)-methyltransferase; methyluridine,	99.27
2fhp_A		187	Methylase, putative; alpha-beta-alpha sandwich, st	99.26
3evz_A		230	Methyltransferase; NYSGXRC, NEW YORK SGX research	99.24
3m4x_A		456	NOL1/NOP2/SUN family protein; mtase domain, PUA do	99.24
3m6w_A		464	RRNA methylase; rRNA methyltransferase, 5-methylcy	99.2
3dr5_A		221	Putative O-methyltransferase; Q8NRD3, CGL1119, PF0	99.18
3tfw_A		248	Putative O-methyltransferase; PSI-biology, nysgrc,	99.18
3eey_A		197	Putative rRNA methylase; rRNA methylation, S-adeno	99.18
1ws6_A		171	Methyltransferase; structural genomics, riken stru	99.17
3u81_A		221	Catechol O-methyltransferase; neurotransmitter deg	99.17
3tr6_A		225	O-methyltransferase; cellular processes; HET: SAH;	99.16
1ixk_A		315	Methyltransferase; open beta sheet; 1.90A {Pyrococ	99.14
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	99.14
1wy7_A		207	Hypothetical protein PH1948; seven-stranded beta s	99.14
2frx_A		479	Hypothetical protein YEBU; rossmann-type S-adenosy	99.13
3duw_A		223	OMT, O-methyltransferase, putative; alternating of	99.12
3njr_A		204	Precorrin-6Y methylase; methyltransferase, decarbo	99.11
2avd_A		229	Catechol-O-methyltransferase; structural genomics,	99.1
1sui_A		247	Caffeoyl-COA O-methyltransferase; rossmann fold, p	99.1
2jjq_A		425	Uncharacterized RNA methyltransferase pyrab10780;	99.1
2r6z_A		258	UPF0341 protein in RSP 3' region; alpha-beta prote	99.09
3c3y_A		237	Pfomt, O-methyltransferase; plant secondary metabo	99.07
3mti_A		185	RRNA methylase; SAM-dependent, PSI, MCSG, structur	99.07
3r3h_A		242	O-methyltransferase, SAM-dependent; structural gen	99.07
3e05_A		204	Precorrin-6Y C5,15-methyltransferase (decarboxyla;	99.07
3c3p_A		210	Methyltransferase; NP_951602.1, structural genomic	99.06
3ntv_A		232	MW1564 protein; rossmann fold, putative methyltran	99.06
1nv8_A		284	HEMK protein; class I adoMet-dependent methyltrans	99.05
2ozv_A		260	Hypothetical protein ATU0636; structural genomics,	99.05
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	99.05
3tma_A		354	Methyltransferase; thump domain; 2.05A {Thermus th	99.04
2qfm_A		364	Spermine synthase; spermidine aminopropyltransfera	99.04
3dxy_A		218	TRNA (guanine-N(7)-)-methyltransferase; rossmann f	99.03
1xdz_A		240	Methyltransferase GIDB; MCSG, protein structure in	99.02
2b9e_A		309	NOL1/NOP2/SUN domain family, member 5 isoform 2; m	99.01
2oo3_A		283	Protein involved in catabolism of external DNA; st	99.01
2o07_A		304	Spermidine synthase; structural genomics, structur	99.01
3hm2_A		178	Precorrin-6Y C5,15-methyltransferase; alpha-beta-s	99.0
3mb5_A		255	SAM-dependent methyltransferase; RNA methyltransfe	98.99
1mjf_A		281	Spermidine synthase; spermidine synthetase, struct	98.99
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	98.99
2pt6_A		321	Spermidine synthase; transferase, structural genom	98.99
1uwv_A		433	23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m	98.98
1yzh_A		214	TRNA (guanine-N(7)-)-methyltransferase; alpha-beta	98.97
3g89_A		249	Ribosomal RNA small subunit methyltransferase G; 1	98.97
2qm3_A		373	Predicted methyltransferase; putative methyltransf	98.96
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	98.96
2b3t_A		276	Protein methyltransferase HEMK; translation termin	98.96
3gdh_A		241	Trimethylguanosine synthase homolog; M7G, CAP, dim	98.96
1l3i_A		192	Precorrin-6Y methyltransferase/putative decarboxyl	98.96
4dzr_A		215	Protein-(glutamine-N5) methyltransferase, release	98.95
1o9g_A		250	RRNA methyltransferase; antibiotic resistance, Se-	98.94
4hc4_A		376	Protein arginine N-methyltransferase 6; HRMT1L6, S	98.94
3cbg_A		232	O-methyltransferase; cyanobacterium; HET: SAH FER	98.94
2gpy_A		233	O-methyltransferase; structural genomics, PSI, pro	98.94
4fzv_A		359	Putative methyltransferase NSUN4; mterf fold, meth	98.93
3kr9_A		225	SAM-dependent methyltransferase; class I rossmann-	98.93
2fca_A		213	TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac	98.92
2yxl_A		450	PH0851 protein, 450AA long hypothetical FMU protei	98.92
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	98.91
3lec_A		230	NADB-rossmann superfamily protein; PSI, MCSG, stru	98.91
2hnk_A		239	SAM-dependent O-methyltransferase; modified rossma	98.91
2vdv_E		246	TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl	98.91
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	98.9
1sqg_A		429	SUN protein, FMU protein; rossmann-fold, mixed bet	98.9
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	98.9
3dmg_A		381	Probable ribosomal RNA small subunit methyltransf;	98.9
1g8a_A		227	Fibrillarin-like PRE-rRNA processing protein; rRNA	98.89
4dcm_A		375	Ribosomal RNA large subunit methyltransferase G; 2	98.89
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	98.88
3ldg_A		384	Putative uncharacterized protein SMU.472; YPSC, me	98.88
3tm4_A		373	TRNA (guanine N2-)-methyltransferase TRM14; rossma	98.88
2yxd_A		183	Probable cobalt-precorrin-6Y C(15)-methyltransfer	98.88
3gjy_A		317	Spermidine synthase; APC62791, structural genomics	98.87
1xj5_A		334	Spermidine synthase 1; structural genomics, protei	98.87
2i7c_A		283	Spermidine synthase; transferase, structural genom	98.86
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	98.86
3ldu_A		385	Putative methylase; structural genomics, PSI-2, pr	98.85
3k0b_A		393	Predicted N6-adenine-specific DNA methylase; methy	98.85
2ipx_A		233	RRNA 2'-O-methyltransferase fibrillarin; FBL, stru	98.85
2nxc_A		254	L11 mtase, ribosomal protein L11 methyltransferase	98.85
1jsx_A		207	Glucose-inhibited division protein B; methyltransf	98.84
2f8l_A		344	Hypothetical protein LMO1582; structural genomics,	98.84
3gnl_A		244	Uncharacterized protein, DUF633, LMOF2365_1472; st	98.83
3bwc_A		304	Spermidine synthase; SAM, SGPP, structura genomics	98.83
2oyr_A		258	UPF0341 protein YHIQ; alpha-beta protein, structur	98.83
3grz_A		205	L11 mtase, ribosomal protein L11 methyltransferase	98.83
2h00_A		254	Methyltransferase 10 domain containing protein; st	98.81
1fbn_A		230	MJ fibrillarin homologue; MJ proteins, ribosomal R	98.81
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	98.8
3r0q_C		376	Probable protein arginine N-methyltransferase 4.2;	98.79
3orh_A		236	Guanidinoacetate N-methyltransferase; structura ge	98.78
3jwh_A		217	HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena	98.77
3ll7_A		410	Putative methyltransferase; methytransferase, stru	98.77
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	98.75
3bzb_A		281	Uncharacterized protein; RED ALGA, protein structu	98.72
1ne2_A		200	Hypothetical protein TA1320; structural genomics,	98.71
3dh0_A		219	SAM dependent methyltransferase; cystal structure,	98.71
3q7e_A		349	Protein arginine N-methyltransferase 1; HET: SAH;	98.71
3jwg_A		219	HEN1, methyltransferase type 12; 1.90A {Clostridiu	98.7
1zx0_A		236	Guanidinoacetate N-methyltransferase; structural g	98.7
3f4k_A		257	Putative methyltransferase; structural genomics, P	98.7
3lbf_A		210	Protein-L-isoaspartate O-methyltransferase; modifi	98.69
3m70_A		286	Tellurite resistance protein TEHB homolog; structu	98.67
3kkz_A		267	Uncharacterized protein Q5LES9; putative methyltra	98.67
4df3_A		233	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	98.67
2b25_A		336	Hypothetical protein; structural genomics, methyl	98.66
3hem_A		302	Cyclopropane-fatty-acyl-phospholipid synthase 2; p	98.65
1g6q_1		328	HnRNP arginine N-methyltransferase; SAM-binding do	98.65
2fyt_A		340	Protein arginine N-methyltransferase 3; structural	98.64
1i1n_A		226	Protein-L-isoaspartate O-methyltransferase; S-aden	98.64
2y1w_A		348	Histone-arginine methyltransferase CARM1; histone	98.64
4htf_A		285	S-adenosylmethionine-dependent methyltransferase;	98.62
2pbf_A		227	Protein-L-isoaspartate O-methyltransferase beta-A	98.61
2xvm_A		199	Tellurite resistance protein TEHB; antibiotic resi	98.61
3b3j_A		480	Histone-arginine methyltransferase CARM1; protein	98.61
1nkv_A		256	Hypothetical protein YJHP; structural genomics, PS	98.6
3ckk_A		235	TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-	98.6
3q87_B		170	N6 adenine specific DNA methylase; SAM-methyltrans	98.59
3id6_C		232	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	98.59
3ocj_A		305	Putative exported protein; structural genomics, PS	98.58
3dlc_A		219	Putative S-adenosyl-L-methionine-dependent methylt	98.58
3fpf_A		298	Mtnas, putative uncharacterized protein; thermonic	98.57
2ar0_A		541	M.ecoki, type I restriction enzyme ecoki M protein	98.57
1dl5_A		317	Protein-L-isoaspartate O-methyltransferase; isoasp	98.56
1ri5_A		298	MRNA capping enzyme; methyltransferase, M7G, messe	98.56
2cmg_A		262	Spermidine synthase; transferase, putrescine amino	98.56
3mgg_A		276	Methyltransferase; NYSGXRC, PSI-II, protein struct	98.55
1kpg_A		287	CFA synthase;, cyclopropane-fatty-acyl-phospholipi	98.55
2pjd_A		343	Ribosomal RNA small subunit methyltransferase C; g	98.55
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	98.54
1ve3_A		227	Hypothetical protein PH0226; dimer, riken structur	98.54
1jg1_A		235	PIMT;, protein-L-isoaspartate O-methyltransferase;	98.53
3vc1_A		312	Geranyl diphosphate 2-C-methyltransferase; rossman	98.53
1nt2_A		210	Fibrillarin-like PRE-rRNA processing protein; adeM	98.52
3gu3_A		284	Methyltransferase; alpha-beta protein, structural	98.52
3g5t_A		299	Trans-aconitate 3-methyltransferase; structural ge	98.51
2fk8_A		318	Methoxy mycolic acid synthase 4; S-adenosylmethion	98.5
1xxl_A		239	YCGJ protein; structural genomics, protein structu	98.48
2okc_A		445	Type I restriction enzyme stysji M protein; NP_813	98.47
2yxe_A		215	Protein-L-isoaspartate O-methyltransferase; rossma	98.46
3sm3_A		235	SAM-dependent methyltransferases; NESG, structural	98.44
3g07_A		292	7SK snRNA methylphosphate capping enzyme; structur	98.44
2ex4_A		241	Adrenal gland protein AD-003; methyltransferase, s	98.44
3ofk_A		216	Nodulation protein S; NODS, N-methyltransferase, S	98.44
3lcc_A		235	Putative methyl chloride transferase; halide methy	98.43
3bus_A		273	REBM, methyltransferase; rebeccamycin synthesis; H	98.43
1wzn_A		252	SAM-dependent methyltransferase; structural genomi	98.43
4gek_A		261	TRNA (CMO5U34)-methyltransferase; structural genom	98.43
3o4f_A		294	Spermidine synthase; aminopropyltransferase, polya	98.42
3lkd_A		542	Type I restriction-modification system methyltrans	98.42
3g5l_A		253	Putative S-adenosylmethionine dependent methyltran	98.42
4fsd_A		383	Arsenic methyltransferase; rossmann fold; 1.75A {C	98.41
3i9f_A		170	Putative type 11 methyltransferase; structural gen	98.41
2o57_A		297	Putative sarcosine dimethylglycine methyltransfera	98.4
3uwp_A		438	Histone-lysine N-methyltransferase, H3 lysine-79;	98.4
2kw5_A		202	SLR1183 protein; structural genomics, northeast st	98.4
3khk_A		544	Type I restriction-modification system methylation	98.4
1vl5_A		260	Unknown conserved protein BH2331; putative methylt	98.4
1vbf_A		231	231AA long hypothetical protein-L-isoaspartate O-	98.39
1r18_A		227	Protein-L-isoaspartate(D-aspartate)-O-methyltrans;	98.38
2pxx_A		215	Uncharacterized protein MGC2408; structural genomi	98.38
1u2z_A		433	Histone-lysine N-methyltransferase, H3 lysine-79 s	98.37
3d2l_A		243	SAM-dependent methyltransferase; ZP_00538691.1, st	98.36
3dtn_A		234	Putative methyltransferase MM_2633; structural gen	98.36
2gb4_A		252	Thiopurine S-methyltransferase; 18204406, thiopuri	98.35
3thr_A		293	Glycine N-methyltransferase; GNMT, folate, methylt	98.34
3m33_A		226	Uncharacterized protein; structural genomics, PSI-	98.32
3h2b_A		203	SAM-dependent methyltransferase; alpha-beta protei	98.32
3cgg_A		195	SAM-dependent methyltransferase; NP_600671.1, meth	98.31
3dli_A		240	Methyltransferase; PSI-II, NYSGXRC, structural gen	98.29
3l8d_A		242	Methyltransferase; structural genomics, PSI, nysgr	98.28
3bkw_A		243	MLL3908 protein, S-adenosylmethionine dependent me	98.28
2ih2_A		421	Modification methylase TAQI; DNA, DNA methyltransf	98.27
2p7i_A		250	Hypothetical protein; putative methyltransferase,	98.27
2p8j_A		209	S-adenosylmethionine-dependent methyltransferase;	98.27
3fzg_A		200	16S rRNA methylase; methyltransferase, plasmid, tr	98.27
3e8s_A		227	Putative SAM dependent methyltransferase; NP_74470	98.26
1y8c_A		246	S-adenosylmethionine-dependent methyltransferase;	98.26
3ou2_A		218	SAM-dependent methyltransferase; O-methyltransfera	98.26
3e23_A		211	Uncharacterized protein RPA2492; alpha-beta protei	98.26
1xtp_A		254	LMAJ004091AAA; SGPP, structural genomics, PSI, pro	98.25
3hnr_A		220	Probable methyltransferase BT9727_4108; structural	98.25
1m6y_A		301	S-adenosyl-methyltransferase MRAW; SAM-dependent m	98.25
2bm8_A		236	Cephalosporin hydroxylase CMCI; cephamycin biosynt	98.24
3s1s_A		878	Restriction endonuclease bpusi; PD--(D/E)XK cataly	98.24
3g2m_A		299	PCZA361.24; SAM-dependent methyltransferase, glyco	98.24
1pjz_A		203	Thiopurine S-methyltransferase; polymorphism, S-ad	98.23
2p35_A		259	Trans-aconitate 2-methyltransferase; SAM dependent	98.22
3bgv_A		313	MRNA CAP guanine-N7 methyltransferase; alternative	98.19
2vdw_A		302	Vaccinia virus capping enzyme D1 subunit; nucleoti	98.19
3mq2_A		218	16S rRNA methyltransferase; methyltranferase, ribo	98.18
3ujc_A		266	Phosphoethanolamine N-methyltransferase; parasite;	98.17
2yqz_A		263	Hypothetical protein TTHA0223; RNA methyltransfera	98.17
2i62_A		265	Nicotinamide N-methyltransferase; structural genom	98.17
3bkx_A		275	SAM-dependent methyltransferase; YP_807781.1, cycl	98.16
2a14_A		263	Indolethylamine N-methyltransferase; SGC,INMT, str	98.15
3pfg_A		263	N-methyltransferase; N,N-dimethyltransferase, SAM	98.15
2r3s_A		335	Uncharacterized protein; methyltransferase domain,	98.14
3iv6_A		261	Putative Zn-dependent alcohol dehydrogenase; alpha	98.13
3ggd_A		245	SAM-dependent methyltransferase; YP_325210.1, stru	98.12
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	98.11
2h1r_A		299	Dimethyladenosine transferase, putative; SGC toron	98.09
1qzz_A		374	RDMB, aclacinomycin-10-hydroxylase; anthracycline,	98.08
2gs9_A		211	Hypothetical protein TT1324; methyl transferase, s	98.08
3p2e_A		225	16S rRNA methylase; methyltransferase, transferase	98.07
3bxo_A		239	N,N-dimethyltransferase; desosamine, sugar, carboh	98.06
1tw3_A		360	COMT, carminomycin 4-O-methyltransferase; anthracy	98.0
4gqb_A		637	Protein arginine N-methyltransferase 5; TIM barrel	97.99
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	97.97
1zq9_A		285	Probable dimethyladenosine transferase; SGC, struc	97.94
3opn_A		232	Putative hemolysin; structural genomics, PSI-2, pr	97.93
3htx_A		950	HEN1; HEN1, small RNA methyltransferase, protein-R	97.92
3ccf_A		279	Cyclopropane-fatty-acyl-phospholipid synthase; YP_	97.92
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	97.91
3ege_A		261	Putative methyltransferase from antibiotic biosyn	97.91
3cvo_A		202	Methyltransferase-like protein of unknown functio;	97.89
3c6k_A		381	Spermine synthase; spermidine aminopropyltransfera	97.88
2ip2_A		334	Probable phenazine-specific methyltransferase; pyo	97.88
3ua3_A		745	Protein arginine N-methyltransferase 5; TIM-barrel	97.88
3cc8_A		230	Putative methyltransferase; structural genomics, j	97.87
3dp7_A		363	SAM-dependent methyltransferase; structural genomi	97.87
1x19_A		359	CRTF-related protein; methyltransferase, bacterioc	97.87
2avn_A		260	Ubiquinone/menaquinone biosynthesis methyltransfe	97.85
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	97.83
1p91_A		269	Ribosomal RNA large subunit methyltransferase A; R	97.82
3hp7_A		291	Hemolysin, putative; structural genomics, APC64019	97.82
2qy6_A		257	UPF0209 protein YFCK; structural genomics, unknown	97.82
3mcz_A		352	O-methyltransferase; adomet_mtases, S-adenosylmeth	97.8
3i53_A		332	O-methyltransferase; CO-complex, rossmann-like fol	97.79
3gwz_A		369	MMCR; methyltransferase, mitomycin, S-adenosyl met	97.78
3lcv_B		281	Sisomicin-gentamicin resistance methylase SGM; ant	97.77
2c7p_A		327	Modification methylase HHAI; DNA methyltransferase	97.7
1g55_A		343	DNA cytosine methyltransferase DNMT2; human DNA me	97.69
2aot_A		292	HMT, histamine N-methyltransferase; classic methyl	97.68
1vlm_A		219	SAM-dependent methyltransferase; possible histamin	97.66
4azs_A		569	Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15	97.66
3g7u_A		376	Cytosine-specific methyltransferase; DNA-binding,	97.62
3frh_A		253	16S rRNA methylase; methyltransferase domain, heli	97.61
4hg2_A		257	Methyltransferase type 11; structural genomics, PS	97.58
1qam_A		244	ERMC' methyltransferase; rRNA methyltransferase ER	97.57
2g72_A		289	Phenylethanolamine N-methyltransferase; HET: SAM F	97.57
3ufb_A		530	Type I restriction-modification system methyltran	97.53
3gru_A		295	Dimethyladenosine transferase; rossman fold, ribos	97.51
4e2x_A		416	TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s	97.49
2qe6_A		274	Uncharacterized protein TFU_2867; putative methylt	97.45
1yub_A		245	Ermam, rRNA methyltransferase; MLS antibiotics; NM	97.4
3fut_A		271	Dimethyladenosine transferase; methyltransferase,	97.36
2xyq_A		290	Putative 2'-O-methyl transferase; transferase-vira	97.3
1af7_A		274	Chemotaxis receptor methyltransferase CHER; chemot	97.28
3ftd_A		249	Dimethyladenosine transferase; KSGA, rossmann-like	97.27
2zfu_A		215	Nucleomethylin, cerebral protein 1; nucleolar prot	97.26
3tqs_A		255	Ribosomal RNA small subunit methyltransferase A; p	97.26
2wa2_A		276	Non-structural protein 5; transferase, S-adenosyl-	97.23
2oxt_A		265	Nucleoside-2'-O-methyltransferase; flavivirus, vir	97.17
2wk1_A		282	NOVP; transferase, O-methyltransferase, novobiocin	97.14
3sso_A		419	Methyltransferase; macrolide, natural product, ros	97.11
3lst_A		348	CALO1 methyltransferase; calicheamicin, enediyne,	97.0
3p8z_A		267	Mtase, non-structural protein 5; methyltransferase	96.92
2p41_A		305	Type II methyltransferase; vizier, viral enzymes i	96.89
1g60_A		260	Adenine-specific methyltransferase MBOIIA; structu	96.87
2qrv_A		295	DNA (cytosine-5)-methyltransferase 3A; DNA methylt	96.87
3ubt_Y		331	Modification methylase HAEIII; protein-DNA complex	96.63
2zig_A		297	TTHA0409, putative modification methylase; methylt	96.52
3me5_A		482	Cytosine-specific methyltransferase; structural ge	96.47
4h0n_A		333	DNMT2; SAH binding, transferase; HET: SAH; 2.71A {	96.44
1wg8_A		285	Predicted S-adenosylmethionine-dependent methyltra	96.36
1fp2_A		352	Isoflavone O-methyltransferase; protein-product co	96.3
3qv2_A		327	5-cytosine DNA methyltransferase; DNMT2, ehmeth; H	96.29
4a6d_A		353	Hydroxyindole O-methyltransferase; melatonin, circ	96.27
1fp1_D		372	Isoliquiritigenin 2'-O-methyltransferase; protein-	96.13
3lkz_A		321	Non-structural protein 5; flavivirus, methyltransf	96.05
1qyr_A		252	KSGA, high level kasugamycin resistance protein, S	95.97
3giw_A		277	Protein of unknown function DUF574; rossmann-fold	95.87
3reo_A		368	(ISO)eugenol O-methyltransferase; directed evoluti	95.7
1g60_A		260	Adenine-specific methyltransferase MBOIIA; structu	95.68
3uzu_A		279	Ribosomal RNA small subunit methyltransferase A; s	95.64
3p9c_A		364	Caffeic acid O-methyltransferase; S-adenosylmethio	95.5
2ld4_A		176	Anamorsin; methyltransferase-like fold, alpha/beta	95.49
1zg3_A		358	Isoflavanone 4'-O-methyltransferase; rossman fold,	95.42
1boo_A		323	Protein (N-4 cytosine-specific methyltransferase P	95.19
1eg2_A		319	Modification methylase RSRI; rossmann fold, exocyc	95.16
2zig_A		297	TTHA0409, putative modification methylase; methylt	95.16
1boo_A		323	Protein (N-4 cytosine-specific methyltransferase P	94.53
3swr_A		1002	DNA (cytosine-5)-methyltransferase 1; epigenetics,	94.51
3vyw_A		308	MNMC2; tRNA wobble uridine, modification enzyme, g	94.17
3tka_A		347	Ribosomal RNA small subunit methyltransferase H; H	94.12
4ft4_B		784	DNA (cytosine-5)-methyltransferase 1; chromodomain	93.79
3evf_A		277	RNA-directed RNA polymerase NS5; NS5 methyltransfe	93.59
3av4_A		1330	DNA (cytosine-5)-methyltransferase 1; CXXC-type zi	93.05
4auk_A		375	Ribosomal RNA large subunit methyltransferase M; Y	91.94
2k4m_A		153	TR8_protein, UPF0146 protein MTH_1000; alpha+beta,	91.92
1eg2_A		319	Modification methylase RSRI; rossmann fold, exocyc	91.71
3pvc_A		689	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	91.68
3gcz_A		282	Polyprotein; flavivirus, RNA capping, methyltransf	91.4
2py6_A		409	Methyltransferase FKBM; YP_546752.1, structural ge	91.24
1pl8_A		356	Human sorbitol dehydrogenase; NAD, oxidoreductase;	91.1
4dkj_A		403	Cytosine-specific methyltransferase; CG-specificit	90.93
3eld_A		300	Methyltransferase; flavivirus, RNA capping, guanyl	90.92
3fpc_A		352	NADP-dependent alcohol dehydrogenase; oxydoreducta	90.56
2px2_A		269	Genome polyprotein [contains: capsid protein C (co	90.0
3s2e_A		340	Zinc-containing alcohol dehydrogenase superfamily;	89.76
1f8f_A		371	Benzyl alcohol dehydrogenase; rossmann fold, oxido	89.62
3ps9_A		676	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	89.43
1kol_A		398	Formaldehyde dehydrogenase; oxidoreductase; HET: N	89.42
4ej6_A		370	Putative zinc-binding dehydrogenase; structural ge	89.3
2dph_A		398	Formaldehyde dismutase; dismutation of aldehydes,	89.11
3ip1_A		404	Alcohol dehydrogenase, zinc-containing; structural	88.16
3fbg_A		346	Putative arginate lyase; structural genomics, unkn	88.12
3m6i_A		363	L-arabinitol 4-dehydrogenase; medium chain dehydro	87.57
1uuf_A		369	YAHK, zinc-type alcohol dehydrogenase-like protein	86.4
2jhf_A		374	Alcohol dehydrogenase E chain; oxidoreductase, met	85.62
1e3j_A		352	NADP(H)-dependent ketose reductase; oxidoreductase	85.53
3uko_A		378	Alcohol dehydrogenase class-3; alcohol dehydrogena	85.49
1p0f_A		373	NADP-dependent alcohol dehydrogenase; ADH topology	85.43
2c0c_A		362	Zinc binding alcohol dehydrogenase, domain contain	85.26
1e3i_A		376	Alcohol dehydrogenase, class II; HET: NAD; 2.08A {	84.88
2fzw_A		373	Alcohol dehydrogenase class III CHI chain; S-nitro	84.83
3qwb_A		334	Probable quinone oxidoreductase; rossmann fold, qu	84.47
1cdo_A		374	Alcohol dehydrogenase; oxidoreductase, oxidoreduct	84.35
3uog_A		363	Alcohol dehydrogenase; structural genomics, protei	84.3
1pqw_A		198	Polyketide synthase; rossmann fold, dimer, structu	83.91
2kdx_A		119	HYPA, hydrogenase/urease nickel incorporation prot	83.78
1i4w_A		353	Mitochondrial replication protein MTF1; mitochondr	83.6
3pi7_A		349	NADH oxidoreductase; groes-like fold, NAD(P)-bindi	83.57
1vj0_A		380	Alcohol dehydrogenase, zinc-containing; TM0436, st	83.35
3two_A		348	Mannitol dehydrogenase; cinnamyl-alcohol dehydroge	83.13
3jv7_A		345	ADH-A; dehydrogenase, nucleotide binding, rossmann	83.11
4dvj_A		363	Putative zinc-dependent alcohol dehydrogenase Pro;	83.07
3jyn_A		325	Quinone oxidoreductase; rossmann fold, protein-NAD	82.88
3a43_A		139	HYPD, hydrogenase nickel incorporation protein HYP	82.81
4a2c_A		346	Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc	82.78
1rjw_A		339	ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD	82.46
4dup_A		353	Quinone oxidoreductase; PSI-biology, structural ge	82.32
2h6e_A		344	ADH-4, D-arabinose 1-dehydrogenase; rossman fold,	82.32
3eod_A		130	Protein HNR; response regulator, phosphoprotein, t	81.97
3gms_A		340	Putative NADPH:quinone reductase; structural genom	81.96
1wly_A		333	CAAR, 2-haloacrylate reductase; NADPH-dependent ox	81.87
2d8a_A		348	PH0655, probable L-threonine 3-dehydrogenase; pyro	81.56
2b5w_A		357	Glucose dehydrogenase; nucleotide binding motif, o	81.05
2eih_A		343	Alcohol dehydrogenase; zinc ION binding protein, s	81.05
3nx4_A		324	Putative oxidoreductase; csgid, structural genomic	80.92
4b7c_A		336	Probable oxidoreductase; NADP cofactor, rossmann f	80.33

>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A*	Back alignment and structure

Probab=100.00  E-value=5.3e-92  Score=750.95  Aligned_cols=370  Identities=27%  Similarity=0.460  Sum_probs=342.2

Q ss_pred             eEEEeeeEEEEecCC-------CCccccccchhhhhHHHHHHHHHHHHhHHHHHHhhhhccCCCCCCCccCCCCCCCCcc
Q 047386            8 TIIKEGEAEILMHAK-------NEVFYNKTQVNNRDISIAVMRAFISKRNQEHEAMLSKRTTSAPKASEKDGEEEAPDES   80 (581)
Q Consensus         8 ~~i~EG~a~I~~p~~-------~~VFYNPvq~fNRDlSV~vi~~f~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~   80 (581)
                      ++|+||.++|.+|..       ..|||||.|++|||+++++++.|...++                              
T Consensus         2 ~~i~E~g~~~~v~~~~~~~~~~~~~Ffn~~~~~nR~l~~~~~~~~~~~~~------------------------------   51 (392)
T 3axs_A            2 EIVQEGIAKIIVPEIPKTVSSDMPVFYNPRMRVNRDLAVLGLEYLCKKLG------------------------------   51 (392)
T ss_dssp             EEEEETTEEEEECCCCSSCCTTCCSSCCGGGHHHHHHHHHHHHHHHHHHC------------------------------
T ss_pred             eEEEECCEEEEEecccccccCCCCEEEcCCcHHHHHHHHHHHHHHhhccC------------------------------
Confidence            579999999999864       4799999999999999999998753210                              


Q ss_pred             ccccCCCCCcCCcccccCCCCccccccccCccchhcccCCCCCeEEEecCcccHHHHHHhhhcCCccEEEEEeCCHHHHH
Q 047386           81 VVNENSNGEIERPAEISQDEPCCISEEAVKPTERNVLRQLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVE  160 (581)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLDafsgSG~rgIr~a~E~~Ga~~V~anD~s~~Ave  160 (581)
                                                              .+.+|||+|||||++||++|++.+||.+|++||+|+.|++
T Consensus        52 ----------------------------------------~g~~VLDlfaGtG~~sl~aa~~~~ga~~V~avDi~~~av~   91 (392)
T 3axs_A           52 ----------------------------------------RPVKVADPLSASGIRAIRFLLETSCVEKAYANDISSKAIE   91 (392)
T ss_dssp             ----------------------------------------SCEEEEESSCTTSHHHHHHHHHCSCEEEEEEECSCHHHHH
T ss_pred             ----------------------------------------CCCEEEECCCcccHHHHHHHHhCCCCCEEEEEECCHHHHH
Confidence                                                    1348999999999999999998778999999999999999


Q ss_pred             HHHHHHHHhCCCCCCc-EEEEehhHHHHHh-hCCCcccEEeeCCCCCChHhHHHHHHhccCCCeEEEEeccchhhcCCCc
Q 047386          161 ACRRNIKFNGSVACSK-VESHLADARVYML-THPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDMAVLCGGNG  238 (581)
Q Consensus       161 ~i~~Ni~~N~~~~~~~-v~v~~~DA~~~l~-~~~~~fDvIdLDPyGs~~~fld~A~~~l~~gGlL~vTaTD~a~Lcg~~~  238 (581)
                      .+++|+++|+++  ++ ++++++||+.+|. ....+||+|++||||++.+|++.|+++|++||+|++||||+++|||+.+
T Consensus        92 ~~~~N~~~Ngl~--~~~v~v~~~Da~~~l~~~~~~~fD~V~lDP~g~~~~~l~~a~~~Lk~gGll~~t~t~~~~l~g~~~  169 (392)
T 3axs_A           92 IMKENFKLNNIP--EDRYEIHGMEANFFLRKEWGFGFDYVDLDPFGTPVPFIESVALSMKRGGILSLTATDTAPLSGTYP  169 (392)
T ss_dssp             HHHHHHHHTTCC--GGGEEEECSCHHHHHHSCCSSCEEEEEECCSSCCHHHHHHHHHHEEEEEEEEEEECCHHHHTTSSH
T ss_pred             HHHHHHHHhCCC--CceEEEEeCCHHHHHHHhhCCCCcEEEECCCcCHHHHHHHHHHHhCCCCEEEEEecchhhhccccH
Confidence            999999999996  45 9999999999997 6556899999999999989999999999999999999999999999999


Q ss_pred             chhhhhccCccCCCccchhhhHHHHHHHHHHHHHHcCCceEEEeecccCceEEEEEEEEcChhhhccccccceEEEEcCC
Q 047386          239 EVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTSASAMKSTPLKLSYVYQCIG  318 (581)
Q Consensus       239 ~~c~rkYG~~~~k~~~~hE~~lRill~~i~~~Aa~~~r~i~Plls~s~dhY~RvfVrV~~~~~~~k~~~~k~g~v~~C~~  318 (581)
                      ..|+|+||..|.+.+|+||+++|++|+.++++|+++++.|+|+||++.|||+||||||.+|+.+++++++++||+|||++
T Consensus       170 ~~~~rkYg~~p~r~~~~~e~~~r~~L~~~~~~a~~~~~~i~P~l~~~~~~y~Rv~vrv~~~~~~~~~~~~~~g~v~~C~~  249 (392)
T 3axs_A          170 KTCMRRYMARPLRNEFKHEVGIRILIKKVIELAAQYDIAMIPIFAYSHLHYFKLFFVKERGVEKVDKLIEQFGYIQYCFN  249 (392)
T ss_dssp             HHHHHHHSSBCCCSTTHHHHHHHHHHHHHHHHHHTTTEEEEEEEEEEETTEEEEEEEEEECHHHHHHHHTTEEEEEECTT
T ss_pred             HHHHHHhCCcccccccccchhHHHHHHHHHHhcccCCCeEEeeEEEEeCcEEEEEEEEecCHHHHHHHHHhcceEEECCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceeEeeccccccCCCCcccccCCCCCCCCCcCCCCCCcccccccccccCCCCHHHHHHHHHHhhhcccCCCcHHHHHH
Q 047386          319 CDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISA  398 (581)
Q Consensus       319 C~~~~~q~lgr~~~~~~~~~~~~~~~~~~~~~~C~~Cg~~~~~~GPlW~GpLhd~~fv~~ml~~~~~~~~~~~t~~ri~~  398 (581)
                      |++|+++..                . +.++..|++||++++++||||+|||||++||++||+.+++.  .|+| +|+.+
T Consensus       250 C~~~~~~~~----------------~-~~~~~~C~~cg~~~~~~GPlW~g~l~d~~fv~~~l~~~~~~--~~~~-~~~~~  309 (392)
T 3axs_A          250 CMNREVVTD----------------L-YKFKEKCPHCGSKFHIGGPLWIGKLWDEEFTNFLYEEAQKR--EEIE-KETKR  309 (392)
T ss_dssp             TCCEEEECC----------------G-GGCCSBCTTTCSBCEEEEEEECSCSCCHHHHHHHHHHHHTC--TTSC-HHHHH
T ss_pred             CCCeEeecC----------------C-CCCCCcCCCCCCccceecccccCcCCCHHHHHHHHHHhhhc--ccch-HHHHH
Confidence            999887511                1 23567899999999999999999999999999999998753  4778 99999


Q ss_pred             HHHHHHhhCCCCCc--eeeHHHHhhhcCCCCC-CHHHHHHHHHHCCceEEecccCCCccccCCCHHHHHHHHHHHHHhCC
Q 047386          399 VLTTISEELPDVPL--FLSLHNLCSTLKCTSP-SAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMRCWVKNHP  475 (581)
Q Consensus       399 lL~~~~eEl~~~P~--yy~l~~l~~~lk~~~P-~~~~~~~aL~~~GY~aSrTH~~p~~iKTdAP~~~i~di~r~w~~~~p  475 (581)
                      ||+++.+|+ +.|+  ||++|+||+++|+++| +++.|+     +||+||+||++|+|||||||+++||||||+|++++.
T Consensus       310 lL~~~~~E~-~~p~~~~y~~~~l~~~~~~~~p~~~~~~~-----~Gy~~s~tH~~p~~iKTdAp~~~i~~i~~~~~~~~~  383 (392)
T 3axs_A          310 ILKLIKEES-QLQTVGFYVLSKLAEKVKLPAQPPIRIAV-----KFFNGVRTHFVGDGFRTNLSFEEVMKKMEELKEKQK  383 (392)
T ss_dssp             HHHHHHHHH-TSCCSSCEEHHHHHHHHTCSCCCCHHHHH-----HHTTCEECTTSTTEEECSSCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHh-cCCccceEcHHHHHHHcCCCCCCCHHHHh-----cCcEEEeeccCCCcEeccCCHHHHHHHHHHHHHhch
Confidence            999999999 6898  9999999999999999 999999     999999999999999999999999999999998643

PyMOL of 3axs

>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A*	Back alignment and structure

>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A*	Back alignment and structure

>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A*	Back alignment and structure

>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus}	Back alignment and structure

>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A*	Back alignment and structure

>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51	Back alignment and structure

>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12}	Back alignment and structure

>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A*	Back alignment and structure

>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A*	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46	Back alignment and structure

>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46	Back alignment and structure

>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46	Back alignment and structure

>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A	Back alignment and structure

>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli}	Back alignment and structure

>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46	Back alignment and structure

>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus}	Back alignment and structure

>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium}	Back alignment and structure

>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A*	Back alignment and structure

>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}	Back alignment and structure

>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46	Back alignment and structure

>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ...	Back alignment and structure

>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17	Back alignment and structure

>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32	Back alignment and structure

>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli}	Back alignment and structure

>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A*	Back alignment and structure

>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus}	Back alignment and structure

>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1	Back alignment and structure

>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A*	Back alignment and structure

>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A*	Back alignment and structure

>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae}	Back alignment and structure

>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum}	Back alignment and structure

>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A*	Back alignment and structure

>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp}	Back alignment and structure

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0	Back alignment and structure

>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca}	Back alignment and structure

>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus}	Back alignment and structure

>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*	Back alignment and structure

>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str}	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*	Back alignment and structure

>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus}	Back alignment and structure

>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A*	Back alignment and structure

>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20	Back alignment and structure

>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38	Back alignment and structure

>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A*	Back alignment and structure

>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}	Back alignment and structure

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*	Back alignment and structure

>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A*	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A*	Back alignment and structure

>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A*	Back alignment and structure

>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53	Back alignment and structure

>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A*	Back alignment and structure

>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13	Back alignment and structure

>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*	Back alignment and structure

>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A*	Back alignment and structure

>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*	Back alignment and structure

>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A	Back alignment and structure

>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens}	Back alignment and structure

>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP}	Back alignment and structure

>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans}	Back alignment and structure

>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A*	Back alignment and structure

>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A*	Back alignment and structure

>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53	Back alignment and structure

>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii}	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae}	Back alignment and structure

>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans}	Back alignment and structure

>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus}	Back alignment and structure

>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A*	Back alignment and structure

>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*	Back alignment and structure

>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A	Back alignment and structure

>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli}	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17	Back alignment and structure

>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans}	Back alignment and structure

>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A*	Back alignment and structure

>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii}	Back alignment and structure

>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A*	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13	Back alignment and structure

>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile}	Back alignment and structure

>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}	Back alignment and structure

>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*	Back alignment and structure

>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20	Back alignment and structure

>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45	Back alignment and structure

>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A*	Back alignment and structure

>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A	Back alignment and structure

>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp}	Back alignment and structure

>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54	Back alignment and structure

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus}	Back alignment and structure

>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana}	Back alignment and structure

>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A	Back alignment and structure

>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis}	Back alignment and structure

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13	Back alignment and structure

>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae}	Back alignment and structure

>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32	Back alignment and structure

>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}	Back alignment and structure

>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A*	Back alignment and structure

>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A	Back alignment and structure

>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A*	Back alignment and structure

>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli}	Back alignment and structure

>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}	Back alignment and structure

>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A*	Back alignment and structure

>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix}	Back alignment and structure

>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13	Back alignment and structure

>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A*	Back alignment and structure

>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6	Back alignment and structure

>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A*	Back alignment and structure

>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*	Back alignment and structure

>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A	Back alignment and structure

>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli}	Back alignment and structure

>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum}	Back alignment and structure

>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A*	Back alignment and structure

>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus}	Back alignment and structure

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21	Back alignment and structure

>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens}	Back alignment and structure

>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}	Back alignment and structure

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E*	Back alignment and structure

>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis}	Back alignment and structure

>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}	Back alignment and structure

>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A*	Back alignment and structure

>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B*	Back alignment and structure

>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1	Back alignment and structure

>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*	Back alignment and structure

>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A	Back alignment and structure

>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei}	Back alignment and structure

>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A*	Back alignment and structure

>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A*	Back alignment and structure

>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A*	Back alignment and structure

>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3	Back alignment and structure

>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A	Back alignment and structure

>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae}	Back alignment and structure

>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*	Back alignment and structure

>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*	Back alignment and structure

>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45	Back alignment and structure

>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei}	Back alignment and structure

>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens}	Back alignment and structure

>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42	Back alignment and structure

>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*	Back alignment and structure

>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}	Back alignment and structure

>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A*	Back alignment and structure

>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli}	Back alignment and structure

>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus}	Back alignment and structure

>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}	Back alignment and structure

>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A	Back alignment and structure

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18	Back alignment and structure

>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A*	Back alignment and structure

>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A	Back alignment and structure

>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei}	Back alignment and structure

>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41	Back alignment and structure

>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7	Back alignment and structure

>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7	Back alignment and structure

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}	Back alignment and structure

>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31	Back alignment and structure

>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}	Back alignment and structure

>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*	Back alignment and structure

>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*	Back alignment and structure

>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}	Back alignment and structure

>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}	Back alignment and structure

>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis}	Back alignment and structure

>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A*	Back alignment and structure

>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A	Back alignment and structure

>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli}	Back alignment and structure

>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440}	Back alignment and structure

>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43	Back alignment and structure

>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*	Back alignment and structure

>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}	Back alignment and structure

>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42	Back alignment and structure

>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian}	Back alignment and structure

>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A*	Back alignment and structure

>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A*	Back alignment and structure

>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus}	Back alignment and structure

>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A*	Back alignment and structure

>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36	Back alignment and structure

>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str}	Back alignment and structure

>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A*	Back alignment and structure

>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus}	Back alignment and structure

>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP}	Back alignment and structure

>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A*	Back alignment and structure

>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A	Back alignment and structure

>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A*	Back alignment and structure

>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei}	Back alignment and structure

>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15	Back alignment and structure

>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A*	Back alignment and structure

>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme}	Back alignment and structure

>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides}	Back alignment and structure

>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413}	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum}	Back alignment and structure

>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A*	Back alignment and structure

>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus}	Back alignment and structure

>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A*	Back alignment and structure

>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae}	Back alignment and structure

>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A*	Back alignment and structure

>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A*	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0	Back alignment and structure

>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24	Back alignment and structure

>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp}	Back alignment and structure

>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana}	Back alignment and structure

>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens}	Back alignment and structure

>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3}	Back alignment and structure

>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A*	Back alignment and structure

>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa}	Back alignment and structure

>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A	Back alignment and structure

>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus}	Back alignment and structure

>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus}	Back alignment and structure

>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A*	Back alignment and structure

>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum}	Back alignment and structure

>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33	Back alignment and structure

>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus}	Back alignment and structure

>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli}	Back alignment and structure

>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A*	Back alignment and structure

>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A*	Back alignment and structure

>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A*	Back alignment and structure

>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ...	Back alignment and structure

>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26	Back alignment and structure

>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A*	Back alignment and structure

>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A*	Back alignment and structure

>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157}	Back alignment and structure

>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A*	Back alignment and structure

>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans}	Back alignment and structure

>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A	Back alignment and structure

>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ...	Back alignment and structure

>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus}	Back alignment and structure

>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A*	Back alignment and structure

>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A*	Back alignment and structure

>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca}	Back alignment and structure

>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24	Back alignment and structure

>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A*	Back alignment and structure

>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A*	Back alignment and structure

>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A*	Back alignment and structure

>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B*	Back alignment and structure

>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens}	Back alignment and structure

>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A*	Back alignment and structure

>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus}	Back alignment and structure

>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus}	Back alignment and structure

>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A*	Back alignment and structure

>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora}	Back alignment and structure

>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A*	Back alignment and structure

>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A*	Back alignment and structure

>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11	Back alignment and structure

>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens}	Back alignment and structure

>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A*	Back alignment and structure

>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A	Back alignment and structure

>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A	Back alignment and structure

>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda}	Back alignment and structure

>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23	Back alignment and structure

>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A*	Back alignment and structure

>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica}	Back alignment and structure

>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A*	Back alignment and structure

>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A*	Back alignment and structure

>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus}	Back alignment and structure

>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A	Back alignment and structure

>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A*	Back alignment and structure

>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A*	Back alignment and structure

>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11	Back alignment and structure

>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei}	Back alignment and structure

>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A*	Back alignment and structure

>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A	Back alignment and structure

>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A*	Back alignment and structure

>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11	Back alignment and structure

>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A	Back alignment and structure

>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A	Back alignment and structure

>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11	Back alignment and structure

>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A*	Back alignment and structure

>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A*	Back alignment and structure

>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli}	Back alignment and structure

>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A*	Back alignment and structure

>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A*	Back alignment and structure

>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A*	Back alignment and structure

>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A*	Back alignment and structure

>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str}	Back alignment and structure

>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A	Back alignment and structure

>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A*	Back alignment and structure

>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus}	Back alignment and structure

>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56	Back alignment and structure

>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A	Back alignment and structure

>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans}	Back alignment and structure

>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A*	Back alignment and structure

>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A	Back alignment and structure

>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A*	Back alignment and structure

>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A*	Back alignment and structure

>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A*	Back alignment and structure

>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A*	Back alignment and structure

>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida}	Back alignment and structure

>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima}	Back alignment and structure

>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus}	Back alignment and structure

>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa}	Back alignment and structure

>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ...	Back alignment and structure

>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana}	Back alignment and structure

>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A*	Back alignment and structure

>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A*	Back alignment and structure

>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A*	Back alignment and structure

>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A*	Back alignment and structure

>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A*	Back alignment and structure

>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021}	Back alignment and structure

>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1	Back alignment and structure

>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori}	Back alignment and structure

>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24	Back alignment and structure

>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti}	Back alignment and structure

>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1	Back alignment and structure

>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori}	Back alignment and structure

>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A*	Back alignment and structure

>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli}	Back alignment and structure

>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A*	Back alignment and structure

>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A*	Back alignment and structure

>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli}	Back alignment and structure

>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A	Back alignment and structure

>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli}	Back alignment and structure

>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus}	Back alignment and structure

>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12}	Back alignment and structure

>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis}	Back alignment and structure

>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP}	Back alignment and structure

>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A*	Back alignment and structure

>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A*	Back alignment and structure

>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus}	Back alignment and structure

>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A*	Back alignment and structure

>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		581
d2dula1		375	c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tR	1e-115
d2frna1		260	c.66.1.47 (A:19-278) Hypothetical protein PH0793 {	4e-07
d2b2ca1		312	c.66.1.17 (A:3-314) Spermidine synthase {Caenorhab	9e-04
d2b25a1		324	c.66.1.13 (A:6-329) Hypothetical protein FLJ20628	0.001
d2o07a1		285	c.66.1.17 (A:16-300) Spermidine synthase {Human (H	0.003
d1inla_		295	c.66.1.17 (A:) Spermidine synthase {Thermotoga mar	0.004

>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Length = 375	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: TRM1-like
domain: N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1
species: Pyrococcus horikoshii [TaxId: 53953]

 Score =  346 bits (888), Expect = e-115
 Identities = 110/365 (30%), Positives = 167/365 (45%), Gaps = 42/365 (11%)

Query: 116 VLRQLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEACRRNIKFNG----- 170
           +L  L P  VL+ALSA+G+R +R+A E     +V   D  + + E  +RN+  N      
Sbjct: 40  LLNILNPKIVLDALSATGIRGIRFALET-PAEEVWLNDISEDAYELMKRNVMLNFDGELR 98

Query: 171 -------SVACSKVESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGML 223
                        +  +  DA   M    + F  +DLDP+GSP  FLD+A++S    G+L
Sbjct: 99  ESKGRAILKGEKTIVINHDDANRLMAERHRYFHFIDLDPFGSPMEFLDTALRSAKRRGIL 158

Query: 224 MCTATDMAVLCGGNGEVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLS 283
             TATD A LCG +   C  KY + PLRG+ CHE+  RIL+  I  +A +Y   I+ +L+
Sbjct: 159 GVTATDGAPLCGAHPRACLRKYLAVPLRGELCHEVGTRILVGVIARYAAKYDLGIDVILA 218

Query: 284 VQMDFYVRVFVRIYTSASAMKSTPLKLSYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPG 343
              D Y R FV++   A     T  KL Y+Y       F L+                  
Sbjct: 219 YYKDHYFRAFVKLKDGARKGDETLEKLGYIYFDDKTGKFELE------------------ 260

Query: 344 FGPVVPQLCSDCGKKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRYPAYDRISAVLTTI 403
                         + N  GP+W G + D++ V+ ++ E +S+        +   +L  I
Sbjct: 261 --------QGFLPTRPNAYGPVWLGPLKDEKIVSKMVKEAESLS--LARKKQALKLLKMI 310

Query: 404 SEELPDVPLFLSLHNLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVI 463
            +EL D+PLF   H +   LK  +       SA+   GY  + TH +P G+KT AP  V 
Sbjct: 311 DQEL-DIPLFYDTHAIGRRLKIETKKVEEIISALREQGYEATRTHFSPTGIKTSAPYEVF 369

Query: 464 WDIMR 468
            + ++
Sbjct: 370 IETIK 374

PyMOL of d2dula1

>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Length = 260	Back information, alignment and structure

>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Length = 312	Back information, alignment and structure

>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324	Back information, alignment and structure

>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 285	Back information, alignment and structure

>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Length = 295	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		581
d2dula1		375	N(2),N(2)-dimethylguanosine tRNA methyltransferase	100.0
d2b78a2		317	Hypothetical protein SMu776, middle and C-terminal	99.83
d2as0a2		324	Hypothetical protein PH1915, middle and C-terminal	99.8
d1wxxa2		318	Hypothetical protein TTHA1280, middle and C-termin	99.75
d2frna1		260	Hypothetical protein PH0793 {Pyrococcus horikoshii	99.74
d2esra1		152	Putative methyltransferase SPy1538 {Streptococcus	99.74
d2fpoa1		183	Methylase YhhF {Escherichia coli [TaxId: 562]}	99.72
d2fhpa1		182	Putative methylase EF2452 {Enterococcus faecalis [	99.72
d2igta1		309	Putative methyltransferase Atu0340 {Agrobacterium	99.7
d2ifta1		183	Putative methylase HI0767 {Haemophilus influenzae	99.7
d1ws6a1		171	Methyltransferase TTHA0928 {Thermus thermophilus [	99.62
d1l3ia_		186	Precorrin-6Y methyltransferase (CbiT) {Archaeon Me	99.34
d1wy7a1		201	Hypothetical protein PH1948 {Archaeon Pyrococcus h	99.28
d1dusa_		194	Hypothetical protein MJ0882 {Archaeon Methanococcu	99.23
d1uwva2		358	rRNA (Uracil-5-)-methyltransferase RumA, catalytic	99.15
d2nxca1		254	PrmA-like protein TTHA0656 (TT0836) {Thermus therm	99.08
d1ne2a_		197	Hypothetical protein Ta1320 {Archaeon Thermoplasma	99.06
d2b3ta1		274	N5-glutamine methyltransferase, HemK {Escherichia	99.05
d1yb2a1		250	Hypothetical protein Ta0852 {Thermoplasma acidophi	98.95
d1oria_		316	Protein arginine N-methyltransferase 1, PRMT1 {Rat	98.82
d1o54a_		266	Hypothetical protein TM0748 {Thermotoga maritima [	98.8
d2fyta1		311	Protein arginine N-methyltransferase 3, PRMT3 {Hum	98.77
d1ri5a_		252	mRNA cap (Guanine N-7) methyltransferase {Fungus (	98.75
d1nv8a_		271	N5-glutamine methyltransferase, HemK {Thermotoga m	98.73
d1g6q1_		328	Arginine methyltransferase, HMT1 {Baker's yeast (S	98.73
d1zx0a1		229	Guanidinoacetate methyltransferase {Human (Homo sa	98.72
d1nkva_		245	Hypothetical Protein YjhP {Escherichia coli [TaxId	98.71
d1ixka_		313	Hypothetical methyltransferase PH1374 {Archaeon Py	98.69
d1wzna1		251	Hypothetical methyltransferase PH1305 {Archaeon Py	98.68
d1susa1		227	Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag	98.67
d2avda1		219	COMT domain-containing protein 1, COMTD1 {Human (H	98.67
d1i9ga_		264	Probable methyltransferase Rv2118c {Mycobacterium	98.66
d1y8ca_		246	Putative methyltransferase CAC2371 {Clostridium ac	98.65
d1vl5a_		231	Hypothetical protein BH2331 {Bacillus halodurans [	98.63
d2fcaa1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil	98.62
d2b25a1		324	Hypothetical protein FLJ20628 {Human (Homo sapiens	98.62
d1sqga2		284	Ribosomal RNA small subunit methyltransferase B, R	98.61
d2b9ea1		293	NOL1R {Human (Homo sapiens) [TaxId: 9606]}	98.59
d2cl5a1		214	Catechol O-methyltransferase, COMT {Rat (Rattus no	98.57
d1uira_		312	Spermidine synthase {Thermus thermophilus [TaxId:	98.56
d1iy9a_		274	Spermidine synthase {Bacillus subtilis [TaxId: 142	98.56
d1xxla_		234	Hypothetical protein YcgJ {Bacillus subtilis [TaxI	98.55
d1dl5a1		213	Protein-L-isoaspartyl O-methyltransferase {Thermot	98.54
d2o57a1		282	Putative sarcosine dimethylglycine methyltransfera	98.53
d1inla_		295	Spermidine synthase {Thermotoga maritima [TaxId: 2	98.51
d2i6ga1		198	Putative methyltransferase TehB {Salmonella typhim	98.49
d1yzha1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep	98.48
d2ex4a1		222	Adrenal gland protein AD-003 (C9orf32) {Human (Hom	98.47
d2b2ca1		312	Spermidine synthase {Caenorhabditis elegans [TaxId	98.46
d2h00a1		250	Methyltransferase 10 domain containing protein MET	98.44
d2o07a1		285	Spermidine synthase {Human (Homo sapiens) [TaxId:	98.44
d1g8aa_		227	Fibrillarin homologue {Archaeon Pyrococcus horikos	98.44
d2gh1a1		281	Methyltransferase BC2162 {Bacillus cereus [TaxId:	98.44
d1mjfa_		276	Putative spermidine synthetase PF0127 (SpeE) {Arch	98.42
d1nt2a_		209	Fibrillarin homologue {Archaeon Archaeoglobus fulg	98.4
d1ve3a1		226	Hypothetical protein PH0226 {Archaeon Pyrococcus h	98.4
d2oyra1		250	Hypothetical protein YhiQ {Shigella flexneri [TaxI	98.39
d2f8la1		328	Hypothetical protein Lmo1582 {Listeria monocytogen	98.39
d2avna1		246	Hypothetical methyltransferase TM1389 {Thermotoga	98.32
d1xj5a_		290	Spermidine synthase {Thale cress (Arabidopsis thal	98.31
d1g8sa_		230	Fibrillarin homologue {Archaeon Methanococcus jann	98.31
d2bzga1		229	Thiopurine S-methyltransferase {Human (Homo sapien	98.3
d1i1na_		224	Protein-L-isoaspartyl O-methyltransferase {Human (	98.26
d2p7ia1		225	Hypothetical protein ECA1738 {Erwinia carotovora [	98.24
d2fk8a1		280	Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri	98.24
d1im8a_		225	Hypothetical protein HI0319 (YecO) {Haemophilus in	98.21
d1m6ya2		192	TM0872, methyltransferase domain {Thermotoga marit	98.16
d1xvaa_		292	Glycine N-methyltransferase {Rat (Rattus norvegicu	98.14
d1tw3a2		253	Carminomycin 4-O-methyltransferase {Streptomyces p	98.12
d1kpga_		285	CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	98.12
d1pjza_		201	Thiopurine S-methyltransferase {Pseudomonas syring	98.04
d1kpia_		291	CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	98.04
d1xtpa_		254	Hypothetical protein Lmaj004091aaa (LmjF30.0810) {	97.96
d1vbfa_		224	Protein-L-isoaspartyl O-methyltransferase {Sulfolo	97.96
d1jg1a_		215	Protein-L-isoaspartyl O-methyltransferase {Archaeo	97.91
d2a14a1		257	Indolethylamine N-methyltransferase, INMT {Human (	97.84
d2okca1		425	Type I restriction enzyme StySJI M protein {Bacter	97.81
d2ih2a1		223	DNA methylase TaqI, N-terminal domain {Thermus aqu	97.8
d1nw3a_		328	Catalytic, N-terminal domain of histone methyltran	97.77
d1p91a_		268	rRNA methyltransferase RlmA {Escherichia coli [Tax	97.72
d1vlma_		208	Possible histamine N-methyltransferase TM1293 {The	97.68
d2ar0a1		524	M.EcoKI {Escherichia coli [TaxId: 562]}	97.59
d1jqea_		280	Histamine methyltransferase {Human (Homo sapiens)	97.55
d1r18a_		223	Protein-L-isoaspartyl O-methyltransferase {Fruit f	97.43
d1qzza2		256	Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu	97.35
d1u2za_		406	Catalytic, N-terminal domain of histone methyltran	97.22
d2g72a1		263	Phenylethanolamine N-methyltransferase, PNMTase {H	97.1
d2c7pa1		327	DNA methylase HhaI {Haemophilus haemolyticus [TaxI	96.89
d1o9ga_		249	rRNA methyltransferase AviRa {Streptomyces viridoc	96.85
d1dcta_		324	DNA methylase HaeIII {Haemophilus aegyptius [TaxId	96.64
d1jsxa_		207	Glucose-inhibited division protein B (GidB) {Esche	96.62
d1xdza_		239	Glucose-inhibited division protein B (GidB) {Bacil	96.54
d1wg8a2		182	TM0872, methyltransferase domain {Thermus thermoph	95.91
d1g55a_		343	DNMT2 {Human (Homo sapiens) [TaxId: 9606]}	94.95
d1ej0a_		180	RNA methyltransferase FtsJ {Escherichia coli [TaxI	94.89
d1g60a_		256	Methyltransferase mboII {Moraxella bovis [TaxId: 4	94.71
d1vj0a2		182	Hypothetical protein TM0436 {Thermotoga maritima [	94.63
d1qama_		235	rRNA adenine dimethylase {Bacillus subtilis, Ermc'	94.62
d1eg2a_		279	m.RsrI N6 adenosine-specific DNA methyltransferase	94.21
d1booa_		320	m.PvuII N4 cytosine-specific DNA methyltransferase	93.48
d1e3ja2		170	Ketose reductase (sorbitol dehydrogenase) {Silverl	92.32
d1piwa2		168	Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas	92.19
d1kola2		195	Formaldehyde dehydrogenase {Pseudomonas putida [Ta	92.12
d1g60a_		256	Methyltransferase mboII {Moraxella bovis [TaxId: 4	92.01
d1yb5a2		174	Quinone oxidoreductase {Human (Homo sapiens) [TaxI	91.83
d1booa_		320	m.PvuII N4 cytosine-specific DNA methyltransferase	91.82
d1rjwa2		168	Alcohol dehydrogenase {Bacillus stearothermophilus	91.78
d1jqba2		174	Bacterial secondary alcohol dehydrogenase {Clostri	91.49
d1zq9a1		278	Probable dimethyladenosine transferase {Human (Hom	91.26
d2p41a1		257	An RNA cap (nucleoside-2'-O-)-methyltransferase do	91.06
d1af7a2		193	Chemotaxis receptor methyltransferase CheR, C-term	90.98
d1iz0a2		171	Quinone oxidoreductase {Thermus thermophilus [TaxI	90.93
d1eg2a_		279	m.RsrI N6 adenosine-specific DNA methyltransferase	90.69
d1pqwa_		183	Putative enoyl reductase domain of polyketide synt	90.15
d1jvba2		170	Alcohol dehydrogenase {Archaeon Sulfolobus solfata	89.96
d2bm8a1		232	Cephalosporin hydroxylase CmcI {Streptomyces clavu	89.86
d1yuba_		245	rRNA adenine dimethylase {Streptococcus pneumoniae	89.85
d1vj1a2		187	Putative zinc-binding alcohol dehydrogenase {Mouse	89.77
d1pl8a2		171	Ketose reductase (sorbitol dehydrogenase) {Human (	89.55
d1llua2		166	Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax	89.28
d1ja9a_		259	1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl	89.05
d1fp1d2		244	Chalcone O-methyltransferase {Alfalfa (Medicago sa	87.78
d1e3ia2		174	Alcohol dehydrogenase {Mouse (Mus musculus), class	87.09
d1krwa_		123	NTRC receiver domain {Salmonella typhimurium [TaxI	86.13
d1fp2a2		244	Isoflavone O-methyltransferase {Alfalfa (Medicago	85.88
d1ys7a2		121	Transcriptional regulatory protein PrrA, N-termina	85.48
d1i4wa_		322	Transcription factor sc-mtTFB {Baker's yeast (Sacc	85.06
d1xhla_		274	Hypothetical protein F25D1.5 {Caenorhabditis elega	84.54
d1f8fa2		174	Benzyl alcohol dehydrogenase {Acinetobacter calcoa	84.11
d1qyra_		252	High level kasugamycin resistance protein KsgA {Es	83.87
d1xkqa_		272	Hypothetical protein R05D8.7 {Caenorhabditis elega	83.8
d1gu7a2		189	2,4-dienoyl-CoA reductase {Yeast (Candida tropical	82.27
d1dcfa_		134	Receiver domain of the ethylene receptor {Thale cr	82.12
d1qkka_		140	Transcriptional regulatory protein DctD, receiver	81.93
d2apob1		55	Ribosome biogenesis protein Nop10 {Archaeon Methan	81.79
d2oo3a1		271	Uncharacterized protein LPG1296 {Legionella pneumo	81.71
d1p2fa2		120	Response regulator DrrB {Thermotoga maritima [TaxI	80.8
d1ny5a1		137	Transcriptional activator sigm54 (NtrC1), N-termin	80.16
d1p0fa2		174	Alcohol dehydrogenase {Frog (Rana perezi) [TaxId:	80.1
d1xa0a2		176	B. subtilis YhfP homologue {Bacillus stearothermop	80.09

>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: TRM1-like
domain: N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=100.00  E-value=5.3e-107  Score=859.43  Aligned_cols=356  Identities=34%  Similarity=0.540  Sum_probs=335.8

Q ss_pred             eEEEeeeEEEEecCC-----CCccccccchhhhhHHHHHHHHHHHHhHHHHHHhhhhccCCCCCCCccCCCCCCCCcccc
Q 047386            8 TIIKEGEAEILMHAK-----NEVFYNKTQVNNRDISIAVMRAFISKRNQEHEAMLSKRTTSAPKASEKDGEEEAPDESVV   82 (581)
Q Consensus         8 ~~i~EG~a~I~~p~~-----~~VFYNPvq~fNRDlSV~vi~~f~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~   82 (581)
                      +.|+||+|+|+||+.     .+|||||+|+|||||||+++++|.                                    
T Consensus         2 ~~i~EG~~~i~vp~~~~~~~~~vFYNp~q~~NRDlsvl~~~~~~------------------------------------   45 (375)
T d2dula1           2 IEVQEGKAKILIPKAESIYDSPVFYNPRMALNRDIVVVLLNILN------------------------------------   45 (375)
T ss_dssp             EEEEETTEEEEEC--------CCCCCGGGHHHHHHHHHHHHHHC------------------------------------
T ss_pred             eEEEeCcEEEEecCCCCCCCCCcccCHHHhhhhHHHHHHHHHhC------------------------------------
Confidence            689999999999874     469999999999999999998651                                    


Q ss_pred             ccCCCCCcCCcccccCCCCccccccccCccchhcccCCCCCeEEEecCcccHHHHHHhhhcCCccEEEEEeCCHHHHHHH
Q 047386           83 NENSNGEIERPAEISQDEPCCISEEAVKPTERNVLRQLKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDKASVEAC  162 (581)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VLDafsgSG~rgIr~a~E~~Ga~~V~anD~s~~Ave~i  162 (581)
                                                             +.+|||+|||||+||||||+|+ |+++|++||+|+.|+++|
T Consensus        46 ---------------------------------------~~~vLD~~sasG~rsiRya~E~-~~~~V~~nDis~~A~~~i   85 (375)
T d2dula1          46 ---------------------------------------PKIVLDALSATGIRGIRFALET-PAEEVWLNDISEDAYELM   85 (375)
T ss_dssp             ---------------------------------------CSEEEESSCTTSHHHHHHHHHS-SCSEEEEEESCHHHHHHH
T ss_pred             ---------------------------------------CCEEEEcCCCccHHHHHHHHhC-CCCEEEEecCCHHHHHHH
Confidence                                                   3479999999999999999997 689999999999999999


Q ss_pred             HHHHHHhCCCC------------CCcEEEEehhHHHHHhhCCCcccEEeeCCCCCChHhHHHHHHhccCCCeEEEEeccc
Q 047386          163 RRNIKFNGSVA------------CSKVESHLADARVYMLTHPKEFDVVDLDPYGSPSVFLDSAIQSVADGGMLMCTATDM  230 (581)
Q Consensus       163 ~~Ni~~N~~~~------------~~~v~v~~~DA~~~l~~~~~~fDvIdLDPyGs~~~fld~A~~~l~~gGlL~vTaTD~  230 (581)
                      ++|+++|++..            ...+.+.+.||+.+|..++++||||||||||+|+||||+|++++++||+|+|||||+
T Consensus        86 ~~N~~lN~~~~~~~~~~~~~~~~~~~~~~~~~Da~~~~~~~~~~fDvIDiDPfGs~~pfldsAi~a~~~~Gll~vTaTD~  165 (375)
T d2dula1          86 KRNVMLNFDGELRESKGRAILKGEKTIVINHDDANRLMAERHRYFHFIDLDPFGSPMEFLDTALRSAKRRGILGVTATDG  165 (375)
T ss_dssp             HHHHHHHCCSCCEECSSEEEEESSSEEEEEESCHHHHHHHSTTCEEEEEECCSSCCHHHHHHHHHHEEEEEEEEEEECCH
T ss_pred             HHHHHhcCccccccccccccccccceeEeehhhhhhhhHhhcCcCCcccCCCCCCcHHHHHHHHHHhccCCEEEEEecCc
Confidence            99999998741            235789999999999988889999999999999999999999999999999999999


Q ss_pred             hhhcCCCcchhhhhccCccCCCccchhhhHHHHHHHHHHHHHHcCCceEEEeecccCceEEEEEEEEcChhhhccccccc
Q 047386          231 AVLCGGNGEVCYSKYGSYPLRGKYCHEMALRILLACIESHANRYKRYIEPVLSVQMDFYVRVFVRIYTSASAMKSTPLKL  310 (581)
Q Consensus       231 a~Lcg~~~~~c~rkYG~~~~k~~~~hE~~lRill~~i~~~Aa~~~r~i~Plls~s~dhY~RvfVrV~~~~~~~k~~~~k~  310 (581)
                      ++|||+++++|+|+||+++++++|+||+|||+||+.|+++|++|+++|+||||++.|||+||||||.+|+..++++++++
T Consensus       166 a~L~G~~~~~~~r~Yg~~~~~~~~~~E~glRill~~i~r~Aa~~~~~i~PllS~~~~~y~Rv~vrv~~~~~~~~~~~~~~  245 (375)
T d2dula1         166 APLCGAHPRACLRKYLAVPLRGELCHEVGTRILVGVIARYAAKYDLGIDVILAYYKDHYFRAFVKLKDGARKGDETLEKL  245 (375)
T ss_dssp             HHHTTSSHHHHHHHHSSBCCCSTTHHHHHHHHHHHHHHHHHHTTTEEEEEEEEEEETTEEEEEEEEEESHHHHHHHHTTE
T ss_pred             hhhcCCCcHHHHHHhCCeecCCcccchHHHHHHHHHHHHHHHhcCCeeEEEEEEEecceEEEEEEEecChHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEEcCCCCceeEeeccccccCCCCcccccCCCCCCCCCcCCCCCCcccccccccccCCCCHHHHHHHHHHhhhcccCC
Q 047386          311 SYVYQCIGCDSFHLQPVGRTASNKNNSVRYLPGFGPVVPQLCSDCGKKFNMGGPIWSGRIHDQEWVNSILGEVKSMKDRY  390 (581)
Q Consensus       311 g~v~~C~~C~~~~~q~lgr~~~~~~~~~~~~~~~~~~~~~~C~~Cg~~~~~~GPlW~GpLhd~~fv~~ml~~~~~~~~~~  390 (581)
                      ||++||.+|++|+++                          |++|+.+++++||||+|||||++|+++|++.++++.  +
T Consensus       246 g~~~~C~~c~~~~~~--------------------------~~~~~~~~~~~GPlW~G~L~d~efl~~~~~~~~~~~--~  297 (375)
T d2dula1         246 GYIYFDDKTGKFELE--------------------------QGFLPTRPNAYGPVWLGPLKDEKIVSKMVKEAESLS--L  297 (375)
T ss_dssp             EEEEECTTTCCEEEE--------------------------ESSSCCSSSCEEEEECSCSBCHHHHHHHHHHHHTSC--C
T ss_pred             CcEEEcCCCCCEEEe--------------------------cCCCCCCCCCcCCCccCcccCHHHHHHHHHHhhccC--c
Confidence            999999999987653                          778999999999999999999999999999988754  7


Q ss_pred             CcHHHHHHHHHHHHhhCCCCCceeeHHHHhhhcCCCCCCHHHHHHHHHHCCceEEecccCCCccccCCCHHHHHHHHH
Q 047386          391 PAYDRISAVLTTISEELPDVPLFLSLHNLCSTLKCTSPSAVMFRSAVINAGYRVSGTHVNPLGLKTDAPMGVIWDIMR  468 (581)
Q Consensus       391 ~t~~ri~~lL~~~~eEl~~~P~yy~l~~l~~~lk~~~P~~~~~~~aL~~~GY~aSrTH~~p~~iKTdAP~~~i~di~r  468 (581)
                      ++.+|+.++|+++.+|+ ++||||++|+||+++|+++||++.|+++|+++||+||+|||+|.|||||||+++||||||
T Consensus       298 ~~~~~~~~ll~~i~eE~-~~P~~y~l~~la~~lk~~~P~~~~~~~aL~~~Gy~asrtH~~p~~iKTdAp~~~i~~i~r  374 (375)
T d2dula1         298 ARKKQALKLLKMIDQEL-DIPLFYDTHAIGRRLKIETKKVEEIISALREQGYEATRTHFSPTGIKTSAPYEVFIETIK  374 (375)
T ss_dssp             TTHHHHHHHHHHHHHSC-CSSCCEEHHHHHHHHTCCBCCHHHHHHHHHHTTCCEEEETTEEEEEEESSCHHHHHHHHB
T ss_pred             chhhHHHHHHHHHHhcc-CCCeEEcHHHHHHHcCCCCCCHHHHHHHHHHCCCEEEecCCCCCCEecCCCHHHHHHHHh
Confidence            88999999999999998 689999999999999999999999999999999999999999999999999999999997

PyMOL of d2dula1

>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}	Back information, alignment and structure

>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]}	Back information, alignment and structure

>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]}	Back information, alignment and structure

>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]}	Back information, alignment and structure

>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}	Back information, alignment and structure

>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]}	Back information, alignment and structure

>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure

>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]}	Back information, alignment and structure

>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]}	Back information, alignment and structure

>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]}	Back information, alignment and structure

>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]}	Back information, alignment and structure

>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]}	Back information, alignment and structure

>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]}	Back information, alignment and structure

>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]}	Back information, alignment and structure

>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]}	Back information, alignment and structure

>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]}	Back information, alignment and structure

>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}	Back information, alignment and structure

>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]}	Back information, alignment and structure

>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]}	Back information, alignment and structure

>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]}	Back information, alignment and structure

>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]}	Back information, alignment and structure

>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}	Back information, alignment and structure

>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]}	Back information, alignment and structure

>d2apob1 g.41.16.1 (B:403-457) Ribosome biogenesis protein Nop10 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]}	Back information, alignment and structure

>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]}	Back information, alignment and structure

>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure