Citrus Sinensis ID: 047709

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
VGKVLPSLNGKLTGMAFRLPPKKATYDDIKAAHKEASQGEMKGIFGYIEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYDSDAAFEK
ccEEcccccccccEEEcccccccccHHHHHHHHHHHcccccccccccccccEEEcccccccccccccccccccccccEEEEEEEEcccccccc
HHHHcHHHcccEEEEEEEEcccccEEEEEEEEEcccccHHccccEEEEcccccHHHcccccccEEEEccccEEEcccEEEEEEEEcccHHHHH
vgkvlpslngkltgmafrlppkkatyDDIKAAHKEASQGEMKGIFgyieddvvstdfvgdnrssifdakagislsDNFEKLVSWYdsdaafek
vgkvlpslngkltgmafrlppkkATYDDIKAAHKEASQGEMKGIFGYIEDDVVSTDFVGDNRSSIfdakagislsdnfEKLVSWYDSDAAFEK
VGKVLPSLNGKLTGMAFRLPPKKATYDDIKAAHKEASQGEMKGIFGYIEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYDSDAAFEK
****************************************MKGIFGYIEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYD*******
VGKVLPSLNGKLTGMAFRLPPKKATYDDIKAAHKEASQGEMKGIFGYIEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYDSDAAFE*
VGKVLPSLNGKLTGMAFRLPPKKATYDDIKAAHKEASQGEMKGIFGYIEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYDSDAAFEK
VGKVLPSLNGKLTGMAFRLPPKKATYDDIKAAHKEASQGEMKGIFGYIEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYDSDAAFEK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VGKVLPSLNGKLTGMAFRLPPKKATYDDIKAAHKEASQGEMKGIFGYIEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYDSDAAFEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
P04796338 Glyceraldehyde-3-phosphat N/A no 0.978 0.269 0.682 4e-33
Q39769340 Glyceraldehyde-3-phosphat N/A no 0.978 0.267 0.673 5e-33
P26521338 Glyceraldehyde-3-phosphat N/A no 0.978 0.269 0.673 1e-32
Q9FX54338 Glyceraldehyde-3-phosphat no no 0.978 0.269 0.682 1e-32
P34921338 Glyceraldehyde-3-phosphat N/A no 0.978 0.269 0.663 2e-32
P34783360 Glyceraldehyde-3-phosphat N/A no 0.978 0.252 0.663 3e-32
P25861337 Glyceraldehyde-3-phosphat N/A no 0.978 0.270 0.663 3e-32
P26520337 Glyceraldehyde-3-phosphat N/A no 0.978 0.270 0.663 3e-32
P17878337 Glyceraldehyde-3-phosphat N/A no 0.978 0.270 0.653 4e-32
P09094326 Glyceraldehyde-3-phosphat N/A no 0.978 0.279 0.663 6e-32
>sp|P04796|G3PC_SINAL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2 Back     alignment and function desciption
 Score =  139 bits (351), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 80/104 (76%), Gaps = 13/104 (12%)

Query: 1   VGKVLPSLNGKLTGMAFRLPP-------------KKATYDDIKAAHKEASQGEMKGIFGY 47
           VGKVLP LNGKLTGM+FR+P              K ATYD+IK A KE SQG++KGI GY
Sbjct: 221 VGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESQGKLKGILGY 280

Query: 48  IEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYDSDAAF 91
            EDDVVSTDFVGDNRSSIFDAKAGI+LSDNF KLVSWYD++  +
Sbjct: 281 TEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGY 324

Sinapis alba (taxid: 3728)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q39769|G3PC_GINBI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1 Back     alignment and function description
>sp|P26521|G3PC_RANAC Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ranunculus acris GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|Q9FX54|G3PC2_ARATH Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Arabidopsis thaliana GN=GAPC2 PE=1 SV=1 Back     alignment and function description
>sp|P34921|G3PC_DIACA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Dianthus caryophyllus GN=GAPC PE=3 SV=1 Back     alignment and function description
>sp|P34783|G3P_ATRNU Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1 Back     alignment and function description
>sp|P25861|G3PC_ANTMA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|P26520|G3PC_PETHY Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petunia hybrida GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|P17878|G3PC_MESCR Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Mesembryanthemum crystallinum GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|P09094|G3PC_TOBAC Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Nicotiana tabacum GN=GAPC PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
388514675 337 unknown [Lotus japonicus] 0.978 0.270 0.673 1e-31
4539543 337 glyceraldehyde-3-phosphate dehydrogenase 0.978 0.270 0.682 1e-31
120675 338 RecName: Full=Glyceraldehyde-3-phosphate 0.978 0.269 0.682 2e-31
3023812 340 RecName: Full=Glyceraldehyde-3-phosphate 0.978 0.267 0.673 2e-31
62321423160 putative glyceraldehyde-3-phosphate dehy 0.978 0.568 0.682 2e-31
356571437 337 PREDICTED: glyceraldehyde-3-phosphate de 0.978 0.270 0.682 2e-31
300174962 337 glyceraldehyde-3-phosphate dehydrogenase 0.978 0.270 0.673 2e-31
356511540 337 PREDICTED: glyceraldehyde-3-phosphate de 0.978 0.270 0.682 3e-31
387604500 211 glyceraldehyde-3-phosphate dehydrogenase 0.946 0.417 0.683 3e-31
418731090 337 glyceraldehyde 3-phosphate dehydrogenase 0.978 0.270 0.673 3e-31
>gi|388514675|gb|AFK45399.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (77%), Gaps = 13/104 (12%)

Query: 1   VGKVLPSLNGKLTGMAFRLPP-------------KKATYDDIKAAHKEASQGEMKGIFGY 47
           VGKVLP+LNGKLTGMAFR+P              K ATYD IKAA KE S+G++KGI GY
Sbjct: 219 VGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAATYDQIKAAIKEESEGKLKGILGY 278

Query: 48  IEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYDSDAAF 91
            EDDVVSTDF+GDNRSSIFDAKAGI+L+DNF KLVSWYD++  +
Sbjct: 279 TEDDVVSTDFIGDNRSSIFDAKAGIALNDNFVKLVSWYDNEMGY 322

Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|4539543|emb|CAB39974.1| glyceraldehyde-3-phosphate dehydrogenase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|120675|sp|P04796.2|G3PC_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic gi|21143|emb|CAA27844.1| unnamed protein product [Sinapis alba] Back     alignment and taxonomy information
>gi|3023812|sp|Q39769.1|G3PC_GINBI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic gi|435046|gb|AAA33352.1| glyceraldehyde-phosphate dehydrogenase [Ginkgo biloba] Back     alignment and taxonomy information
>gi|62321423|dbj|BAD94800.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356571437|ref|XP_003553883.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like [Glycine max] Back     alignment and taxonomy information
>gi|300174962|dbj|BAJ10716.1| glyceraldehyde-3-phosphate dehydrogenase [Cladopus doianus] Back     alignment and taxonomy information
>gi|356511540|ref|XP_003524483.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like [Glycine max] Back     alignment and taxonomy information
>gi|387604500|gb|AFJ93196.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Eremosparton songoricum] Back     alignment and taxonomy information
>gi|418731090|gb|AFX67011.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
TAIR|locus:2010007338 GAPC2 "glyceraldehyde-3-phosph 0.946 0.260 0.702 2.3e-30
TAIR|locus:2103085338 GAPC1 "glyceraldehyde-3-phosph 0.946 0.260 0.683 1e-29
UNIPROTKB|P0A9B2331 gapA "glyceraldehyde 3-phospha 0.978 0.274 0.625 2.2e-27
UNIPROTKB|Q4U3L0333 Gapdh "Glyceraldehyde-3-phosph 0.978 0.273 0.615 9.4e-27
UNIPROTKB|P51469333 gapdh "Glyceraldehyde-3-phosph 0.978 0.273 0.615 1.2e-26
TAIR|locus:2206435422 GAPCP-1 "glyceraldehyde-3-phos 0.946 0.208 0.623 1.5e-26
UNIPROTKB|Q5R2J2333 GAPDH "Glyceraldehyde-3-phosph 0.978 0.273 0.615 1.9e-26
ASPGD|ASPL0000009927336 gpdA [Emericella nidulans (tax 1.0 0.276 0.594 2.5e-26
POMBASE|SPBC32F12.11336 tdh1 "glyceraldehyde-3-phospha 1.0 0.276 0.603 2.5e-26
POMBASE|SPBC354.12335 gpd3 "glyceraldehyde 3-phospha 0.946 0.262 0.633 2.5e-26
TAIR|locus:2010007 GAPC2 "glyceraldehyde-3-phosphate dehydrogenase C2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 335 (123.0 bits), Expect = 2.3e-30, P = 2.3e-30
 Identities = 71/101 (70%), Positives = 79/101 (78%)

Query:     1 VGKVLPSLNGKLTGMAFRLPP-------------KKATYDDIKAAHKEASQGEMKGIFGY 47
             VGKVLPSLNGKLTGM+FR+P              K ATYD+IK A KE S+G+MKGI GY
Sbjct:   221 VGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKMKGILGY 280

Query:    48 IEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYDSD 88
              EDDVVSTDFVGDNRSSIFDAKAGI+LSD F KLVSWYD++
Sbjct:   281 TEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNE 321
GO:0005737 "cytoplasm" evidence=ISM
GO:0006006 "glucose metabolic process" evidence=IEA
GO:0006096 "glycolysis" evidence=ISS;RCA;TAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0006979 "response to oxidative stress" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005730 "nucleolus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA;TAS
GO:0006094 "gluconeogenesis" evidence=RCA;TAS
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0042742 "defense response to bacterium" evidence=IEP
GO:0016020 "membrane" evidence=IDA
GO:0004365 "glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity" evidence=IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0051049 "regulation of transport" evidence=RCA
TAIR|locus:2103085 GAPC1 "glyceraldehyde-3-phosphate dehydrogenase C subunit 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P0A9B2 gapA "glyceraldehyde 3-phosphate dehydrogenase-A monomer" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q4U3L0 Gapdh "Glyceraldehyde-3-phosphate dehydrogenase" [Glossina morsitans morsitans (taxid:37546)] Back     alignment and assigned GO terms
UNIPROTKB|P51469 gapdh "Glyceraldehyde-3-phosphate dehydrogenase" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
TAIR|locus:2206435 GAPCP-1 "glyceraldehyde-3-phosphate dehydrogenase of plastid 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R2J2 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Pelodiscus sinensis (taxid:13735)] Back     alignment and assigned GO terms
ASPGD|ASPL0000009927 gpdA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPBC32F12.11 tdh1 "glyceraldehyde-3-phosphate dehydrogenase Tdh1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
POMBASE|SPBC354.12 gpd3 "glyceraldehyde 3-phosphate dehydrogenase Gpd3" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
PLN02272421 PLN02272, PLN02272, glyceraldehyde-3-phosphate deh 6e-44
PTZ00023337 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh 1e-41
pfam02800157 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh 4e-41
PLN02358338 PLN02358, PLN02358, glyceraldehyde-3-phosphate deh 2e-38
COG0057335 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog 2e-35
TIGR01534326 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh 1e-34
PRK15425331 PRK15425, gapA, glyceraldehyde-3-phosphate dehydro 5e-34
PTZ00434361 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho 2e-24
PRK07729343 PRK07729, PRK07729, glyceraldehyde-3-phosphate deh 2e-20
PRK08955334 PRK08955, PRK08955, glyceraldehyde-3-phosphate deh 2e-17
PRK07403337 PRK07403, PRK07403, glyceraldehyde-3-phosphate deh 4e-15
PLN03096395 PLN03096, PLN03096, glyceraldehyde-3-phosphate deh 1e-14
PLN02237442 PLN02237, PLN02237, glyceraldehyde-3-phosphate deh 1e-14
PRK08289477 PRK08289, PRK08289, glyceraldehyde-3-phosphate deh 6e-14
PTZ00353342 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph 2e-09
TIGR01532325 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de 1e-07
PRK13535336 PRK13535, PRK13535, erythrose 4-phosphate dehydrog 5e-07
>gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information 
 Score =  146 bits (370), Expect = 6e-44
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 13/101 (12%)

Query: 1   VGKVLPSLNGKLTGMAFRLPP-------------KKATYDDIKAAHKEASQGEMKGIFGY 47
           VGKVLP LNGKLTGMAFR+P              K A+Y+D+KAA K AS+G +KGI GY
Sbjct: 300 VGKVLPELNGKLTGMAFRVPTPNVSVVDLTCRLEKSASYEDVKAAIKYASEGPLKGILGY 359

Query: 48  IEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYDSD 88
            ++DVVS DFVGD+RSSIFDAKAGI LS +F KLVSWYD++
Sbjct: 360 TDEDVVSNDFVGDSRSSIFDAKAGIGLSASFMKLVSWYDNE 400

Length = 421
>gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
PLN02237442 glyceraldehyde-3-phosphate dehydrogenase B 100.0
PTZ00434361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 100.0
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PRK15425331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 100.0
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 100.0
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 100.0
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 100.0
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 100.0
PTZ00353342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 100.0
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 100.0
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 100.0
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 100.0
PRK08289477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PF02800157 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, 100.0
KOG0657285 consensus Glyceraldehyde 3-phosphate dehydrogenase 99.94
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 98.59
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 98.04
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 95.34
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 95.15
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 94.2
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 94.05
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 91.94
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 90.67
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 90.36
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 89.13
smart0051764 PolyA C-terminal domain of Poly(A)-binding protein 83.66
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information 
Probab=100.00  E-value=4.1e-44  Score=284.27  Aligned_cols=93  Identities=39%  Similarity=0.688  Sum_probs=90.6

Q ss_pred             CceeccCCCCCcceeEEEeCC-------------C-CCCHHHHHHHHHHhhcCccccccceeccceEeecCCCCCcceEE
Q 047709            1 VGKVLPSLNGKLTGMAFRLPP-------------K-KATYDDIKAAHKEASQGEMKGIFGYIEDDVVSTDFVGDNRSSIF   66 (93)
Q Consensus         1 v~~vlPeL~Gkl~g~a~RVPt-------------k-~~~~~~in~~~k~aa~~~lkgil~~t~~~~VS~Df~g~~~s~i~   66 (93)
                      |++|||+|+|||+||||||||             | ++++||||++||+|++|+|||||+|+++|+||+||+|++||+||
T Consensus       293 v~~VlP~L~GKl~g~A~RVPt~nvS~vDLt~~l~k~~~t~eein~~~k~aa~~~lkgil~y~~~plVS~Df~~~~~Ssi~  372 (442)
T PLN02237        293 VSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCSDVSSTI  372 (442)
T ss_pred             hceecccCCCceeeEEEecccCCceEEEEEEEeCCCCCCHHHHHHHHHHhhccccCCeeeeeCCceeeeeecCCCcceEE
Confidence            589999999999999999999             6 79999999999999999999999999999999999999999999


Q ss_pred             eCCCceeecCCeEEEEEEcCCCCccCC
Q 047709           67 DAKAGISLSDNFEKLVSWYDSDAAFEK   93 (93)
Q Consensus        67 d~~~t~~~~~~~vkl~~WyDNE~gys~   93 (93)
                      |+.+|++++++++|+++|||||||||+
T Consensus       373 D~~~t~v~~~~~vKv~aWYDNEwGys~  399 (442)
T PLN02237        373 DASLTMVMGDDMVKVVAWYDNEWGYSQ  399 (442)
T ss_pred             EcccCEEeCCCEEEEEEEeCCchhHHH
Confidence            999999999999999999999999984

>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>smart00517 PolyA C-terminal domain of Poly(A)-binding protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
3e6a_O336 Crystal Structure And Functional Analysis Of Glycer 4e-31
3e5r_O337 Crystal Structure And Functional Analysis Of Glycer 5e-31
1gae_O330 Comparison Of The Structures Of Wild Type And A N31 7e-31
2vyn_A331 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 7e-31
1gad_O330 Comparison Of The Structures Of Wild Type And A N31 8e-31
1s7c_A331 Crystal Structure Of Mes Buffer Bound Form Of Glyce 8e-31
1ihx_A333 Crystal Structure Of Two D-Glyceraldehyde-3-Phospha 2e-30
1gpd_G334 Studies Of Asymmetry In The Three-Dimensional Struc 3e-30
4gpd_1333 The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho 3e-30
1szj_G333 Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr 3e-30
1dss_G333 Structure Of Active-Site Carboxymethylated D-Glycer 3e-30
1dc4_A330 Structural Analysis Of Glyceraldehyde 3-Phosphate D 6e-29
3gpd_R334 Twinning In Crystals Of Human Skeletal Muscle D-Gly 3e-27
2vyn_D334 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 3e-27
2b4r_O345 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 4e-27
1ywg_O337 The Structure Of Glyceraldehyde-3-Phosphate Dehydro 4e-27
3pym_A332 Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res 6e-27
4iq8_A340 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 7e-27
1j0x_O332 Crystal Structure Of The Rabbit Muscle Glyceraldehy 1e-26
2i5p_O342 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-26
3h9e_B346 Crystal Structure Of Human Sperm-Specific Glycerald 5e-26
1u8f_O335 Crystal Structure Of Human Placental Glyceraldehyde 6e-26
1znq_O338 Crsytal Structure Of Human Liver Gapdh Length = 338 6e-26
3cps_A354 Crystal Structure Of Cryptosporidium Parvum Glycera 2e-25
1vsu_A359 Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate 2e-25
3cif_A359 Crystal Structure Of C153s Mutant Glyceraldehyde 3- 8e-25
3sth_A361 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 7e-22
1k3t_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 1e-18
3dmt_C359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 1e-18
1gyp_A358 Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph 5e-18
1a7k_A360 Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase 5e-18
2x0n_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 2e-17
1nq5_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-15
1npt_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-15
3dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-15
1dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-15
1gd1_O334 Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr 2e-15
3hja_A356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 3e-14
1hdg_O332 The Crystal Structure Of Holo-glyceraldehyde-3-phos 3e-14
1cer_O331 Determinants Of Enzyme Thermostability Observed In 1e-13
2g82_O331 High Resolution Structures Of Thermus Aquaticus Gly 1e-13
3gnq_A344 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 3e-13
3doc_A335 Crystal Structure Of Trka Glyceraldehyde-3-Phosphat 5e-13
1vc2_A331 Crystal Structure Of Glyceraldehyde 3-Phosphate Deh 5e-13
1nbo_O337 The Dual Coenzyme Specificity Of Photosynthetic Gly 1e-11
1rm5_O337 Crystal Structure Of Mutant S188a Of Photosynthetic 1e-11
1rm3_O337 Crystal Structure Of Mutant T33a Of Photosynthetic 1e-11
4dib_A345 The Crystal Structure Of Glyceraldehyde-3-Phosphate 1e-11
2pkr_O365 Crystal Structure Of (A+cte)4 Chimeric Form Of Phot 1e-11
1jn0_O335 Crystal Structure Of The Non-Regulatory A4 Isoform 2e-11
1obf_O335 The Crystal Structure Of Glyceraldehyde 3-Phosphate 4e-11
3k2b_A337 Crystal Structure Of Photosynthetic A4 Isoform Glyc 7e-11
3b1j_A339 Crystal Structure Of Dehydrogenese Length = 339 1e-10
2d2i_A380 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 1e-10
2ep7_A342 Structural Study Of Project Id Aq_1065 From Aquifex 6e-10
3l0d_A356 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 2e-09
2pkq_O368 Crystal Structure Of The Photosynthetic A2b2-Glycer 2e-09
3ksd_Q336 Crystal Structure Of C151s+h178n Mutant Of Glyceral 4e-09
3lc1_P336 Crystal Structure Of H178n Mutant Of Glyceraldehyde 5e-09
3hq4_R336 Crystal Structure Of C151s Mutant Of Glyceraldehyde 5e-09
3vaz_P344 Crystal Structure Of Staphylococcal Gapdh1 In A Hex 5e-09
3lvf_P338 Crystal Structure Of Holo Glyceraldehyde-3-Phosphat 5e-09
3k73_Q336 Crystal Structure Of Phosphate Bound Holo Glycerald 5e-09
3k9q_Q336 Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 5e-09
3lc7_O339 Crystal Structure Of Apo Glyceraldehyde-3-Phosphate 5e-09
2x5j_O339 Crystal Structure Of The Apoform Of The D-Erythrose 4e-04
2xf8_A338 Structure Of The D-Erythrose-4-Phosphate Dehydrogen 4e-04
2x5k_O339 Structure Of An Active Site Mutant Of The D-Erythro 5e-04
>pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 Back     alignment and structure 
Iteration: 1

 Score =  129 bits (324), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 64/104 (61%), Positives = 81/104 (77%), Gaps = 13/104 (12%)
Query: 1   VGKVLPSLNGKLTGMAFRLPP-------------KKATYDDIKAAHKEASQGEMKGIFGY 47
           VGKVLP LNGKLTGM+FR+P              K A+YD IK+A K AS+G++KGI GY
Sbjct: 218 VGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGY 277
Query: 48  IEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYDSDAAF 91
           +E+D+VSTDFVGD+RSSIFDAKAGI+L+DNF KLV+WYD++  +
Sbjct: 278 VEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGY 321
>pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 Back     alignment and structure
>pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 Back     alignment and structure
>pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 Back     alignment and structure
>pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 Back     alignment and structure
>pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 Back     alignment and structure
>pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 Back     alignment and structure
>pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Back     alignment and structure
>pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 Back     alignment and structure
>pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 Back     alignment and structure
>pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 Back     alignment and structure
>pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 Back     alignment and structure
>pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure
>pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 Back     alignment and structure
>pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 Back     alignment and structure
>pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 Back     alignment and structure
>pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 Back     alignment and structure
>pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 Back     alignment and structure
>pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 Back     alignment and structure
>pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 Back     alignment and structure
>pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 Back     alignment and structure
>pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 Back     alignment and structure
>pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 Back     alignment and structure
>pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 Back     alignment and structure
>pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 Back     alignment and structure
>pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 Back     alignment and structure
>pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 Back     alignment and structure
>pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 Back     alignment and structure
>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 Back     alignment and structure
>pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 Back     alignment and structure
>pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure
>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 Back     alignment and structure
>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 Back     alignment and structure
>pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 Back     alignment and structure
>pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 Back     alignment and structure
>pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 Back     alignment and structure
>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 Back     alignment and structure
>pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 Back     alignment and structure
>pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 Back     alignment and structure
>pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 Back     alignment and structure
>pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 Back     alignment and structure
>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 Back     alignment and structure
>pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 Back     alignment and structure
>pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 Back     alignment and structure
>pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 Back     alignment and structure
>pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 Back     alignment and structure
>pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 Back     alignment and structure
>pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 1e-53
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 3e-53
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 1e-52
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 1e-52
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 2e-52
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 2e-52
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 4e-52
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 1e-50
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 2e-43
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 2e-39
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 3e-39
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 3e-39
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 4e-39
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 8e-39
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 1e-38
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 5e-37
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 4e-35
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 9e-35
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 4e-33
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 2e-30
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 2e-29
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 2e-24
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 1e-07
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 8e-06
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 Back     alignment and structure
 Score =  168 bits (428), Expect = 1e-53
 Identities = 64/99 (64%), Positives = 74/99 (74%), Gaps = 13/99 (13%)

Query: 1   VGKVLPSLNGKLTGMAFRLP-------------PKKATYDDIKAAHKEASQGEMKGIFGY 47
           VGKVLP LNGKLTGMAFR+P              K ATY+ IKAA K A++GEMKG+ GY
Sbjct: 214 VGKVLPELNGKLTGMAFRVPTPNVSVVDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGY 273

Query: 48  IEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYD 86
            EDDVVSTDF G+  +S+FDAKAGI+L+DNF KLVSWYD
Sbjct: 274 TEDDVVSTDFNGEVCTSVFDAKAGIALNDNFVKLVSWYD 312
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 100.0
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 100.0
3v1y_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 100.0
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 100.0
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 100.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 100.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 100.0
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 100.0
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 100.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 100.0
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 100.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 100.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 100.0
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 100.0
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 98.74
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 98.51
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 98.09
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 98.09
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 97.81
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 97.8
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 97.67
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 97.47
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.27
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 97.23
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.01
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 96.97
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.64
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.6
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 96.19
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 93.16
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 90.12
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
Probab=100.00  E-value=6.4e-45  Score=281.13  Aligned_cols=93  Identities=61%  Similarity=1.025  Sum_probs=90.5

Q ss_pred             CceeccCCCCCcceeEEEeCC-------------CCCCHHHHHHHHHHhhcCccccccceeccceEeecCCCCCcceEEe
Q 047709            1 VGKVLPSLNGKLTGMAFRLPP-------------KKATYDDIKAAHKEASQGEMKGIFGYIEDDVVSTDFVGDNRSSIFD   67 (93)
Q Consensus         1 v~~vlPeL~Gkl~g~a~RVPt-------------k~~~~~~in~~~k~aa~~~lkgil~~t~~~~VS~Df~g~~~s~i~d   67 (93)
                      ++||||||+|||+||+|||||             |++++||||++||+|++|+|||||+|||+|+||+||+|+|||+|||
T Consensus       221 vgkViPeL~gkltg~avRVPv~~~s~~dlt~~lek~~t~eei~~~lk~A~~g~lkgil~yte~~~VS~Df~~~~~ssi~d  300 (346)
T 3h9e_O          221 VTKVIPELKGKLTGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTEDEVVSTDFLGDTHSSIFD  300 (346)
T ss_dssp             HHHHSGGGTTTEEEEEEEESCSSCEEEEEEEEESSCCCHHHHHHHHHHHHHTTTTTTEEEECSCCCGGGGTTCCCSEEEE
T ss_pred             hheechhhcCcEEEEEEEcccccceeEEEEEEECCcCCHHHHHHHHHHhccCccCCceeEEcCCeEeeccCCCCCceeEc
Confidence            368999999999999999999             8999999999999999999999999999999999999999999999


Q ss_pred             CCCceeecCCeEEEEEEcCCCCccCC
Q 047709           68 AKAGISLSDNFEKLVSWYDSDAAFEK   93 (93)
Q Consensus        68 ~~~t~~~~~~~vkl~~WyDNE~gys~   93 (93)
                      +.+|++++++++|+++|||||||||+
T Consensus       301 ~~~~~~~~~~~vk~~~WYDNE~gys~  326 (346)
T 3h9e_O          301 AKAGIALNDNFVKLISWYDNEYGYSH  326 (346)
T ss_dssp             TTTCEEEETTEEEEEEEECTTHHHHH
T ss_pred             ccccEEecCCEEEEEEEECCCcchHH
Confidence            99999999999999999999999984
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 93
d3cmco2163 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de 8e-40
d1u8fo2164 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de 3e-38
d1obfo2162 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de 8e-38
d1rm4a2163 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de 1e-35
d2g82a2162 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de 4e-30
d1k3ta2169 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de 6e-27
d1b7go2162 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de 5e-04
d1cf2o2165 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de 0.001
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Bacillus stearothermophilus, nca 1503 [TaxId: 1422]

 Score =  127 bits (320), Expect = 8e-40
 Identities = 40/99 (40%), Positives = 55/99 (55%), Gaps = 13/99 (13%)

Query: 1   VGKVLPSLNGKLTGMAFRLPP-------------KKATYDDIKAAHKEASQGEMKGIFGY 47
           V  VLP L GKL GMA R+P              K+ T +++ AA K A++GE+KGI  Y
Sbjct: 65  VALVLPELKGKLNGMAMRVPTPNVSVVDLVAELEKEVTVEEVNAALKAAAEGELKGILAY 124

Query: 48  IEDDVVSTDFVGDNRSSIFDAKAGISLSDNFEKLVSWYD 86
            E+ +VS D+ G   SS  DA + + +     K+VSWYD
Sbjct: 125 SEEPLVSRDYNGSTVSSTIDALSTMVIDGKMVKVVSWYD 163
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d3cmco2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1rm4a2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1u8fo2164 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2g82a2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1obfo2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1k3ta2169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1b7go2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.5
d1cf2o2165 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.1
d2czca1162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.35
d2hjsa2190 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 91.62
d1t4ba2221 Aspartate beta-semialdehyde dehydrogenase {Escheri 90.53
d1mb4a2222 Aspartate beta-semialdehyde dehydrogenase {Vibrio 86.29
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Bacillus stearothermophilus, nca 1503 [TaxId: 1422]

Probab=100.00  E-value=1.4e-40  Score=233.20  Aligned_cols=86  Identities=47%  Similarity=0.796  Sum_probs=84.2

Q ss_pred             CceeccCCCCCcceeEEEeCC-------------CCCCHHHHHHHHHHhhcCccccccceeccceEeecCCCCCcceEEe
Q 047709            1 VGKVLPSLNGKLTGMAFRLPP-------------KKATYDDIKAAHKEASQGEMKGIFGYIEDDVVSTDFVGDNRSSIFD   67 (93)
Q Consensus         1 v~~vlPeL~Gkl~g~a~RVPt-------------k~~~~~~in~~~k~aa~~~lkgil~~t~~~~VS~Df~g~~~s~i~d   67 (93)
                      +++|||+|+|||+|+||||||             |++++|+||++||+|++++|||||+|+++|+||+||+|++||+|||
T Consensus        65 v~~vlP~L~gkl~g~a~RVPt~~vS~vDlt~~l~k~~t~e~in~~~k~as~~~lkgil~~t~~plVSsDf~g~~~SsI~D  144 (163)
T d3cmco2          65 VALVLPELKGKLNGMAMRVPTPNVSVVDLVAELEKEVTVEEVNAALKAAAEGELKGILAYSEEPLVSRDYNGSTVSSTID  144 (163)
T ss_dssp             HHHHCGGGTTTEEEEEEEESCSSCEEEEEEEEESSCCCHHHHHHHHHHHHHTTTTTTEEEECSCCCGGGGTTCCSSEEEE
T ss_pred             HHHhhHHhCCCcceEEEecCCCcceeEEEEEEecCcCCHHHHHHHHHHHhcCCccCcceeeecccchhhccCCCccEEEE
Confidence            478999999999999999999             9999999999999999999999999999999999999999999999


Q ss_pred             CCCceeecCCeEEEEEEcC
Q 047709           68 AKAGISLSDNFEKLVSWYD   86 (93)
Q Consensus        68 ~~~t~~~~~~~vkl~~WyD   86 (93)
                      +.+|++++++++|+++|||
T Consensus       145 ~~~t~v~~~~~vKv~aWYD  163 (163)
T d3cmco2         145 ALSTMVIDGKMVKVVSWYD  163 (163)
T ss_dssp             GGGCEEETTTEEEEEEEEC
T ss_pred             cccCEEECCCEEEEEEEeC
Confidence            9999999999999999998
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure