Citrus Sinensis ID: 047744


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MKGGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEFPMSDWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIEVKPAPYNVLLEDDTYKGQIVIGFKFIVN
cccEEEEEEEEEEEccccccccccccEEEEEEEccEEEEEEEEEccccccEEccEEEEEEEcccccccEEEEEEEEEccccccccccEEEEEEccccccccccEEEEEccEEEcccccccEEEEccccccEEEcccccccEEEEEEEEEEc
cccEEEEEEEEEcccccccccccccccEEEEEEccEEEEEEEEEcccccccEcEEEEEEEcccccccccEEEEEEEEcccccccccEEEEEEEcHHHHHHcccccccHHHHHHccccccccEccccccccEEEccccEEEEEEEEEEEEcc
MKGGILEVLLVNAegikhtnifgtpSYYVIARcgnqehrsknsmvkgekawwnekfifefpmsdwklLTHIKFRIMdtelltdggfvgETVFSYIHDQTSVNQCRYYLggiitdqsndkelievkpapynvlleddtykgqiVIGFKFIVN
MKGGILEVLLVNAEgikhtnifgTPSYYVIARCgnqehrsknsMVKGEKAWWNEKFIFEFPMSDWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIItdqsndkelIEVKPApynvlleddtykgqIVIGFKFIVN
MKGGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEFPMSDWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIEVKPAPYNVLLEDDTYKGQIVIGFKFIVN
***GILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQ*******MVKGEKAWWNEKFIFEFPMSDWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIEVKPAPYNVLLEDDTYKGQIVIGFKFIV*
*KGGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSK*SMVKGEKAWWNEKFIFEFPMSDWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGG***********IEVKPAPYNVLLEDDTYKGQIVIGFKFIVN
MKGGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQE*********GEKAWWNEKFIFEFPMSDWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIEVKPAPYNVLLEDDTYKGQIVIGFKFIVN
*KGGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEFPMSDWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIEVKPAPYNVLLEDDTYKGQIVIGFKFIVN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEFPMSDWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIEVKPAPYNVLLEDDTYKGQIVIGFKFIVN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query151 2.2.26 [Sep-21-2011]
Q0JBH9144 Elicitor-responsive prote yes no 0.807 0.847 0.317 7e-12
Q25AG5144 Elicitor-responsive prote N/A no 0.807 0.847 0.317 7e-12
Q9C8S6147 C2 domain-containing prot no no 0.807 0.829 0.277 7e-07
Q0JHU5159 Elicitor-responsive prote no no 0.880 0.836 0.245 1e-05
A2WWV5159 Elicitor-responsive prote N/A no 0.880 0.836 0.245 1e-05
Q9ZT47150 16 kDa phloem protein 1 O N/A no 0.867 0.873 0.258 9e-05
Q9ZT46138 16 kDa phloem protein 2 O N/A no 0.867 0.949 0.264 0.0004
>sp|Q0JBH9|ERG3_ORYSJ Elicitor-responsive protein 3 OS=Oryza sativa subsp. japonica GN=ERG3 PE=2 SV=1 Back     alignment and function desciption
 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 72/148 (48%), Gaps = 26/148 (17%)

Query: 1   MKGGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEF 60
           M  G LEVLLV A+G+++T+       Y + +C +QE +S  +  KG    WNE F+F  
Sbjct: 1   MVQGTLEVLLVGAKGLENTDYLCNMDPYAVLKCRSQEQKSSVASGKGSDPEWNETFMFSV 60

Query: 61  PMSDWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKE 120
             +     T +  ++MD++  TD  FVGE   S              L  I T+ S    
Sbjct: 61  THN----ATELIIKLMDSDSGTDDDFVGEATIS--------------LEAIYTEGS---- 98

Query: 121 LIEVKPAPYNVLLEDDTYKGQIVIGFKF 148
              + P  YNV+ E++ Y+G+I +G  F
Sbjct: 99  ---IPPTVYNVVKEEE-YRGEIKVGLTF 122





Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q25AG5|ERG3_ORYSI Elicitor-responsive protein 3 OS=Oryza sativa subsp. indica GN=ERG3 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8S6|Y1322_ARATH C2 domain-containing protein At1g63220 OS=Arabidopsis thaliana GN=At1g63220 PE=1 SV=1 Back     alignment and function description
>sp|Q0JHU5|ERG1_ORYSJ Elicitor-responsive protein 1 OS=Oryza sativa subsp. japonica GN=ERG1 PE=2 SV=1 Back     alignment and function description
>sp|A2WWV5|ERG1_ORYSI Elicitor-responsive protein 1 OS=Oryza sativa subsp. indica GN=ERG1 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZT47|PP16A_CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxima GN=PP16-1 PE=1 SV=3 Back     alignment and function description
>sp|Q9ZT46|PP16B_CUCMA 16 kDa phloem protein 2 OS=Cucurbita maxima GN=PP16-2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
255541594 751 pentatricopeptide repeat-containing prot 0.900 0.181 0.609 9e-45
356506222217 PREDICTED: elicitor-responsive protein 3 0.900 0.626 0.589 1e-40
186511394202 Calcium-dependent lipid-binding (CaLB do 0.900 0.673 0.556 5e-40
297810133204 hypothetical protein ARALYDRAFT_327726 [ 0.900 0.666 0.556 7e-40
359489798 804 PREDICTED: pentatricopeptide repeat-cont 0.894 0.167 0.573 2e-39
147834193 826 hypothetical protein VITISV_040403 [Viti 0.596 0.108 0.523 1e-21
357143075188 PREDICTED: uncharacterized protein LOC10 0.867 0.696 0.374 1e-19
242066448204 hypothetical protein SORBIDRAFT_04g03248 0.880 0.651 0.386 1e-18
50251363221 hypothetical protein [Oryza sativa Japon 0.894 0.610 0.331 1e-17
218191318183 hypothetical protein OsI_08382 [Oryza sa 0.754 0.622 0.364 3e-15
>gi|255541594|ref|XP_002511861.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549041|gb|EEF50530.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  184 bits (468), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 92/151 (60%), Positives = 110/151 (72%), Gaps = 15/151 (9%)

Query: 1   MKGGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEF 60
           MK GILEVLLV+AEGI+HTN+ G P+YYVI +CGN+ H SK S  K ++A WNEKF FEF
Sbjct: 564 MKKGILEVLLVHAEGIRHTNLIGRPAYYVITQCGNRVHESKVSSGKDQEACWNEKFRFEF 623

Query: 61  PMSDWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKE 120
           P+ DWK +TH+KFRIMD E  TD GFVGET+               YLGGII +  N K 
Sbjct: 624 PLIDWKRMTHLKFRIMDKEFFTDSGFVGETII--------------YLGGIIAEGIN-KG 668

Query: 121 LIEVKPAPYNVLLEDDTYKGQIVIGFKFIVN 151
           ++EVKPAPYNV+LEDDTYKG+I IG  FI+N
Sbjct: 669 ILEVKPAPYNVVLEDDTYKGEIKIGLNFIIN 699




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356506222|ref|XP_003521886.1| PREDICTED: elicitor-responsive protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|186511394|ref|NP_001118904.1| Calcium-dependent lipid-binding (CaLB domain) family protein [Arabidopsis thaliana] gi|332656486|gb|AEE81886.1| Calcium-dependent lipid-binding (CaLB domain) family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297810133|ref|XP_002872950.1| hypothetical protein ARALYDRAFT_327726 [Arabidopsis lyrata subsp. lyrata] gi|297318787|gb|EFH49209.1| hypothetical protein ARALYDRAFT_327726 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359489798|ref|XP_002274780.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147834193|emb|CAN75306.1| hypothetical protein VITISV_040403 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357143075|ref|XP_003572794.1| PREDICTED: uncharacterized protein LOC100841553 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|242066448|ref|XP_002454513.1| hypothetical protein SORBIDRAFT_04g032480 [Sorghum bicolor] gi|241934344|gb|EES07489.1| hypothetical protein SORBIDRAFT_04g032480 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|50251363|dbj|BAD28390.1| hypothetical protein [Oryza sativa Japonica Group] gi|125583175|gb|EAZ24106.1| hypothetical protein OsJ_07845 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218191318|gb|EEC73745.1| hypothetical protein OsI_08382 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
TAIR|locus:4515103319202 AT4G00467 "AT4G00467" [Arabido 0.887 0.663 0.563 4.2e-40
TAIR|locus:2099946156 AT3G55470 "AT3G55470" [Arabido 0.841 0.814 0.277 2e-08
TAIR|locus:2038461147 AT1G63220 "AT1G63220" [Arabido 0.880 0.904 0.260 4.8e-07
TAIR|locus:2124321247 AT4G34150 "AT4G34150" [Arabido 0.556 0.340 0.295 0.00022
TAIR|locus:4515103319 AT4G00467 "AT4G00467" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 427 (155.4 bits), Expect = 4.2e-40, P = 4.2e-40
 Identities = 84/149 (56%), Positives = 106/149 (71%)

Query:     1 MKGGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEF 60
             MK GILEV L++A GI HTN  GTP YYV+ +CG +E+RSK S    + A WN+KF+F+F
Sbjct:     1 MKRGILEVFLIDAHGITHTNFIGTPVYYVLLQCGTKEYRSKMSKGDNDNALWNQKFVFDF 60

Query:    61 PMSDWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKE 120
             PMS WK LT+IK RI+D EL  DGGFVGET+   IH           LGGIIT+   D+ 
Sbjct:    61 PMSQWKKLTYIKLRILDKELFNDGGFVGETI---IH-----------LGGIITE-GRDRG 105

Query:   121 LIEVKPAPYNVLLEDDTYKGQIVIGFKFI 149
              IE+KPAPYNV+LEDDT+KG++ +G +FI
Sbjct:   106 YIEIKPAPYNVVLEDDTFKGELKVGLRFI 134




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2099946 AT3G55470 "AT3G55470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038461 AT1G63220 "AT1G63220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124321 AT4G34150 "AT4G34150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0JBH9ERG3_ORYSJNo assigned EC number0.31750.80790.8472yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT4G00467
unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biological_process unknown; LOCATED IN- cellular_component unknown; CONTAINS InterPro DOMAIN/s- C2 membrane targeting protein (InterPro-IPR018029), C2 calcium/lipid-binding region, CaLB (InterPro-IPR008973), C2 calcium-dependent membrane targeting (InterPro-IPR000008); BEST Arabidopsis thaliana protein match is- C2 domain-containing protein (TAIR-AT3G55470.2); Has 88 Blast hits to 88 proteins in 15 species- Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 87; Viruses - 0; Other Eukaryotes - 1 (source- NCB [...] (202 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
cd04049124 cd04049, C2_putative_Elicitor-responsive_gene, C2 2e-45
pfam0016885 pfam00168, C2, C2 domain 2e-07
smart00239101 smart00239, C2, Protein kinase C conserved region 4e-06
cd00030102 cd00030, C2, C2 domain 7e-06
cd04046126 cd04046, C2_Calpain, C2 domain present in Calpain 4e-05
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 0.001
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
 Score =  144 bits (365), Expect = 2e-45
 Identities = 52/139 (37%), Positives = 72/139 (51%), Gaps = 15/139 (10%)

Query: 4   GILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEFPMS 63
           G LEVLL++A+G++ T+  G    YVI +C  QE +SK +   G    WNEKF F     
Sbjct: 1   GTLEVLLISAKGLQDTDFLGKIDPYVIIQCRTQERKSKVAKGDGRNPEWNEKFKFTVEYP 60

Query: 64  DWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIE 123
            W   T +  RIMD +  +D  F+GE                 +L G+   +  +    E
Sbjct: 61  GWGGDTKLILRIMDKDNFSDDDFIGEATI--------------HLKGLFE-EGVEPGTAE 105

Query: 124 VKPAPYNVLLEDDTYKGQI 142
           + PA YNV+LEDDTYKG+I
Sbjct: 106 LVPAKYNVVLEDDTYKGEI 124


In plants elicitor-responsive proteins are triggered in response to specific elicitor molecules such as glycolproteins, peptides, carbohydrates and lipids. A host of defensive responses are also triggered resulting in localized cell death. Antimicrobial secondary metabolites, such as phytoalexins, or defense-related proteins, including pathogenesis-related (PR) proteins are also produced. There is a single C2 domain present here. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Members have a type-II topology. Length = 124

>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 151
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.96
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.94
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.94
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.93
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.93
KOG1030168 consensus Predicted Ca2+-dependent phospholipid-bi 99.93
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.93
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.92
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.92
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.92
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.92
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.92
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.92
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.92
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.91
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.91
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.91
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.91
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.91
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.91
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.9
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.9
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.9
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.9
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.9
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.89
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.89
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.89
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.89
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.89
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.89
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.88
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.88
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.88
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.88
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.88
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.88
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.88
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.88
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.88
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.87
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.87
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.87
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.86
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.86
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.86
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.86
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.86
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.86
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.86
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.86
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.86
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.86
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.85
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.85
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.85
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.85
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.85
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.84
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.84
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.84
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.84
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.83
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.83
KOG1028 421 consensus Ca2+-dependent phospholipid-binding prot 99.83
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.82
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.82
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.82
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.82
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.82
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.81
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.81
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.8
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.8
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.8
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.8
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.8
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.79
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.79
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.79
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.79
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.79
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.79
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.78
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.78
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.78
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.78
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.78
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.77
PLN03008 868 Phospholipase D delta 99.77
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.77
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.76
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.76
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.75
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.71
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.68
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.58
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 99.56
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.55
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.54
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 99.53
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.52
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 99.51
PLN02223537 phosphoinositide phospholipase C 99.47
PLN02952599 phosphoinositide phospholipase C 99.4
PLN02270 808 phospholipase D alpha 99.39
KOG0169746 consensus Phosphoinositide-specific phospholipase 99.38
PLN02230598 phosphoinositide phospholipase C 4 99.35
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.33
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 99.3
PLN02222581 phosphoinositide phospholipase C 2 99.29
PLN02228567 Phosphoinositide phospholipase C 99.28
KOG12641267 consensus Phospholipase C [Lipid transport and met 99.22
KOG1031 1169 consensus Predicted Ca2+-dependent phospholipid-bi 99.18
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 99.16
KOG13281103 consensus Synaptic vesicle protein BAIAP3, involve 99.1
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 99.06
PLN02352 758 phospholipase D epsilon 98.91
KOG09051639 consensus Phosphoinositide 3-kinase [Signal transd 98.77
KOG1013 362 consensus Synaptic vesicle protein rabphilin-3A [I 98.71
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 98.62
PLN02964 644 phosphatidylserine decarboxylase 98.37
KOG1013362 consensus Synaptic vesicle protein rabphilin-3A [I 98.34
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.19
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 98.03
KOG1327 529 consensus Copine [Signal transduction mechanisms] 97.99
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 97.89
KOG1265 1189 consensus Phospholipase C [Lipid transport and met 97.86
KOG10111283 consensus Neurotransmitter release regulator, UNC- 97.77
KOG2060405 consensus Rab3 effector RIM1 and related proteins, 97.75
KOG3837523 consensus Uncharacterized conserved protein, conta 97.57
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 97.47
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 97.41
PF15627156 CEP76-C2: CEP76 C2 domain 97.29
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 97.21
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 97.13
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 97.13
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 97.13
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 97.02
cd08397159 C2_PI3K_class_III C2 domain present in class III p 96.77
KOG1327 529 consensus Copine [Signal transduction mechanisms] 96.53
PF12416 340 DUF3668: Cep120 protein; InterPro: IPR022136 This 96.44
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 96.28
KOG1452 442 consensus Predicted Rho GTPase-activating protein 96.08
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 95.63
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 94.05
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 93.79
cd08679178 C2_DOCK180_related C2 domains found in Dedicator O 93.54
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 93.23
PF11618107 DUF3250: Protein of unknown function (DUF3250); In 92.76
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 90.82
cd08696179 C2_Dock-C C2 domains found in Dedicator Of CytoKin 89.57
cd08697185 C2_Dock-D C2 domains found in Dedicator Of CytoKin 88.53
KOG1329 887 consensus Phospholipase D1 [Lipid transport and me 84.81
KOG0694 694 consensus Serine/threonine protein kinase [Signal 83.31
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
Probab=99.96  E-value=2.6e-28  Score=162.50  Aligned_cols=120  Identities=16%  Similarity=0.251  Sum_probs=101.4

Q ss_pred             CcEEEEEEEEeeCCCCCCCCCCCCEEEEEEECCeeeEEeeeeCCCCCCeeceEEEEEEeCCCccccceEEEEEEECCCCC
Q 047744            3 GGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEFPMSDWKLLTHIKFRIMDTELLT   82 (151)
Q Consensus         3 ~g~L~V~v~~a~~L~~~~~~~~~dpyv~v~~~~~~~~T~~~~~~~~nP~wne~f~f~v~~~~~~~~~~L~v~v~d~~~~~   82 (151)
                      .|+|+|+|++|++++..+ .|++||||++.+++++.+|++..+++.||+|||+|.|.+...    ...|.|+|||++.++
T Consensus         1 ~g~L~v~v~~Ak~l~~~~-~g~sDPYv~i~lg~~~~kT~v~~~~~~nP~WNe~F~f~v~~~----~~~l~~~V~d~d~~~   75 (121)
T cd04016           1 VGRLSITVVQAKLVKNYG-LTRMDPYCRIRVGHAVYETPTAYNGAKNPRWNKTIQCTLPEG----VDSIYIEIFDERAFT   75 (121)
T ss_pred             CcEEEEEEEEccCCCcCC-CCCCCceEEEEECCEEEEeEEccCCCCCCccCeEEEEEecCC----CcEEEEEEEeCCCCc
Confidence            489999999999998887 789999999999999999998876689999999999998752    367999999999999


Q ss_pred             CCcccEEEEEeccccccccceeeeecCc-ccccCCCcceeeeeeccccceecCCCccceEEEEEEEE
Q 047744           83 DGGFVGETVFSYIHDQTSVNQCRYYLGG-IITDQSNDKELIEVKPAPYNVLLEDDTYKGQIVIGFKF  148 (151)
Q Consensus        83 ~d~~iG~~~~~~~~~~~~~~~~~i~l~~-~~~~~~~~~~~~~l~~~~~~~~~~~~~~~G~i~~~~~~  148 (151)
                      +|++||.+.              +++.. +...... ..|+.|.+..      .....|+|+++++|
T Consensus        76 ~dd~iG~~~--------------i~l~~~~~~g~~~-~~W~~L~~~~------~~~~~g~i~l~l~y  121 (121)
T cd04016          76 MDERIAWTH--------------ITIPESVFNGETL-DDWYSLSGKQ------GEDKEGMINLVFSY  121 (121)
T ss_pred             CCceEEEEE--------------EECchhccCCCCc-cccEeCcCcc------CCCCceEEEEEEeC
Confidence            999999999              99974 4433334 7888886532      33467999999987



Tollip is a part of the Interleukin-1 receptor (IL-1R) signaling pathway. Tollip is proposed to link serine/threonine kinase IRAK to IL-1Rs as well as inhibiting phosphorylation of IRAK. There is a single C2 domain present in Tollip. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice varian

>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG1264 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1031 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG0905 consensus Phosphoinositide 3-kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG1013 consensus Synaptic vesicle protein rabphilin-3A [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1265 consensus Phospholipase C [Lipid transport and metabolism] Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2060 consensus Rab3 effector RIM1 and related proteins, contain PDZ and C2 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3837 consensus Uncharacterized conserved protein, contains DM14 and C2 domains [General function prediction only] Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1327 consensus Copine [Signal transduction mechanisms] Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>PF11618 DUF3250: Protein of unknown function (DUF3250); InterPro: IPR021656 This family of proteins represents a protein with unknown function Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>KOG1329 consensus Phospholipase D1 [Lipid transport and metabolism] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
1wfj_A136 C2 Domain-Containing Protein From Putative Elicitor 2e-07
>pdb|1WFJ|A Chain A, C2 Domain-Containing Protein From Putative Elicitor- Responsive Gene Length = 136 Back     alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 40/145 (27%), Positives = 62/145 (42%), Gaps = 26/145 (17%) Query: 4 GILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEFPMS 63 G LEV+LV+A+G++ + YV C Q+ +S + G WNE FIF Sbjct: 10 GTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTVSEG 69 Query: 64 DWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIE 123 T +K +I D ++ T+ VGE L + + S Sbjct: 70 ----TTELKAKIFDKDVGTEDDAVGEATIP--------------LEPVFVEGS------- 104 Query: 124 VKPAPYNVLLEDDTYKGQIVIGFKF 148 + P YNV ++D+ YKG+I + F Sbjct: 105 IPPTAYNV-VKDEEYKGEIWVALSF 128

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 5e-21
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 1e-07
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 3e-06
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 3e-05
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 6e-05
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 2e-04
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 2e-04
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 4e-04
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
 Score = 82.0 bits (203), Expect = 5e-21
 Identities = 38/145 (26%), Positives = 61/145 (42%), Gaps = 26/145 (17%)

Query: 4   GILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEFPMS 63
           G LEV+LV+A+G++  +       YV   C  Q+ +S  +   G    WNE FIF     
Sbjct: 10  GTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTVSEG 69

Query: 64  DWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIE 123
                T +K +I D ++ T+   VGE                  L  +  +         
Sbjct: 70  T----TELKAKIFDKDVGTEDDAVGEATIP--------------LEPVFVEG-------S 104

Query: 124 VKPAPYNVLLEDDTYKGQIVIGFKF 148
           + P  YN +++D+ YKG+I +   F
Sbjct: 105 IPPTAYN-VVKDEEYKGEIWVALSF 128


>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.95
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.95
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.94
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.94
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.94
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.94
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.94
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.92
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.92
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.91
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.91
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.91
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.9
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.9
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.89
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.88
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.88
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.88
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.88
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.88
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.88
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.88
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.87
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.87
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.87
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.87
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.86
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.86
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.86
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.86
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.86
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.86
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.86
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.85
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.85
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.85
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.84
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.84
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.83
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.82
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.78
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.77
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.75
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.71
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.65
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.64
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.54
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.54
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.53
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 99.37
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 99.32
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 95.76
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 95.26
2yrb_A156 Protein fantom; beta sandwich, NPPSFA, national pr 93.71
1e7u_A 961 Phosphatidylinositol 3-kinase catalytic subunit; p 92.91
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 92.62
2y3a_A 1092 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 91.98
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
Probab=99.95  E-value=3.1e-27  Score=159.07  Aligned_cols=124  Identities=30%  Similarity=0.480  Sum_probs=105.8

Q ss_pred             CCcEEEEEEEEeeCCCCCCCCCCCCEEEEEEECCeeeEEeeeeCCCCCCeeceEEEEEEeCCCccccceEEEEEEECCCC
Q 047744            2 KGGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEFPMSDWKLLTHIKFRIMDTELL   81 (151)
Q Consensus         2 ~~g~L~V~v~~a~~L~~~~~~~~~dpyv~v~~~~~~~~T~~~~~~~~nP~wne~f~f~v~~~~~~~~~~L~v~v~d~~~~   81 (151)
                      +.|.|.|+|++|++|+..+..+.+||||++.+.+++.+|++++.++.||.|||+|.|.+..    ....|.|+|||++.+
T Consensus         8 ~~~~L~v~v~~a~~L~~~d~~g~~dpyv~v~~~~~~~kT~~~~~~~~nP~Wne~f~f~v~~----~~~~l~~~V~d~~~~   83 (136)
T 1wfj_A            8 PHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTVSE----GTTELKAKIFDKDVG   83 (136)
T ss_dssp             CEEEEEEEEEEEEECSSCCSSCSSCCCEEEESSSCEEECCCCTTCCSSCEEEEEEEEEEES----SCCEEEEEECCSSSC
T ss_pred             CcEEEEEEEEeccCCCCcccCCCcCceEEEEECCccceeEeccCCCCCCccCcEEEEEECC----CCCEEEEEEEECCCC
Confidence            5789999999999999999889999999999998888998876469999999999999986    357899999999999


Q ss_pred             CCCcccEEEEEeccccccccceeeeecCcccccCCCcceeeeeeccccceecCCCccceEEEEEEEEEeC
Q 047744           82 TDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIEVKPAPYNVLLEDDTYKGQIVIGFKFIVN  151 (151)
Q Consensus        82 ~~d~~iG~~~~~~~~~~~~~~~~~i~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~G~i~~~~~~~~~  151 (151)
                      ++|++||++.              +++.++...+.....|+.|.        ..++..|+|.++++|.|.
T Consensus        84 ~~d~~lG~~~--------------i~l~~l~~~~~~~~~w~~L~--------~~~~~~G~i~l~l~~~p~  131 (136)
T 1wfj_A           84 TEDDAVGEAT--------------IPLEPVFVEGSIPPTAYNVV--------KDEEYKGEIWVALSFKPS  131 (136)
T ss_dssp             TTTCCSEEEE--------------EESHHHHHHSEEEEEEEEEE--------ETTEEEEEEEEEEEEEEC
T ss_pred             CCCceEEEEE--------------EEHHHhccCCCCCcEEEEee--------cCCccCEEEEEEEEEEeC
Confidence            9999999999              99998864443213455553        356788999999999884



>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
>2yrb_A Protein fantom; beta sandwich, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 151
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 1e-12
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 2e-07
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 3e-06
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 7e-06
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 4e-05
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 5e-05
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 1e-04
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-04
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 5e-04
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 6e-04
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 0.002
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 0.003
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain protein At1g63220
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 59.0 bits (142), Expect = 1e-12
 Identities = 38/146 (26%), Positives = 61/146 (41%), Gaps = 26/146 (17%)

Query: 4   GILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEFPMS 63
           G LEV+LV+A+G++  +       YV   C  Q+ +S  +   G    WNE FIF     
Sbjct: 10  GTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTVSEG 69

Query: 64  DWKLLTHIKFRIMDTELLTDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIE 123
                T +K +I D ++ T+   VGE                  L  +  +         
Sbjct: 70  T----TELKAKIFDKDVGTEDDAVGEATIP--------------LEPVFVEG-------S 104

Query: 124 VKPAPYNVLLEDDTYKGQIVIGFKFI 149
           + P  YN +++D+ YKG+I +   F 
Sbjct: 105 IPPTAYN-VVKDEEYKGEIWVALSFK 129


>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.96
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.96
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.92
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.91
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.89
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.89
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.89
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.87
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.87
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.87
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.86
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.83
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.83
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.83
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.81
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.8
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.79
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.75
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.74
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.64
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 96.21
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: C2 domain protein At1g63220
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.96  E-value=1e-29  Score=170.12  Aligned_cols=124  Identities=32%  Similarity=0.561  Sum_probs=106.0

Q ss_pred             CCcEEEEEEEEeeCCCCCCCCCCCCEEEEEEECCeeeEEeeeeCCCCCCeeceEEEEEEeCCCccccceEEEEEEECCCC
Q 047744            2 KGGILEVLLVNAEGIKHTNIFGTPSYYVIARCGNQEHRSKNSMVKGEKAWWNEKFIFEFPMSDWKLLTHIKFRIMDTELL   81 (151)
Q Consensus         2 ~~g~L~V~v~~a~~L~~~~~~~~~dpyv~v~~~~~~~~T~~~~~~~~nP~wne~f~f~v~~~~~~~~~~L~v~v~d~~~~   81 (151)
                      +.|+|+|+|++|++|+..+..+++||||+++++.+.++|++++.++.||.|||+|.|.+...    ...|.|+|||++.+
T Consensus         8 p~G~L~V~v~~a~~L~~~d~~g~~Dpyv~v~~~~~~~~t~~~~~~~~nP~Wne~f~f~v~~~----~~~L~v~V~d~d~~   83 (136)
T d1wfja_           8 PHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTVSEG----TTELKAKIFDKDVG   83 (136)
T ss_dssp             CEEEEEEEEEEEEECSSCCSSCSSCCCEEEESSSCEEECCCCTTCCSSCEEEEEEEEEEESS----CCEEEEEECCSSSC
T ss_pred             CcEEEEEEEEEeeCCCCCCCCCCCCccEEEEEeeeeEEEEEEecCCCcEEEeeEEEEEEcCc----cceEEEEEEEecCC
Confidence            46899999999999999999999999999999999999988876789999999999999863    46799999999999


Q ss_pred             CCCcccEEEEEeccccccccceeeeecCcccccCCCcceeeeeeccccceecCCCccceEEEEEEEEEeC
Q 047744           82 TDGGFVGETVFSYIHDQTSVNQCRYYLGGIITDQSNDKELIEVKPAPYNVLLEDDTYKGQIVIGFKFIVN  151 (151)
Q Consensus        82 ~~d~~iG~~~~~~~~~~~~~~~~~i~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~G~i~~~~~~~~~  151 (151)
                      ++|++||++.              |+|.++...+..       .+.++.+. .+++.+|+|.++++|.|.
T Consensus        84 ~~d~~iG~~~--------------i~L~~l~~~~~~-------~~~~~~l~-~~~~~~G~i~l~l~~~p~  131 (136)
T d1wfja_          84 TEDDAVGEAT--------------IPLEPVFVEGSI-------PPTAYNVV-KDEEYKGEIWVALSFKPS  131 (136)
T ss_dssp             TTTCCSEEEE--------------EESHHHHHHSEE-------EEEEEEEE-ETTEEEEEEEEEEEEEEC
T ss_pred             CCCCEEEEEE--------------EEhHHhcccCCc-------CcEEEEec-CCCccCEEEEEEEEEEeC
Confidence            9999999999              999998755433       23333333 467789999999999984



>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure