Citrus Sinensis ID: 047835

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MRKKILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRRKIGYVETMKLDILDGRNQPAIEPEVPQQPFPAETPCCSIM
ccEEEEEEEEccccHHHHHHHHHHHHccccEEEEEEEccccccEEEEccccHHHHHHHHHHcccEEEEEEEEEcccccccccccccccccccccccccccc
cccEEEEEEccccccccHHHHHHHHHcccccEEEEEEcccccEEEEEEcccHHHHHHHHHHHcccEEEEEEEEEccccccccccccccccccccccccccc
MRKKILYRldnmhspkcrtKAFKIIagfpgllsvamkgddlrhmEVIGDIDEVALANMLRRKIGYVETMKLdildgrnqpaiepevpqqpfpaetpccsim
mrkkilyrldnmhspkcRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRRKIGYVETMKLDILDGRNQPaiepevpqqpfpaetpccsim
MRKKILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRRKIGYVETMKLDILDGRNQPAIEPEVPQQPFPAETPCCSIM
****ILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRRKIGYVETMKLDILD**************************
*RKKILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRRKIGYVETMK********************FPAETPCCSIM
MRKKILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRRKIGYVETMKLDILDGRNQPAIEPEVPQQPFPAETPCCSIM
*RKKILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRRKIGYVETMKLDILDGRNQ****PEVPQQPFPAETPCC***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKKILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRRKIGYVETMKLDILDGRNQPAIEPEVPQQPFPAETPCCSIM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
224104235114 predicted protein [Populus trichocarpa] 0.990 0.877 0.339 6e-10
224150813118 predicted protein [Populus trichocarpa] 0.990 0.847 0.336 8e-09
225447460118 PREDICTED: uncharacterized protein LOC10 0.990 0.847 0.302 8e-08
224104585121 predicted protein [Populus trichocarpa] 0.693 0.578 0.388 8e-08
225454107124 PREDICTED: uncharacterized protein LOC10 0.950 0.774 0.339 2e-07
296085070 213 unnamed protein product [Vitis vinifera] 0.722 0.342 0.36 4e-07
35744814577 hypothetical protein MTR_2g027600 [Medic 0.693 0.909 0.416 2e-06
255584629119 metal ion binding protein, putative [Ric 0.891 0.756 0.368 3e-06
125540061130 hypothetical protein OsI_07838 [Oryza sa 0.613 0.476 0.428 3e-06
255567218125 metal ion binding protein, putative [Ric 0.722 0.584 0.36 3e-06
>gi|224104235|ref|XP_002313367.1| predicted protein [Populus trichocarpa] gi|222849775|gb|EEE87322.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 65/115 (56%), Gaps = 15/115 (13%)

Query: 1   MRKKILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGD-IDEVALANML 59
           M++KI+ ++   + PK RTKA +I  G  G+ S  + G+D   +EV+GD +D V L N+L
Sbjct: 1   MKQKIVIKVTG-NGPKSRTKALRIAVGLSGVESARLGGEDKSQIEVVGDGVDAVQLTNLL 59

Query: 60  RRKIGYVETMKLDIL-DGRNQPAIEP--------EVPQQPF----PAETPCCSIM 101
           R+K+GY E   ++ + + + +P ++P         +PQ       P + P CSIM
Sbjct: 60  RKKVGYAELASVEAVGEKKEEPEVQPVDWPVYVGGMPQTYIYPIHPHQDPSCSIM 114

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224150813|ref|XP_002337014.1| predicted protein [Populus trichocarpa] gi|222837833|gb|EEE76198.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225447460|ref|XP_002266819.1| PREDICTED: uncharacterized protein LOC100242530 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224104585|ref|XP_002333922.1| predicted protein [Populus trichocarpa] gi|224129254|ref|XP_002320539.1| predicted protein [Populus trichocarpa] gi|222839172|gb|EEE77523.1| predicted protein [Populus trichocarpa] gi|222861312|gb|EEE98854.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225454107|ref|XP_002268731.1| PREDICTED: uncharacterized protein LOC100255094 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085070|emb|CBI28485.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357448145|ref|XP_003594348.1| hypothetical protein MTR_2g027600 [Medicago truncatula] gi|124360895|gb|ABN08867.1| Heavy metal transport/detoxification protein [Medicago truncatula] gi|355483396|gb|AES64599.1| hypothetical protein MTR_2g027600 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255584629|ref|XP_002533038.1| metal ion binding protein, putative [Ricinus communis] gi|223527176|gb|EEF29346.1| metal ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|125540061|gb|EAY86456.1| hypothetical protein OsI_07838 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|255567218|ref|XP_002524590.1| metal ion binding protein, putative [Ricinus communis] gi|223536143|gb|EEF37798.1| metal ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
TAIR|locus:2091112157 AT3G07600 [Arabidopsis thalian 0.960 0.617 0.354 4.7e-09
TAIR|locus:2156253181 AT5G48290 [Arabidopsis thalian 0.693 0.386 0.347 2.5e-08
TAIR|locus:2149594139 AT5G52750 [Arabidopsis thalian 0.821 0.597 0.313 3.4e-06
TAIR|locus:2087580118 AT3G20180 "AT3G20180" [Arabido 0.693 0.593 0.337 9e-06
TAIR|locus:2025421177 AT1G01490 [Arabidopsis thalian 0.801 0.457 0.333 2.3e-05
TAIR|locus:2138376110 AT4G05030 "AT4G05030" [Arabido 0.702 0.645 0.328 2.4e-05
TAIR|locus:2149629111 AT5G52770 [Arabidopsis thalian 0.722 0.657 0.333 8.1e-05
TAIR|locus:2091112 AT3G07600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 134 (52.2 bits), Expect = 4.7e-09, P = 4.7e-09
 Identities = 39/110 (35%), Positives = 58/110 (52%)

Query:     1 MRKKILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIG-DIDEVALANML 59
             M++KIL R+  M     R KA K    F G+ +V +KGD    +EV G ++D +AL N L
Sbjct:     1 MKQKILIRIA-MTDDTTRAKAMKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTL 59

Query:    60 RRKIGYVETMKLDIL----DGRNQPAIE--PEV--PQQPFPAET---PCC 98
             R+K+ + E + +  +    DG  +P  E  PE   P++  P E    PCC
Sbjct:    60 RKKVAFAELVSVAKVEPPKDGDKKPEEEKKPEEKKPEEKKPEEKKPEPCC 109
GO:0005634 "nucleus" evidence=ISM
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA;ISS
TAIR|locus:2156253 AT5G48290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149594 AT5G52750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087580 AT3G20180 "AT3G20180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025421 AT1G01490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138376 AT4G05030 "AT4G05030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149629 AT5G52770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_IX3674
hypothetical protein (114 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 6e-06
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information 
 Score = 39.9 bits (94), Expect = 6e-06
 Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 3/61 (4%)

Query: 7  YRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLR--RKIG 64
           R+  M    C  K  K ++  PG+ SV++  +    + V GD D + L  + +   K G
Sbjct: 2  LRVPGMTCAGCAKKVEKALSKLPGVSSVSVDLET-GKVTVTGDPDPLKLEKLKKAIEKAG 60

Query: 65 Y 65
          Y
Sbjct: 61 Y 61

Length = 62

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 101
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.75
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 99.24
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.39
KOG4656 247 consensus Copper chaperone for superoxide dismutas 98.37
PLN02957 238 copper, zinc superoxide dismutase 98.06
PRK10671 834 copA copper exporting ATPase; Provisional 97.7
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 94.6
TIGR0000368 copper ion binding protein. This model describes a 94.36
PRK10671 834 copA copper exporting ATPase; Provisional 92.94
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 91.66
cd0409880 eEF2_C_snRNP eEF2_C_snRNP: This family includes a 84.67
PF0268095 DUF211: Uncharacterized ArCR, COG1888; InterPro: I 84.41
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 84.02
PF0067989 EFG_C: Elongation factor G C-terminus; InterPro: I 83.34
smart0083885 EFG_C Elongation factor G C-terminus. This domain 82.01
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 81.56
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.75  E-value=9.5e-18  Score=107.18  Aligned_cols=67  Identities=21%  Similarity=0.344  Sum_probs=61.8

Q ss_pred             cceEEEEEeCCChHhhHHHHHHHHcCCCCeeEEEecCCCCCcEEEEEEccHHHHHHHHHhcc-CceEEEe
Q 047835            2 RKKILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRRKI-GYVETMK   70 (101)
Q Consensus         2 ~q~vvlKV~m~C~e~C~~Kv~k~l~~~~GV~sV~id~~~k~kvtV~G~vDp~~l~~~LrKk~-~~aeivs   70 (101)
                      .++.+++|+||| +||.+++.+.+.++.||+++.+|.++ ++|||.|++||..|+++|+|.+ +.+++|.
T Consensus         4 ~~~~v~kv~~~C-~gc~~kV~~~l~~~~GV~~v~id~~~-~kvtV~g~~~p~~vl~~l~k~~~k~~~~~~   71 (73)
T KOG1603|consen    4 IKTVVLKVNMHC-EGCARKVKRVLQKLKGVESVDIDIKK-QKVTVKGNVDPVKLLKKLKKTGGKRAELWK   71 (73)
T ss_pred             ccEEEEEECccc-ccHHHHHHHHhhccCCeEEEEecCCC-CEEEEEEecCHHHHHHHHHhcCCCceEEec
Confidence            578999999999 99999999999999999999999987 8999999999999999999977 4666653

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04098 eEF2_C_snRNP eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00679 EFG_C: Elongation factor G C-terminus; InterPro: IPR000640 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>smart00838 EFG_C Elongation factor G C-terminus Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.4
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 99.4
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 99.18
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 99.11
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 99.03
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.98
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 98.98
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.83
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.75
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 98.73
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.7
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.66
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.64
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.64
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.63
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.61
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 98.61
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.57
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.57
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.52
1yg0_A66 COP associated protein; open-faced beta-sandwich, 98.47
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.46
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.44
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.44
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.43
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.43
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.42
1opz_A76 Potential copper-transporting ATPase; mutation, fo 98.39
2kyz_A67 Heavy metal binding protein; structural genomics, 98.36
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 98.33
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 98.32
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 98.3
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 98.3
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.27
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.27
2kkh_A95 Putative heavy metal transporter; zinc transport, 98.19
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 98.18
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 98.1
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 97.82
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 97.58
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 97.19
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 83.42
2raq_A97 Conserved protein MTH889; alpha-beta protein, stru 80.83
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=99.40  E-value=1.3e-12  Score=78.75  Aligned_cols=66  Identities=12%  Similarity=0.181  Sum_probs=60.7

Q ss_pred             ceEEEEEeCCChHhhHHHHHHHHcCCCCeeEEEecCCCCCcEEEEEEccHHHHHHHHHhccCceEEEec
Q 047835            3 KKILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRRKIGYVETMKL   71 (101)
Q Consensus         3 q~vvlKV~m~C~e~C~~Kv~k~l~~~~GV~sV~id~~~k~kvtV~G~vDp~~l~~~LrKk~~~aeivsv   71 (101)
                      +++.|+|.|+| .+|.+++.++|.+++|| ++.+|... ++++|.|++++..|.+.|++.+-.+.+++.
T Consensus         2 ~~~~~~vgm~C-~~C~~~i~~~l~~~~gV-~v~v~~~~-~~~~v~~~~~~~~i~~~i~~~Gy~~~~~~~   67 (68)
T 3iwl_A            2 PKHEFSVDMTC-GGCAEAVSRVLNKLGGV-KYDIDLPN-KKVCIESEHSMDTLLATLKKTGKTVSYLGL   67 (68)
T ss_dssp             CEEEEEECCCS-HHHHHHHHHHHHHHCSE-EEEEETTT-TEEEEEESSCHHHHHHHHHTTCSCEEEEEC
T ss_pred             ceEEEEECcCc-HHHHHHHHHHHHcCCCe-EEEEEcCC-CEEEEEecCCHHHHHHHHHHcCCceEecCC
Confidence            56788889999 99999999999999999 99999977 899999999999999999986668888875
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.59
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.58
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.55
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.24
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.22
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.13
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 99.12
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 99.11
d1p6ta279 Potential copper-translocating P-type ATPase CopA 99.01
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 99.01
d1p6ta172 Potential copper-translocating P-type ATPase CopA 98.96
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 98.94
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 98.89
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 98.88
d3bpda191 Uncharacterized protein AF1549 {Archaeoglobus fulg 87.57
d1n0ua5117 Elongation factor 2 (eEF-2) {Baker's yeast (Saccha 87.27
d2raqa193 Uncharacterized protein MTH889 {Methanobacterium t 85.9
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: ATX1 metallochaperone protein (ATOX1)
species: Human (Homo sapiens), HAH1 [TaxId: 9606]

Probab=99.59  E-value=2.4e-15  Score=92.33  Aligned_cols=65  Identities=12%  Similarity=0.187  Sum_probs=60.1

Q ss_pred             eEEEEEeCCChHhhHHHHHHHHcCCCCeeEEEecCCCCCcEEEEEEccHHHHHHHHHhccCceEEEec
Q 047835            4 KILYRLDNMHSPKCRTKAFKIIAGFPGLLSVAMKGDDLRHMEVIGDIDEVALANMLRRKIGYVETMKL   71 (101)
Q Consensus         4 ~vvlKV~m~C~e~C~~Kv~k~l~~~~GV~sV~id~~~k~kvtV~G~vDp~~l~~~LrKk~~~aeivsv   71 (101)
                      +..|+|+||| .+|.++|.++|.+++|+ ++.+|..+ ++++|.|++|+..|+++|++.+..|+++.+
T Consensus         2 k~ef~V~M~C-~~C~~~I~~aL~~~~gv-~v~v~~~~-~~v~V~~~~~~~~i~~~I~~~Gy~a~lig~   66 (66)
T d1fe0a_           2 KHEFSVDMTC-GGCAEAVSRVLNKLGGV-KYDIDLPN-KKVCIESEHSMDTLLATLKKTGKTVSYLGL   66 (66)
T ss_dssp             EEEEEECCCS-HHHHHHHHHHHHHHCSE-EEEEETTT-TEEEEEESSCHHHHHHHHHTTTSCEEEEEC
T ss_pred             CEEEEEccCc-hHHHHHHHHHHhcCCCc-EEEEEcCC-CEEEEEeeCCHHHHHHHHHHhCCeEEEeeC
Confidence            4689999999 99999999999999998 69999977 899999999999999999997779999864
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n0ua5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure