Citrus Sinensis ID: 047873


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460----
PHFRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGLVLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLEILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKNLDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLIDGHCKNGRIDMAGDMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAERMLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLCKHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPEDFDKLQSEKGLVSDYACYTSLVSKSSKYRQKR
ccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccccc
cccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHHccccc
PHFRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETrgthlpglvLDALMIVYVDLGFLDDAIQCFRLLRKhyfripargcRCLIDrmmrtnlptvtLGFYLEIldygyspsVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLinghckaknldeGFRLKsvmegsgmrpdvyTYSALINGLCKENRLDDAELLLHEMCergltpndvIFTTLIdghckngridmaGDMKEARKIVDEMctnglnpdkiTYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAERMLREMLKvglkpddatYTMVIDCfckngdtkTGFRLLKEmrsdghlpaVETYNALMNGLCKHGQLKNANMLLDTMldlgvvpdditYNILLeghckhgnpedfdklqsekglvsdyACYTSLVSKsskyrqkr
phfrltlhAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGLVLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLEILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKNLDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLIDGHCKNGRIDMAGDMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAERMLREMLkvglkpddaTYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLCKHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPEDFDKLQSEKGLVSDYAcytslvsksskyrqkr
PHFRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGLVLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLEILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKNLDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLIDGHCKNGRIDMAGDMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAERMLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLCKHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPEDFDKLQSEKGLVSDYACYTSLVSKSSKYRQKR
**FRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGLVLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLEILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKNLDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLIDGHCKNGRIDMAGDMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAERMLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLCKHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPEDFDKL**EKGLVSDYACYTSLV**********
PHFRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGLVLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLEILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKNLDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLIDGHCKNGRIDMAGDMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAERMLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLCKHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPEDFDKLQSEKGLVSDYACYTSLVSKSSKYRQK*
PHFRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGLVLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLEILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKNLDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLIDGHCKNGRIDMAGDMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAERMLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLCKHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPEDFDKLQSEKGLVSDYACYTSLV**********
PHFRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGLVLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLEILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKNLDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLIDGHCKNGRIDMAGDMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAERMLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLCKHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPEDFDKLQSEKGLVSDYACYTSLVSKSSKYR***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PHFRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGLVLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLEILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKNLDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLIDGHCKNGRIDMAGDMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAERMLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLCKHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPEDFDKLQSEKGLVSDYACYTSLVSKSSKYRQKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query464 2.2.26 [Sep-21-2011]
O04491607 Putative pentatricopeptid yes no 0.982 0.751 0.575 1e-163
Q9FIX3 747 Pentatricopeptide repeat- no no 1.0 0.621 0.304 3e-65
Q0WVK7 741 Pentatricopeptide repeat- no no 0.922 0.577 0.297 1e-63
P0C894 761 Putative pentatricopeptid no no 0.974 0.593 0.310 1e-62
Q9T0D6566 Pentatricopeptide repeat- no no 0.943 0.773 0.310 2e-62
Q9LFC5729 Pentatricopeptide repeat- no no 0.971 0.618 0.276 6e-59
Q9CAN5614 Pentatricopeptide repeat- no no 0.913 0.690 0.319 2e-56
Q9LQ16632 Pentatricopeptide repeat- no no 0.797 0.585 0.334 7e-56
Q9CA58 763 Putative pentatricopeptid no no 0.849 0.516 0.315 4e-55
O04504606 Pentatricopeptide repeat- no no 0.965 0.739 0.281 8e-55
>sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 Back     alignment and function desciption
 Score =  574 bits (1480), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 279/485 (57%), Positives = 346/485 (71%), Gaps = 29/485 (5%)

Query: 1   PHFRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGL 60
           P FR T+  Y  +  FL  H+M ++A+ L+ L+VS+KG  S++S+F S++E R T + G 
Sbjct: 112 PGFRFTVETYFVLARFLAVHEMFTEAQSLIELVVSRKGKNSASSVFISLVEMRVTPMCGF 171

Query: 61  VLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLEI 120
           ++DALMI Y DLGF+ DAIQCFRL RKH F +P RGC  L+DRMM+ N      GFY+EI
Sbjct: 172 LVDALMITYTDLGFIPDAIQCFRLSRKHRFDVPIRGCGNLLDRMMKLNPTGTIWGFYMEI 231

Query: 121 LDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKNL 180
           LD G+  +VYVFN+LM+K CKEG I DAQ VFDE  KR L  T VSFNTLING+CK  NL
Sbjct: 232 LDAGFPLNVYVFNILMNKFCKEGNISDAQKVFDEITKRSLQPTVVSFNTLINGYCKVGNL 291

Query: 181 DEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTL 240
           DEGFRLK  ME S  RPDV+TYSALIN LCKEN++D A  L  EMC+RGL PNDVIFTTL
Sbjct: 292 DEGFRLKHQMEKSRTRPDVFTYSALINALCKENKMDGAHGLFDEMCKRGLIPNDVIFTTL 351

Query: 241 IDGHCKNGRIDMA-----------------------------GDMKEARKIVDEMCTNGL 271
           I GH +NG ID+                              GD+  AR IVD M   GL
Sbjct: 352 IHGHSRNGEIDLMKESYQKMLSKGLQPDIVLYNTLVNGFCKNGDLVAARNIVDGMIRRGL 411

Query: 272 NPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAER 331
            PDKITYT L+DGFC+ GD+E+AL+IRKEM + GIELD V F+AL+ G C+ G+V++AER
Sbjct: 412 RPDKITYTTLIDGFCRGGDVETALEIRKEMDQNGIELDRVGFSALVCGMCKEGRVIDAER 471

Query: 332 MLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLC 391
            LREML+ G+KPDD TYTM++D FCK GD +TGF+LLKEM+SDGH+P+V TYN L+NGLC
Sbjct: 472 ALREMLRAGIKPDDVTYTMMMDAFCKKGDAQTGFKLLKEMQSDGHVPSVVTYNVLLNGLC 531

Query: 392 KHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPEDFDKLQSEKGLVSDYACYT 451
           K GQ+KNA+MLLD ML++GVVPDDITYN LLEGH +H N       + E G+V+D A Y 
Sbjct: 532 KLGQMKNADMLLDAMLNIGVVPDDITYNTLLEGHHRHANSSKRYIQKPEIGIVADLASYK 591

Query: 452 SLVSK 456
           S+V++
Sbjct: 592 SIVNE 596





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function description
>sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 Back     alignment and function description
>sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 Back     alignment and function description
>sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query464
224069254 599 predicted protein [Populus trichocarpa] 1.0 0.774 0.629 0.0
225451367 592 PREDICTED: putative pentatricopeptide re 0.997 0.782 0.634 1e-180
449446121 590 PREDICTED: putative pentatricopeptide re 1.0 0.786 0.582 1e-165
449522636 590 PREDICTED: putative pentatricopeptide re 1.0 0.786 0.578 1e-163
147861320559 hypothetical protein VITISV_031191 [Viti 0.909 0.754 0.625 1e-162
356499079 615 PREDICTED: putative pentatricopeptide re 0.989 0.746 0.577 1e-162
15218241 607 pentatricopeptide repeat-containing prot 0.982 0.751 0.575 1e-161
297849270 607 pentatricopeptide repeat-containing prot 0.982 0.751 0.577 1e-161
357491947 811 Pentatricopeptide repeat-containing prot 0.989 0.565 0.569 1e-154
356552005509 PREDICTED: LOW QUALITY PROTEIN: putative 0.801 0.730 0.580 1e-132
>gi|224069254|ref|XP_002302938.1| predicted protein [Populus trichocarpa] gi|222844664|gb|EEE82211.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/496 (62%), Positives = 376/496 (75%), Gaps = 32/496 (6%)

Query: 1   PHFRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGL 60
           P F  T+ +Y +MVHFL+AH+M+ QA  LLH +VS+KG GS++S+FASILET+GT     
Sbjct: 104 PTFSHTVQSYCSMVHFLIAHRMNQQAESLLHFVVSRKGKGSASSVFASILETKGTLSSSF 163

Query: 61  VLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLEI 120
           V DALM VY + G++ DAIQCFRL +KH  +IP  GC+CL++RM++ + P V L FYLEI
Sbjct: 164 VFDALMSVYTEFGYVSDAIQCFRLTKKHNLKIPFNGCKCLLERMIKMSSPMVALEFYLEI 223

Query: 121 LDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKNL 180
           LD GY P+VY FNVLM++LCKEGK+KDAQ++FDE  K GL  TAVSFNTLING+CK+ NL
Sbjct: 224 LDSGYPPNVYTFNVLMNRLCKEGKVKDAQLIFDEIRKTGLQPTAVSFNTLINGYCKSGNL 283

Query: 181 DEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTL 240
           +EGFRLK VME   + PDV+TYSALI+GLCKE +L+DA  L  EMC+RGL PNDV FTTL
Sbjct: 284 EEGFRLKMVMEEFRVFPDVFTYSALIDGLCKECQLEDANHLFKEMCDRGLVPNDVTFTTL 343

Query: 241 IDGHCKNGRIDMA-----------------------------GDMKEARKIVDEMCTNGL 271
           I+G CKNGR+D+A                             G  +EARK V EM   GL
Sbjct: 344 INGQCKNGRVDLALEIYQQMFTKGLKADLVLYNTLIDGLCKGGYFREARKFVGEMTKRGL 403

Query: 272 NPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAER 331
            PDK TYT LLDG CKEGDLE AL++RKEM+K GI+LDNVAFTA+ISG CR GK+V+AER
Sbjct: 404 IPDKFTYTTLLDGSCKEGDLELALEMRKEMVKEGIQLDNVAFTAIISGLCRDGKIVDAER 463

Query: 332 MLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLC 391
            LREML+ GLKPDD TYTMV+D FCK GD K GF+LLKEM+SDGH+P V TYN LMNGLC
Sbjct: 464 TLREMLRAGLKPDDGTYTMVMDGFCKKGDVKMGFKLLKEMQSDGHIPGVITYNVLMNGLC 523

Query: 392 KHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPEDFDKLQSEKGLVSDYACYT 451
           K GQ+KNA+MLL+ ML+LGVVPDDITYNILL+GHCKHG   DF  +++E GLVSDYA Y 
Sbjct: 524 KQGQVKNADMLLNAMLNLGVVPDDITYNILLQGHCKHGKLGDFQNVKTEMGLVSDYASYR 583

Query: 452 SL---VSKSSKYRQKR 464
           SL   +SK+SK RQKR
Sbjct: 584 SLLHELSKASKDRQKR 599




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225451367|ref|XP_002263590.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g09680 [Vitis vinifera] gi|296087085|emb|CBI33459.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449446121|ref|XP_004140820.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g09680-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449522636|ref|XP_004168332.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g09680-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147861320|emb|CAN83994.1| hypothetical protein VITISV_031191 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356499079|ref|XP_003518371.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g09680-like [Glycine max] Back     alignment and taxonomy information
>gi|15218241|ref|NP_172439.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75097039|sp|O04491.1|PPR26_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At1g09680 gi|2160161|gb|AAB60724.1| F21M12.7 gene product [Arabidopsis thaliana] gi|332190358|gb|AEE28479.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297849270|ref|XP_002892516.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338358|gb|EFH68775.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357491947|ref|XP_003616261.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355517596|gb|AES99219.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356552005|ref|XP_003544362.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g09680-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query464
TAIR|locus:2024367607 AT1G09680 "AT1G09680" [Arabido 0.963 0.736 0.504 1.9e-113
TAIR|locus:2164910 747 EMB2745 "EMBRYO DEFECTIVE 2745 0.965 0.599 0.311 1.3e-59
TAIR|locus:2139732566 AT4G11690 [Arabidopsis thalian 0.734 0.602 0.357 2.7e-59
TAIR|locus:2150024 729 AT5G01110 [Arabidopsis thalian 0.911 0.580 0.308 8.9e-54
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.702 0.518 0.349 9.9e-54
TAIR|locus:2019085 763 AT1G74580 "AT1G74580" [Arabido 0.728 0.442 0.348 3.8e-53
TAIR|locus:2024301606 AT1G09820 "AT1G09820" [Arabido 0.946 0.724 0.285 3.8e-53
TAIR|locus:2015228614 AT1G63080 [Arabidopsis thalian 0.754 0.570 0.339 4.9e-53
TAIR|locus:2053552627 AT2G15630 "AT2G15630" [Arabido 0.853 0.631 0.326 4.9e-53
TAIR|locus:2173403730 AT5G64320 "AT5G64320" [Arabido 0.765 0.486 0.331 5.4e-53
TAIR|locus:2024367 AT1G09680 "AT1G09680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1119 (399.0 bits), Expect = 1.9e-113, P = 1.9e-113
 Identities = 231/458 (50%), Positives = 298/458 (65%)

Query:     1 PHFRLTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGL 60
             P FR T+  Y  +  FL  H+M ++A+ L+ L+VS+KG  S++S+F S++E R T + G 
Sbjct:   112 PGFRFTVETYFVLARFLAVHEMFTEAQSLIELVVSRKGKNSASSVFISLVEMRVTPMCGF 171

Query:    61 VLDALMIVYVDLGFLDDAIQCFRLLRKHYFRIPARGCRCLIDRMMRTNLPTVTL-GFYLE 119
             ++DALMI Y DLGF+ DAIQCFRL RKH F +P RGC  L+DRMM+ N PT T+ GFY+E
Sbjct:   172 LVDALMITYTDLGFIPDAIQCFRLSRKHRFDVPIRGCGNLLDRMMKLN-PTGTIWGFYME 230

Query:   120 ILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKN 179
             ILD G+  +VYVFN+LM+K CKEG I DAQ VFDE  KR L  T VSFNTLING+CK  N
Sbjct:   231 ILDAGFPLNVYVFNILMNKFCKEGNISDAQKVFDEITKRSLQPTVVSFNTLINGYCKVGN 290

Query:   180 LDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTT 239
             LDEGFRLK  ME S  RPDV+TYSALIN LCKEN++D A  L  EMC+RGL PNDVIFTT
Sbjct:   291 LDEGFRLKHQMEKSRTRPDVFTYSALINALCKENKMDGAHGLFDEMCKRGLIPNDVIFTT 350

Query:   240 LIDGHCKNGRIDMAGDMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRK 299
             LI GH +NG ID+   MKE+ +   +M + GL PD + Y  L++GFCK GDL +A +I  
Sbjct:   351 LIHGHSRNGEIDL---MKESYQ---KMLSKGLQPDIVLYNTLVNGFCKNGDLVAARNIVD 404

Query:   300 EMIKRGIELDNVAFTALISGFCRGGKVVEAERMLREMLKVGLKPDDATYTMVIDCFCKNG 359
              MI+RG+  D + +T LI GFCRGG V  A  + +EM + G++ D   ++ ++   CK G
Sbjct:   405 GMIRRGLRPDKITYTTLIDGFCRGGDVETALEIRKEMDQNGIELDRVGFSALVCGMCKEG 464

Query:   360 DTKTGFRLLKEMRSDGHLPAVETYNALMNGLCKHGQLKNANMLLDTMLDLGVVPDDITYN 419
                   R L+EM   G  P   TY  +M+  CK G  +    LL  M   G VP  +TYN
Sbjct:   465 RVIDAERALREMLRAGIKPDDVTYTMMMDAFCKKGDAQTGFKLLKEMQSDGHVPSVVTYN 524

Query:   420 ILLEGHCKHGNPEDFDKLQSEK---GLVSDYACYTSLV 454
             +LL G CK G  ++ D L       G+V D   Y +L+
Sbjct:   525 VLLNGLCKLGQMKNADMLLDAMLNIGVVPDDITYNTLL 562


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139732 AT4G11690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150024 AT5G01110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019085 AT1G74580 "AT1G74580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024301 AT1G09820 "AT1G09820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015228 AT1G63080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053552 AT2G15630 "AT2G15630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173403 AT5G64320 "AT5G64320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O04491PPR26_ARATHNo assigned EC number0.57520.98270.7512yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-35
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-21
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-14
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-14
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-13
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-12
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-11
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-10
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-10
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-08
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 5e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 9e-07
pfam0153531 pfam01535, PPR, PPR repeat 1e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-06
pfam0153531 pfam01535, PPR, PPR repeat 6e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-05
pfam0153531 pfam01535, PPR, PPR repeat 3e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-05
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 4e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.003
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  137 bits (347), Expect = 9e-35
 Identities = 89/327 (27%), Positives = 150/327 (45%), Gaps = 31/327 (9%)

Query: 127 PSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGHCKAKNLDEGFRL 186
           P++  FN+LM        I  A  V     + GL A    + TLI+   K+  +D  F +
Sbjct: 435 PTLSTFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEV 494

Query: 187 KSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLIDGHCK 246
              M  +G+  +V+T+ ALI+G  +  ++  A      M  + + P+ V+F  LI    +
Sbjct: 495 FHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQ 554

Query: 247 NGRIDMA----GDMKEARKIVD----------EMCTNGLNPDKI---------------- 276
           +G +D A     +MK     +D          + C N    D+                 
Sbjct: 555 SGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTP 614

Query: 277 -TYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAERMLRE 335
             YTI ++   ++GD + AL I  +M K+G++ D V F+AL+      G + +A  +L++
Sbjct: 615 EVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQD 674

Query: 336 MLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLCKHGQ 395
             K G+K    +Y+ ++       + K    L ++++S    P V T NAL+  LC+  Q
Sbjct: 675 ARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQ 734

Query: 396 LKNANMLLDTMLDLGVVPDDITYNILL 422
           L  A  +L  M  LG+ P+ ITY+ILL
Sbjct: 735 LPKALEVLSEMKRLGLCPNTITYSILL 761


Length = 1060

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 464
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.95
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.94
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.94
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.93
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.93
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.92
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.92
PRK14574 822 hmsH outer membrane protein; Provisional 99.9
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.9
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.9
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.89
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.85
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.82
KOG2003 840 consensus TPR repeat-containing protein [General f 99.8
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.8
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.79
KOG2076 895 consensus RNA polymerase III transcription factor 99.79
KOG2003840 consensus TPR repeat-containing protein [General f 99.78
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.77
KOG2076 895 consensus RNA polymerase III transcription factor 99.75
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.73
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.72
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.72
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.71
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.7
KOG0547606 consensus Translocase of outer mitochondrial membr 99.7
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.7
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.7
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.69
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.68
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.66
KOG1126638 consensus DNA-binding cell division cycle control 99.66
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.65
KOG1915677 consensus Cell cycle control protein (crooked neck 99.64
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.64
KOG1126638 consensus DNA-binding cell division cycle control 99.64
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.63
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.61
PRK12370553 invasion protein regulator; Provisional 99.58
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.57
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.55
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.52
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.52
KOG0547606 consensus Translocase of outer mitochondrial membr 99.49
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.47
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.47
PRK12370553 invasion protein regulator; Provisional 99.46
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.46
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.44
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.44
KOG1129478 consensus TPR repeat-containing protein [General f 99.43
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.43
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.43
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.43
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.42
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.41
KOG1129478 consensus TPR repeat-containing protein [General f 99.4
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.4
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.4
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.39
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.37
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.35
PRK11189296 lipoprotein NlpI; Provisional 99.35
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.35
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.34
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.33
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.33
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.33
PF1304150 PPR_2: PPR repeat family 99.31
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.31
PRK11189296 lipoprotein NlpI; Provisional 99.29
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.28
PF1304150 PPR_2: PPR repeat family 99.26
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.26
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.25
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.15
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.14
PRK04841903 transcriptional regulator MalT; Provisional 99.12
PLN02789320 farnesyltranstransferase 99.08
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.07
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.07
PRK04841 903 transcriptional regulator MalT; Provisional 99.06
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.05
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.04
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.03
KOG1125579 consensus TPR repeat-containing protein [General f 99.02
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.02
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.0
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.97
KOG1125579 consensus TPR repeat-containing protein [General f 98.96
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.92
PLN02789320 farnesyltranstransferase 98.91
PRK10370198 formate-dependent nitrite reductase complex subuni 98.9
PRK15359144 type III secretion system chaperone protein SscB; 98.89
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.87
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.87
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.86
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.86
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.86
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.85
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.84
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.83
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.81
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.79
PRK15359144 type III secretion system chaperone protein SscB; 98.78
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.76
KOG1128777 consensus Uncharacterized conserved protein, conta 98.76
KOG1128777 consensus Uncharacterized conserved protein, conta 98.74
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.72
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.71
PRK10370198 formate-dependent nitrite reductase complex subuni 98.69
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.66
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.65
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.64
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.64
PF1285434 PPR_1: PPR repeat 98.62
PF1285434 PPR_1: PPR repeat 98.62
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.61
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.59
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.5
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.45
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.41
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.39
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.35
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.34
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.32
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.32
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.27
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.27
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.26
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.25
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.24
KOG0553304 consensus TPR repeat-containing protein [General f 98.23
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.21
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.19
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.15
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.11
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.11
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.1
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.09
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.08
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.07
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.07
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.06
PF12688120 TPR_5: Tetratrico peptide repeat 98.06
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.05
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.04
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.01
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.01
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.01
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.01
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.01
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.0
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.97
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.97
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.97
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.97
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.94
KOG0553304 consensus TPR repeat-containing protein [General f 97.93
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.91
COG4700251 Uncharacterized protein conserved in bacteria cont 97.91
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.91
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.9
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.88
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.88
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.86
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.84
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.84
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.83
COG4700251 Uncharacterized protein conserved in bacteria cont 97.82
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.81
KOG20411189 consensus WD40 repeat protein [General function pr 97.77
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.76
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.75
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.74
PRK10803263 tol-pal system protein YbgF; Provisional 97.74
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.73
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.7
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.69
PF12688120 TPR_5: Tetratrico peptide repeat 97.68
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.67
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.64
PRK15331165 chaperone protein SicA; Provisional 97.63
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.62
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.61
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.6
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.6
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.56
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.55
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.52
PF1337173 TPR_9: Tetratricopeptide repeat 97.47
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.46
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.45
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.44
PRK10803263 tol-pal system protein YbgF; Provisional 97.36
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.33
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.3
PF1337173 TPR_9: Tetratricopeptide repeat 97.26
COG3898531 Uncharacterized membrane-bound protein [Function u 97.16
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.11
PRK15331165 chaperone protein SicA; Provisional 97.05
KOG1585308 consensus Protein required for fusion of vesicles 96.98
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.98
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.97
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.96
KOG20411189 consensus WD40 repeat protein [General function pr 96.96
PRK11906458 transcriptional regulator; Provisional 96.95
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.92
PF1342844 TPR_14: Tetratricopeptide repeat 96.83
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.83
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.8
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.8
PF13512142 TPR_18: Tetratricopeptide repeat 96.77
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.72
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.71
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.67
PF13512142 TPR_18: Tetratricopeptide repeat 96.67
KOG4555175 consensus TPR repeat-containing protein [Function 96.66
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.65
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.63
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.61
KOG1585308 consensus Protein required for fusion of vesicles 96.56
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.54
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.49
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.45
COG3898531 Uncharacterized membrane-bound protein [Function u 96.43
KOG2610491 consensus Uncharacterized conserved protein [Funct 96.36
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.3
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.3
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.27
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.17
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.17
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.17
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.16
PF1342844 TPR_14: Tetratricopeptide repeat 96.1
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.09
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 96.07
KOG1258577 consensus mRNA processing protein [RNA processing 96.04
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.03
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.02
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.01
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.98
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.97
KOG4555175 consensus TPR repeat-containing protein [Function 95.87
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.83
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 95.81
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.79
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.76
KOG4234271 consensus TPR repeat-containing protein [General f 95.67
smart00299140 CLH Clathrin heavy chain repeat homology. 95.63
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.62
PRK11906458 transcriptional regulator; Provisional 95.57
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.56
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.55
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.55
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.34
smart00299140 CLH Clathrin heavy chain repeat homology. 95.32
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.3
PF1343134 TPR_17: Tetratricopeptide repeat 95.25
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.2
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.14
KOG1258577 consensus mRNA processing protein [RNA processing 95.06
KOG3941406 consensus Intermediate in Toll signal transduction 95.04
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.84
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.77
KOG1941518 consensus Acetylcholine receptor-associated protei 94.74
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.63
COG3629280 DnrI DNA-binding transcriptional activator of the 94.61
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.51
PF1343134 TPR_17: Tetratricopeptide repeat 94.35
KOG3941 406 consensus Intermediate in Toll signal transduction 94.33
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 94.33
COG3629280 DnrI DNA-binding transcriptional activator of the 94.1
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.99
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 93.94
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.9
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 93.77
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.68
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 93.65
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 92.89
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 92.72
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 92.66
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.35
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.14
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.02
PRK11619 644 lytic murein transglycosylase; Provisional 91.85
PF06552186 TOM20_plant: Plant specific mitochondrial import r 91.77
KOG4234271 consensus TPR repeat-containing protein [General f 91.72
KOG4648536 consensus Uncharacterized conserved protein, conta 91.68
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 91.16
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.16
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.15
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 91.06
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 90.84
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.74
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.71
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 90.57
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 90.41
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 90.4
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 90.28
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.28
PRK09687280 putative lyase; Provisional 90.17
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.99
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 89.85
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 89.77
KOG2034 911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 89.74
KOG1550552 consensus Extracellular protein SEL-1 and related 89.69
KOG4648536 consensus Uncharacterized conserved protein, conta 89.64
KOG1550552 consensus Extracellular protein SEL-1 and related 89.56
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 89.52
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.52
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 89.41
COG0457291 NrfG FOG: TPR repeat [General function prediction 89.28
KOG2471 696 consensus TPR repeat-containing protein [General f 89.26
COG4455273 ImpE Protein of avirulence locus involved in tempe 89.21
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.04
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 88.77
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 88.66
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 88.49
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.35
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 88.13
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 87.99
KOG4570 418 consensus Uncharacterized conserved protein [Funct 87.66
KOG4570418 consensus Uncharacterized conserved protein [Funct 87.63
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 87.62
COG3947361 Response regulator containing CheY-like receiver a 87.16
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 87.08
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 86.96
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 86.84
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 86.84
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 86.71
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 85.87
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 85.83
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 85.36
COG4455273 ImpE Protein of avirulence locus involved in tempe 85.31
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 85.18
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 84.94
PRK09687280 putative lyase; Provisional 84.31
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 84.3
COG5159421 RPN6 26S proteasome regulatory complex component [ 84.1
KOG45211480 consensus Nuclear pore complex, Nup160 component [ 83.99
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.93
PF13929292 mRNA_stabil: mRNA stabilisation 83.72
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 83.55
PF06552186 TOM20_plant: Plant specific mitochondrial import r 83.47
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.31
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 82.98
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 82.84
KOG4507886 consensus Uncharacterized conserved protein, conta 82.81
PRK12798421 chemotaxis protein; Reviewed 82.31
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 82.31
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 82.0
PRK10941269 hypothetical protein; Provisional 81.83
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 81.71
COG1747 711 Uncharacterized N-terminal domain of the transcrip 80.07
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 80.04
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.2e-64  Score=488.14  Aligned_cols=433  Identities=18%  Similarity=0.298  Sum_probs=377.6

Q ss_pred             CCHHHHHHHHHHHHhCCChHHHHHHHHHHHHhcCCCChHHHHHHHHHhcCCCCChhhHHHHHHHHHhcCChhHHHHHHHH
Q 047873            5 LTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPGLVLDALMIVYVDLGFLDDAIQCFRL   84 (464)
Q Consensus         5 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~   84 (464)
                      |+..+|+.++.+|.+.|++++|.++|+.|.+.                 |..||..+|+.++.+|.+.|++++|.++|++
T Consensus       435 pd~~Tyn~LL~a~~k~g~~e~A~~lf~~M~~~-----------------Gl~pD~~tynsLI~~y~k~G~vd~A~~vf~e  497 (1060)
T PLN03218        435 PTLSTFNMLMSVCASSQDIDGALRVLRLVQEA-----------------GLKADCKLYTTLISTCAKSGKVDAMFEVFHE  497 (1060)
T ss_pred             CCHHHHHHHHHHHHhCcCHHHHHHHHHHHHHc-----------------CCCCCHHHHHHHHHHHHhCcCHHHHHHHHHH
Confidence            56777777777777777777777777777644                 7788889999999999999999999999999


Q ss_pred             HHhCCCCCChhcHHHHHHHHHcCCChhhHHHHHHHHHhcCCCCChhhHHHHHHHHHhcCChhhHHHHHHHHhh--CCCCC
Q 047873           85 LRKHYFRIPARGCRCLIDRMMRTNLPTVTLGFYLEILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGK--RGLHA  162 (464)
Q Consensus        85 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~--~~~~~  162 (464)
                      |.+.|+.|+..+|+.++.+|++.|++++|.++|++|.+.|..||..+|+.++.+|++.|++++|.++|++|..  .++.|
T Consensus       498 M~~~Gv~PdvvTynaLI~gy~k~G~~eeAl~lf~~M~~~Gv~PD~vTYnsLI~a~~k~G~~deA~~lf~eM~~~~~gi~P  577 (1060)
T PLN03218        498 MVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMKAETHPIDP  577 (1060)
T ss_pred             HHHcCCCCCHHHHHHHHHHHHHCcCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhcCCCCC
Confidence            9988888899999999999999999999999999999889999999999999999999999999999999976  57788


Q ss_pred             CcccHHHHHHHHHhcCChhHHHHHHHHHhhCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHH
Q 047873          163 TAVSFNTLINGHCKAKNLDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLID  242 (464)
Q Consensus       163 ~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~  242 (464)
                      |..+|+.++.+|++.|++++|.++|+.|.+.|+.|+..+|+.++.+|++.|++++|.++|++|.+.|+.||..+|+.++.
T Consensus       578 D~vTynaLI~ay~k~G~ldeA~elf~~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~  657 (1060)
T PLN03218        578 DHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVD  657 (1060)
T ss_pred             cHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999989889999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCcccccCHHHHHHHHHHHHhCCCCCCHHhHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhc
Q 047873          243 GHCKNGRIDMAGDMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCR  322 (464)
Q Consensus       243 ~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~  322 (464)
                      +|++.|+.      ++|.++++.|.+.|..|+..+|+.+|.+|++.|++++|.++|++|.+.|+.||..+|+.++.+|++
T Consensus       658 a~~k~G~~------eeA~~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k  731 (1060)
T PLN03218        658 VAGHAGDL------DKAFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCE  731 (1060)
T ss_pred             HHHhCCCH------HHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHH
Confidence            99988876      589999999999999999999999999999999999999999999888889999999999999999


Q ss_pred             cCChHHHHHHHHHHHHCCCCCCHhhHHHHHHHHHhcCChHHHHHHHHHHHhCCCCcCHHHHHHHHHHHHh----c-----
Q 047873          323 GGKVVEAERMLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLCK----H-----  393 (464)
Q Consensus       323 ~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~----~-----  393 (464)
                      .|++++|.++|++|...|+.||..+|+.++.+|++.|++++|.++|.+|.+.|+.||..+|+.++..|.+    +     
T Consensus       732 ~G~~eeAlelf~eM~~~Gi~Pd~~Ty~sLL~a~~k~G~le~A~~l~~~M~k~Gi~pd~~tynsLIglc~~~y~ka~~l~~  811 (1060)
T PLN03218        732 GNQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMCRCITGLCLRRFEKACALGE  811 (1060)
T ss_pred             CCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHhhhhh
Confidence            9999999999999998899999999999999999999999999999999998999999999988865432    1     


Q ss_pred             --------------CCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHhcCC---CCchhHHHHhhcc
Q 047873          394 --------------GQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGNPEDFDKLQSEKGL---VSDYACYTSLVSK  456 (464)
Q Consensus       394 --------------g~~~~a~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~---~p~~~~~~~ll~~  456 (464)
                                    +..++|..+|++|++.|+.||..||+.++.+++..+..+.+..+++++++   .|+..+|++||.+
T Consensus       812 ~v~~f~~g~~~~~n~w~~~Al~lf~eM~~~Gi~Pd~~T~~~vL~cl~~~~~~~~~~~m~~~m~~~~~~~~~~~y~~Li~g  891 (1060)
T PLN03218        812 PVVSFDSGRPQIENKWTSWALMVYRETISAGTLPTMEVLSQVLGCLQLPHDATLRNRLIENLGISADSQKQSNLSTLVDG  891 (1060)
T ss_pred             hhhhhhccccccccchHHHHHHHHHHHHHCCCCCCHHHHHHHHHHhcccccHHHHHHHHHHhccCCCCcchhhhHHHHHh
Confidence                          12367888999999999999999999999777788888888888887654   4457889999998


Q ss_pred             chhh
Q 047873          457 SSKY  460 (464)
Q Consensus       457 ~~~~  460 (464)
                      ++++
T Consensus       892 ~~~~  895 (1060)
T PLN03218        892 FGEY  895 (1060)
T ss_pred             hccC
Confidence            8765



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4521 consensus Nuclear pore complex, Nup160 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
4g24_A 501 Crystal Structure Of Proteinaceous Rnase P 1 (Prorp 8e-04
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From A. Thaliana With Mn Length = 501 Back     alignment and structure

Iteration: 1

Score = 42.0 bits (97), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 30/133 (22%), Positives = 56/133 (42%), Gaps = 21/133 (15%) Query: 282 LDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALI---------------SGFCRGGKV 326 LD K+GD+ AL + E + G++L + L+ G RG + Sbjct: 33 LDMCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDI 92 Query: 327 VEAERMLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNAL 386 ++M+ + P++AT+T D + F ++K+M++ G P + +Y Sbjct: 93 ------FKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPA 146 Query: 387 MNGLCKHGQLKNA 399 + G C+ G A Sbjct: 147 LFGFCRKGDADKA 159

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-20
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 94.1 bits (232), Expect = 1e-20
 Identities = 32/188 (17%), Positives = 61/188 (32%), Gaps = 4/188 (2%)

Query: 255 DMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESA---LDIRKEMIKRGIELDNV 311
            +   +    +     L+  +               L  A   L +     ++   L   
Sbjct: 107 SLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLD 166

Query: 312 AFTALISGFCRGGKVVEAERMLREMLKVGLKPDDATYTMVIDCFCKNG-DTKTGFRLLKE 370
            + A++ G+ R G   E   +L  +   GL PD  +Y   + C  +   D  T  R L++
Sbjct: 167 MYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQ 226

Query: 371 MRSDGHLPAVETYNALMNGLCKHGQLKNANMLLDTMLDLGVVPDDITYNILLEGHCKHGN 430
           M  +G          L++   +   LK  + +  T      +P  +  + LL        
Sbjct: 227 MSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDG 286

Query: 431 PEDFDKLQ 438
              + KL 
Sbjct: 287 RVSYPKLH 294


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query464
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.98
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.96
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.95
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.92
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.91
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.9
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.9
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.89
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.88
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.88
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.86
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.86
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.85
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.85
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.85
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.83
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.83
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.81
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.81
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.8
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.8
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.78
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.78
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.77
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.75
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.74
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.73
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.72
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.72
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.72
3u4t_A272 TPR repeat-containing protein; structural genomics 99.71
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.71
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.7
3u4t_A272 TPR repeat-containing protein; structural genomics 99.7
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.7
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.7
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.69
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.69
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.67
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.67
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.65
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.64
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.64
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.64
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.63
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.61
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.6
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.59
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.58
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.58
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.58
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.57
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.56
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.56
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.56
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.54
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.54
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.53
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.53
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.53
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.51
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.5
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.48
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.48
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.45
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.44
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.4
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.4
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.39
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.38
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.38
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.37
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.34
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.33
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.33
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.32
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.32
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.26
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.26
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.25
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.25
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.25
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.23
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.22
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.21
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.21
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.21
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.2
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.19
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.19
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.17
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.17
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.17
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.16
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.15
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.14
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.14
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.11
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.11
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.1
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.08
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.03
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.02
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.01
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.01
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.0
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.99
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.98
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.97
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.96
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.96
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.94
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.94
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.93
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.92
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.91
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.91
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.9
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.88
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.88
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.85
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.85
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.84
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.84
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.84
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.84
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.83
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.83
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.81
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.81
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.81
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.8
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.8
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.79
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.79
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.79
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.77
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.77
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.73
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.72
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.71
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.7
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.69
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.68
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.68
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.68
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.67
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.66
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.63
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.62
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.61
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.61
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.6
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.6
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.59
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.58
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.58
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.57
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.55
3k9i_A117 BH0479 protein; putative protein binding protein, 98.53
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.52
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.52
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.51
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.5
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.49
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.49
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.47
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.45
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.44
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.34
3k9i_A117 BH0479 protein; putative protein binding protein, 98.33
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.32
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.31
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.27
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.27
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.26
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.23
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.19
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.18
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.18
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.14
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.12
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.08
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.04
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.02
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.01
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.01
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.96
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.89
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.88
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.86
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.81
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.64
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.6
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.54
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.51
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.44
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.44
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.42
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.38
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.27
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.2
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.1
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.04
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.95
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.81
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.8
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.78
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.63
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.53
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.49
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.46
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.35
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.28
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.26
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.17
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.93
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.3
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.17
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.08
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.63
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.15
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 93.76
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.65
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.64
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.23
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 93.15
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 93.07
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.06
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.96
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.83
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 92.73
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.81
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.71
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.37
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 90.86
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 90.43
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 90.42
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 89.99
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 89.56
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 88.24
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 87.81
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 86.31
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 86.17
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 85.84
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 84.86
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 84.46
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 84.25
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 82.48
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3.6e-39  Score=311.39  Aligned_cols=424  Identities=11%  Similarity=0.017  Sum_probs=265.7

Q ss_pred             CCHHHHHHHHHHHHhCCChHHHHHHHHHHHHhcCCC-----------------ChHHHHHHHHHhcCCCCChhhHHHHHH
Q 047873            5 LTLHAYSTMVHFLVAHKMHSQARDLLHLIVSKKGMG-----------------SSASLFASILETRGTHLPGLVLDALMI   67 (464)
Q Consensus         5 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~-----------------~~~~~~~~~~~~~~~~~~~~~~~~l~~   67 (464)
                      +++..|+.++..|.+.|++++|+.+|++++......                 .+...+..+   ...+++..+++.++.
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~---~~~~~~~~~~~~l~~  158 (597)
T 2xpi_A           82 SREDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTKE---DLYNRSSACRYLAAF  158 (597)
T ss_dssp             CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHTTCHHHHHHHHHHT---CGGGTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHccCchHHHHHHHHHHhhCCCchHHHHHHHHHHHcCcHHHHHHHHHHH---hccccchhHHHHHHH
Confidence            578899999999999999999999999998432110                 011111111   112334455555555


Q ss_pred             HHHhcCChhHHHHHHHHHHhC---------------CCCCChhcHHHHHHHHHcCCChhhHHHHHHHHHhcCCCCChhhH
Q 047873           68 VYVDLGFLDDAIQCFRLLRKH---------------YFRIPARGCRCLIDRMMRTNLPTVTLGFYLEILDYGYSPSVYVF  132 (464)
Q Consensus        68 ~~~~~g~~~~A~~~~~~~~~~---------------~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~  132 (464)
                      +|.+.|++++|+++|+++...               +.+.+..+|..++.++.+.|++++|.+.|+++.+.++. +...+
T Consensus       159 ~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~-~~~~~  237 (597)
T 2xpi_A          159 CLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAK-CYEAF  237 (597)
T ss_dssp             HHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CHHHH
T ss_pred             HHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCch-hhHHH
Confidence            555555555555555532111               11122445555555555556666666555555554432 33333


Q ss_pred             HHH--------------------------------------HHHHHhcCChhhHHHHHHHHhhCCCCCCcccHHHHHHHH
Q 047873          133 NVL--------------------------------------MHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLINGH  174 (464)
Q Consensus       133 ~~l--------------------------------------~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~  174 (464)
                      ..+                                      +..|.+.|++++|.++|+++.+.  +++..+++.++..|
T Consensus       238 ~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~  315 (597)
T 2xpi_A          238 DQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKADTL  315 (597)
T ss_dssp             HHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHHHHH
T ss_pred             HHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHHHHH
Confidence            222                                      22233445555555555555443  35666666777777


Q ss_pred             HhcCChhHHHHHHHHHhhCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCccccc
Q 047873          175 CKAKNLDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLIDGHCKNGRIDMAG  254 (464)
Q Consensus       175 ~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  254 (464)
                      .+.|++++|.++|+++.+.+ +.+..++..++.++.+.|++++|.++++++.+.. +.+..++..++..|.+.|++    
T Consensus       316 ~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~----  389 (597)
T 2xpi_A          316 FVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAVTWLAVGIYYLCVNKI----  389 (597)
T ss_dssp             HHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHHHHHHHHHHHHHTTCH----
T ss_pred             HHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHHHHHHHHHHHHHhccH----
Confidence            77777777777777766543 2355566667777777777777777777766543 33566677777777776655    


Q ss_pred             CHHHHHHHHHHHHhCCCCCCHHhHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhccCChHHHHHHHH
Q 047873          255 DMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAERMLR  334 (464)
Q Consensus       255 ~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~  334 (464)
                        ++|.++|+++.... +.+..+|..++.+|.+.|++++|.++|+++.+.+.. +..++..++.+|.+.|++++|..+|+
T Consensus       390 --~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~  465 (597)
T 2xpi_A          390 --SEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQG-THLPYLFLGMQHMQLGNILLANEYLQ  465 (597)
T ss_dssp             --HHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTT-CSHHHHHHHHHHHHHTCHHHHHHHHH
T ss_pred             --HHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCcc-chHHHHHHHHHHHHcCCHHHHHHHHH
Confidence              47777777776542 234567777777777777777777777777765432 56677777777777777777777777


Q ss_pred             HHHHCCCCCCHhhHHHHHHHHHhcCChHHHHHHHHHHHhC----CCCcC--HHHHHHHHHHHHhcCCHHHHHHHHHHHHh
Q 047873          335 EMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSD----GHLPA--VETYNALMNGLCKHGQLKNANMLLDTMLD  408 (464)
Q Consensus       335 ~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~----~~~~~--~~~~~~l~~~~~~~g~~~~a~~~~~~~~~  408 (464)
                      ++.+.. +.+..+|+.++..|.+.|++++|.++|+++.+.    +..|+  ..+|..++.+|.+.|++++|.++++++.+
T Consensus       466 ~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~  544 (597)
T 2xpi_A          466 SSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLL  544 (597)
T ss_dssp             HHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             HHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHH
Confidence            776654 345667777777777777777777777777664    44555  56777777777777777777777777765


Q ss_pred             CCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHh-cCCCCc
Q 047873          409 LGVVPDDITYNILLEGHCKHGNPEDFDKLQSE-KGLVSD  446 (464)
Q Consensus       409 ~~~~p~~~~~~~l~~~~~~~g~~~~a~~~~~~-~~~~p~  446 (464)
                      .+ +.+..+|..+..+|.+.|++++|.+.+++ +.+.|+
T Consensus       545 ~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~  582 (597)
T 2xpi_A          545 LS-TNDANVHTAIALVYLHKKIPGLAITHLHESLAISPN  582 (597)
T ss_dssp             HS-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT
T ss_pred             hC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcCCC
Confidence            43 33667777777777777777777777776 455665



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query464
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.96
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.69
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.67
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.52
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.43
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.32
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.31
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.27
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.26
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.25
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.25
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.25
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.19
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.99
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.98
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.96
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.94
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.88
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.86
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.73
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.71
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.69
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.65
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.65
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.63
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.61
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.57
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.53
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.5
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.5
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.48
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.47
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.44
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.4
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.31
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.27
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.19
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.17
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.05
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.04
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.02
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.0
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.99
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.98
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.97
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.9
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.83
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.8
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.34
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.27
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.91
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.72
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.68
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.64
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.49
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.27
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.15
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 92.81
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 92.16
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 91.66
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=3.1e-24  Score=193.02  Aligned_cols=382  Identities=13%  Similarity=0.016  Sum_probs=302.6

Q ss_pred             HHHHHHhCCChHHHHHHHHHHHHhcCCCChHHHHHHHHHhcCCCCCh-hhHHHHHHHHHhcCChhHHHHHHHHHHhCCCC
Q 047873           13 MVHFLVAHKMHSQARDLLHLIVSKKGMGSSASLFASILETRGTHLPG-LVLDALMIVYVDLGFLDDAIQCFRLLRKHYFR   91 (464)
Q Consensus        13 l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~   91 (464)
                      +.+.+.+.|++++|++.|+++++                   ..|++ .++..++.+|.+.|++++|+..|+++.+.+ |
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~-------------------~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p   64 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWR-------------------QEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-P   64 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHH-------------------HCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-T
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHH-------------------hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-C
Confidence            56778889999999999999984                   24544 888999999999999999999999998876 4


Q ss_pred             CChhcHHHHHHHHHcCCChhhHHHHHHHHHhcCCCCChhhHHHHHHHHHhcCChhhHHHHHHHHhhCCCCCCcccHHHHH
Q 047873           92 IPARGCRCLIDRMMRTNLPTVTLGFYLEILDYGYSPSVYVFNVLMHKLCKEGKIKDAQMVFDEFGKRGLHATAVSFNTLI  171 (464)
Q Consensus        92 ~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~  171 (464)
                      .+..++..++.++.+.|++++|+..+....+.... +..............+....+........... ...........
T Consensus        65 ~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~  142 (388)
T d1w3ba_          65 LLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD-FIDGYINLAAALVAAGDMEGAVQAYVSALQYN-PDLYCVRSDLG  142 (388)
T ss_dssp             TCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC-TTCTHHHHHHH
T ss_pred             CCHHHHHHHHHHhhhhccccccccccccccccccc-cccccccccccccccccccccccccccccccc-ccccccccccc
Confidence            56778889999999999999999999999887654 55566666666667777777776666655543 33455555666


Q ss_pred             HHHHhcCChhHHHHHHHHHhhCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCcc
Q 047873          172 NGHCKAKNLDEGFRLKSVMEGSGMRPDVYTYSALINGLCKENRLDDAELLLHEMCERGLTPNDVIFTTLIDGHCKNGRID  251 (464)
Q Consensus       172 ~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  251 (464)
                      ......+....+...+....... +.+...+..+...+...|++++|...+++..+..+ -+...+..+...+...++++
T Consensus       143 ~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p-~~~~~~~~l~~~~~~~~~~~  220 (388)
T d1w3ba_         143 NLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDP-NFLDAYINLGNVLKEARIFD  220 (388)
T ss_dssp             HHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHTTTCTT
T ss_pred             ccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhCc-ccHHHHHHHhhhhhccccHH
Confidence            66777788888888887776553 33567778888889999999999999998887642 25677888888888888874


Q ss_pred             cccCHHHHHHHHHHHHhCCCCCCHHhHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHhccCChHHHHH
Q 047873          252 MAGDMKEARKIVDEMCTNGLNPDKITYTILLDGFCKEGDLESALDIRKEMIKRGIELDNVAFTALISGFCRGGKVVEAER  331 (464)
Q Consensus       252 ~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~a~~  331 (464)
                            +|...+++...... .+...+..+..++.+.|++++|...|++..+..+. +...+..+...+...|++++|..
T Consensus       221 ------~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~-~~~~~~~l~~~~~~~~~~~~A~~  292 (388)
T d1w3ba_         221 ------RAVAAYLRALSLSP-NHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPH-FPDAYCNLANALKEKGSVAEAED  292 (388)
T ss_dssp             ------HHHHHHHHHHHHCT-TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSS-CHHHHHHHHHHHHHHSCHHHHHH
T ss_pred             ------HHHHHHHHhHHHhh-hHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCC-CHHHHHHHHHHHHHcCCHHHHHH
Confidence                  88999888877543 35667777888889999999999999998887544 67788888889999999999999


Q ss_pred             HHHHHHHCCCCCCHhhHHHHHHHHHhcCChHHHHHHHHHHHhCCCCcCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCC
Q 047873          332 MLREMLKVGLKPDDATYTMVIDCFCKNGDTKTGFRLLKEMRSDGHLPAVETYNALMNGLCKHGQLKNANMLLDTMLDLGV  411 (464)
Q Consensus       332 ~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~  411 (464)
                      .++...... +.+...+..+...+...|++++|+..|++.++.. +-+..++..+..+|.+.|++++|.+.|+++++.  
T Consensus       293 ~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l--  368 (388)
T d1w3ba_         293 CYNTALRLC-PTHADSLNNLANIKREQGNIEEAVRLYRKALEVF-PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI--  368 (388)
T ss_dssp             HHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSC-TTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT--
T ss_pred             HHHhhhccC-CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--
Confidence            998887764 5567788888888999999999999999888752 235777888889999999999999999998864  


Q ss_pred             CC-CHHHHHHHHHHHHhcCC
Q 047873          412 VP-DDITYNILLEGHCKHGN  430 (464)
Q Consensus       412 ~p-~~~~~~~l~~~~~~~g~  430 (464)
                      .| +...|..+..+|.+.||
T Consensus       369 ~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         369 SPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             CTTCHHHHHHHHHHHHHTCC
T ss_pred             CCCCHHHHHHHHHHHHHcCC
Confidence            45 57778888888887775



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure