Citrus Sinensis ID: 048095
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 535 | ||||||
| 449466953 | 1145 | PREDICTED: uncharacterized protein LOC10 | 0.928 | 0.434 | 0.297 | 2e-42 | |
| 449524874 | 888 | PREDICTED: uncharacterized LOC101218416, | 0.928 | 0.559 | 0.297 | 4e-42 | |
| 255542460 | 716 | Protein FRIGIDA, putative [Ricinus commu | 0.628 | 0.469 | 0.343 | 9e-42 | |
| 224130844 | 1006 | predicted protein [Populus trichocarpa] | 0.820 | 0.436 | 0.311 | 2e-40 | |
| 147767145 | 1701 | hypothetical protein VITISV_031269 [Viti | 0.285 | 0.089 | 0.503 | 2e-37 | |
| 224130848 | 954 | predicted protein [Populus trichocarpa] | 0.749 | 0.420 | 0.326 | 4e-37 | |
| 224130856 | 1033 | predicted protein [Populus trichocarpa] | 0.289 | 0.150 | 0.483 | 6e-36 | |
| 224130872 | 168 | predicted protein [Populus trichocarpa] | 0.289 | 0.922 | 0.490 | 5e-34 | |
| 297813019 | 1191 | predicted protein [Arabidopsis lyrata su | 0.902 | 0.405 | 0.307 | 7e-31 | |
| 356541044 | 885 | PREDICTED: uncharacterized protein LOC10 | 0.854 | 0.516 | 0.277 | 9e-31 |
| >gi|449466953|ref|XP_004151190.1| PREDICTED: uncharacterized protein LOC101218416 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 179 bits (455), Expect = 2e-42, Method: Compositional matrix adjust.
Identities = 172/578 (29%), Positives = 286/578 (49%), Gaps = 81/578 (14%)
Query: 15 LQCKERQLRFLEKRIGESKGELALVQKEIEECNS-------ELWCKEKELGLVQKRIRGC 67
++ KE++L + + I E E L +K +E + EL KEK+ +Q I+
Sbjct: 175 MELKEQKLNGVMQLIEERLMECELKEKSVESIRALLRNHEEELAIKEKQFDAIQMAIKDS 234
Query: 68 NGELQS----------------KQGELALVEKEIEESNSELQSKEIELGLLQKRVGECNC 111
NGEL+ K+ L +EK I+ EL KE E ++ ++G +
Sbjct: 235 NGELKLKEKELETIQNMIATKWKEKRLDKIEKTIKVRTEELDLKEQEFDVMWSKLGALSE 294
Query: 112 ELECKQQQLGLAQSEEDLLKNSLKNSIEHWSQKLNLTKEELSLLQKSIRECKGELDSKER 171
+L K+ +L S+K+ I+ S++L++ +++L Q+SIR+C+ +
Sbjct: 295 DLLSKESEL-----------ESIKSCIKEHSKELDVQEKQLDGTQQSIRDCQNAVMMLTN 343
Query: 172 QLAVVQKRIGECNNELQLKENELNLVK-TV--------------------VEHCLQKLNL 210
++ ++K I EC+ E +L+EN + +K TV V+ CL+ L
Sbjct: 344 YVSTIEKAIIECSKEWELEENHHHSLKETVDGNSNDFSSVVEQHGSISLTVDKCLEGLKS 403
Query: 211 KKEELSLLQKSNGEWNGQLECGERQLELRLEPESGIKDCSQQIELKE-KKLRQIQSS--- 266
+KE + L+K E + LE E + R+E E KD + LKE + L+ S
Sbjct: 404 QKEHFNALRKFIEERSKYLENVENNFKRRME-ELNKKDEKVSLYLKEIESLKADMDSQIL 462
Query: 267 -IEECEKELAIKERHISDYEEKLKAKEKLYDEIKKSIKELESAKKELEQPKSL------- 318
+E+ +EL +KE +E+L++KEK + ++ I++ K ++ P +L
Sbjct: 463 LLEKDREELRLKEIQHKAPDEELESKEKEINLVRALIQKCNEKVKLIDDPNNLHLQVKTE 522
Query: 319 ------TDNEETRLLSLQSMNNGRSLQLILNQHLQKHDLIFGQISQTLTKACDPALLVLD 372
+ T S +G+ L +L +HL+ HDL+ ++ TL + DPA LVLD
Sbjct: 523 ESGCKPAGSSNTLHFPTGSALDGKLLLALLCEHLKLHDLVRAELMITLKASSDPAKLVLD 582
Query: 373 AMQGFYPPHSRKGDMEFDVSIIKRTCILLLEQLSNIAPDINPQVRDEAMKMAGEWKKKMG 432
AM+ FYP H+ D + D +KR CI L E L N +P I P +++EA+++AG WK K+
Sbjct: 583 AMRWFYPTHTESKDAKIDFYNVKRGCIFLSELLLNFSPKITPPLKEEALRLAGLWKAKLV 642
Query: 433 VIGENSLEVLGFLHLLAAYRLAPAFDGNELESLLDIVAHYRQTAKLRQSLGFADK---VT 489
+ EN EV+ FL L+A +RLA F+ EL+ LL+ V+ Y+Q +L ++LG DK V
Sbjct: 643 MPVENHAEVVAFLLLVANFRLASNFNAGELQILLNSVSQYKQAFELSRALGIGDKSSEVN 702
Query: 490 VVPWSSIGMDQAENSRMNHGIGPAVFREQLQLQNYNKR 527
P S+ E + N G+ + EQL ++ KR
Sbjct: 703 ATPTPSL----VELEQPNEGLVFSSKNEQLSMEPNEKR 736
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449524874|ref|XP_004169446.1| PREDICTED: uncharacterized LOC101218416, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255542460|ref|XP_002512293.1| Protein FRIGIDA, putative [Ricinus communis] gi|223548254|gb|EEF49745.1| Protein FRIGIDA, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224130844|ref|XP_002328390.1| predicted protein [Populus trichocarpa] gi|222838105|gb|EEE76470.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147767145|emb|CAN75646.1| hypothetical protein VITISV_031269 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224130848|ref|XP_002328391.1| predicted protein [Populus trichocarpa] gi|222838106|gb|EEE76471.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224130856|ref|XP_002328393.1| predicted protein [Populus trichocarpa] gi|222838108|gb|EEE76473.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224130872|ref|XP_002328397.1| predicted protein [Populus trichocarpa] gi|222838112|gb|EEE76477.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297813019|ref|XP_002874393.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297320230|gb|EFH50652.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356541044|ref|XP_003538993.1| PREDICTED: uncharacterized protein LOC100783311 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 535 | ||||||
| TAIR|locus:2181241 | 1181 | AT5G27220 "AT5G27220" [Arabido | 0.867 | 0.392 | 0.265 | 5.3e-27 | |
| TAIR|locus:2181251 | 948 | AT5G27230 [Arabidopsis thalian | 0.338 | 0.190 | 0.307 | 2.5e-14 | |
| TAIR|locus:2826175 | 473 | FRL2 "AT1G31814" [Arabidopsis | 0.426 | 0.482 | 0.241 | 2.2e-11 | |
| TAIR|locus:2171327 | 470 | FRL1 "FRIGIDA like 1" [Arabido | 0.226 | 0.257 | 0.369 | 7.9e-11 | |
| TAIR|locus:1005716104 | 558 | AT5G48385 "AT5G48385" [Arabido | 0.250 | 0.240 | 0.346 | 1.3e-10 | |
| DICTYBASE|DDB_G0286985 | 1024 | zipA "zipper-like domain-conta | 0.332 | 0.173 | 0.217 | 3.2e-08 | |
| ZFIN|ZDB-GENE-030131-731 | 904 | hmmr "hyaluronan-mediated moti | 0.489 | 0.289 | 0.232 | 4.6e-08 | |
| WB|WBGene00010306 | 1133 | F59A2.6 [Caenorhabditis elegan | 0.570 | 0.269 | 0.233 | 4.7e-08 | |
| SGD|S000002764 | 944 | SPC110 "Inner plaque spindle p | 0.745 | 0.422 | 0.204 | 2.2e-07 | |
| MGI|MGI:2685018 | 848 | Ccdc110 "coiled-coil domain co | 0.282 | 0.178 | 0.240 | 1.8e-06 |
| TAIR|locus:2181241 AT5G27220 "AT5G27220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 335 (123.0 bits), Expect = 5.3e-27, Sum P(2) = 5.3e-27
Identities = 130/489 (26%), Positives = 223/489 (45%)
Query: 15 LQCKERQLRFLEKRIGESKGELALVQKEIEECNSELWCKEKELGLVQKRIRGCNGELQSK 74
L+ + + R L + I + EL V + E + E+EL L QK + + EL SK
Sbjct: 328 LEKSQTRSRELAEEIERKRKELTAVLDKTAEYGKTIELVEEELALQQKLLDIRSSELVSK 387
Query: 75 QGEL-------ALVEK---EIEESNSELQSKEIELGLLQKRVGECNCELECKQQQLGLAQ 124
+ EL LV E++E+ ++SK EL +++ + E + E + L
Sbjct: 388 KKELDGLSLDLELVNSLNNELKETVQRIESKGKELEDMERLIQERSGHNESIKLLLE-EH 446
Query: 125 SEEDLLKNSLKNSIEHWSQKLNLTKEELSLLQKSIRECKGELDSKERQLAVVQKRIGXXX 184
SEE +K N I +KL+L E+ +K+I++ + SK+ +L +K +
Sbjct: 447 SEELAIKEERHNEIAEAVRKLSL---EIVSKEKTIQQLSEKQHSKQTKLDSTEKCLEETT 503
Query: 185 XXXXXXXXXXXXVKTVVEHCXXXXXXXXXXXXXXXXXXGEWNGQL-ECGERQLELRLEPE 243
VK C + L + ++ EL E
Sbjct: 504 AELVSKENELCSVKDTYRECLQNWEIKEKELKSFQEEVKKIQDSLKDFQSKEAELVKLKE 563
Query: 244 SGIKDCSQQIELKEKKLRQIQSSIEECEKELAIKERHISXXXXXXXXXXXXXXXIKKSIK 303
S + + +++ LK+K++ IE +K+L +E + + K +K
Sbjct: 564 S-LTEHEKELGLKKKQIHVRSEKIELKDKKLDAREERLDKKDEQLKSAEQK---LAKCVK 619
Query: 304 ELE-SAKKELEQPKSLTDNEETRLLSLQSMNNGRSLQLILNQHLQKHDLIFGQISQTLTK 362
E E +AKK + +++ L+ S+ + ++LQL+L HL+K D + + + L
Sbjct: 620 EYELNAKKLASFCQQNNPDQQVDLVRDASVCDEKTLQLLLRGHLKKCDQLHLDVLRALKA 679
Query: 363 ACDPALLVLDAMQGFYPPHSRKGDMEFDVSIIKRTCILLLEQLSNIAPDINPQVRDEAMK 422
+ DPA LVL+ +Q H + + D ++R I LLE L +++P+ +V+ EA+K
Sbjct: 680 SSDPAKLVLNTIQRL---HEKMAVTKLDPDSVRRGSICLLECLMDMSPEPKTEVQVEAIK 736
Query: 423 MAGEWKKKMGVIGENSLEVLGFLHLLAAYRLAPAFDGNELESLLDIVAHYRQTA-KLRQS 481
EWK V EN +EVLGFLH L+A+ LA FD +++++L D A RQ A L ++
Sbjct: 737 SVTEWKNTTLVKAENPVEVLGFLHFLSAFSLAYTFDADKVQNLFD-AAFLRQYAPSLCEA 795
Query: 482 LGFADKVTV 490
LG + V
Sbjct: 796 LGVSSLAPV 804
|
|
| TAIR|locus:2181251 AT5G27230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2826175 FRL2 "AT1G31814" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171327 FRL1 "FRIGIDA like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716104 AT5G48385 "AT5G48385" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286985 zipA "zipper-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-731 hmmr "hyaluronan-mediated motility receptor (RHAMM)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00010306 F59A2.6 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| SGD|S000002764 SPC110 "Inner plaque spindle pole body (SPB) component" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2685018 Ccdc110 "coiled-coil domain containing 110" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_scaffold_70000144 | hypothetical protein (1006 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 535 | |||
| pfam07899 | 293 | pfam07899, Frigida, Frigida-like protein | 9e-39 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-14 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-14 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 9e-14 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-12 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-10 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-10 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-08 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-06 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 2e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-05 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 5e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 7e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-04 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 2e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 2e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-04 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 5e-04 | |
| PLN02939 | 977 | PLN02939, PLN02939, transferase, transferring glyc | 6e-04 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 7e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 9e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| PRK00106 | 535 | PRK00106, PRK00106, hypothetical protein; Provisio | 0.003 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.004 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 0.004 |
| >gnl|CDD|219629 pfam07899, Frigida, Frigida-like protein | Back alignment and domain information |
|---|
Score = 143 bits (362), Expect = 9e-39
Identities = 72/183 (39%), Positives = 106/183 (57%), Gaps = 5/183 (2%)
Query: 313 EQPKSLTDNEETRLLSLQSMNNGRSLQLILNQHLQKHDLIFGQISQTLTKACDPALLVLD 372
+P S + L L + R L + ++ ++ + ++ L A DPA LVLD
Sbjct: 2 SEPSSDEEGLNPELRRLCEKMDSRGLLKFVIENRKELASLREEVPAALRCAPDPAKLVLD 61
Query: 373 AMQGFYPPHSRKGDMEFDVSIIKRTCILLLEQLSNIAPDINPQVRDEAMKMAGEWKKKM- 431
A++GFYPP S+ G E + ++R+C+LLLEQL + P I+P V++EA K+A EWK K+
Sbjct: 62 AIEGFYPPDSKGGK-EDKMVDVRRSCVLLLEQLVRVNPPISPDVKEEAKKLAVEWKAKLE 120
Query: 432 ---GVIGENSLEVLGFLHLLAAYRLAPAFDGNELESLLDIVAHYRQTAKLRQSLGFADKV 488
GV SLE LGFL LLAA+ L FD +EL L +V+ +Q +L +SLG ADK+
Sbjct: 121 EDGGVENGKSLEALGFLQLLAAFGLVSEFDQDELLKLFVMVSRRKQAPELCRSLGLADKM 180
Query: 489 TVV 491
+
Sbjct: 181 PDL 183
|
This family is composed of plant proteins that are similar to FRIGIDA protein expressed by Arabidopsis thaliana. This protein is probably nuclear and is required for the regulation of flowering time in the late-flowering phenotype. It is known to increase RNA levels of flowering locus C. Allelic variation at the FRIGIDA locus is a major determinant of natural variation in flowering time. Length = 293 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|215507 PLN02939, PLN02939, transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|178867 PRK00106, PRK00106, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 535 | |||
| PF07899 | 290 | Frigida: Frigida-like protein; InterPro: IPR012474 | 100.0 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.95 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.95 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.87 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.72 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.64 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.45 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.42 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.41 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.37 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.29 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.2 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.15 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.11 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.11 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.11 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.02 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.01 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.0 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.98 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.97 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.94 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.84 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.77 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 97.76 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 97.71 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.7 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.66 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 97.62 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.61 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.59 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 97.49 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 97.46 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.39 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.3 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.24 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.21 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.1 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.02 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.0 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 96.92 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.85 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 96.84 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 96.82 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.81 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.68 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 96.62 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 96.51 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.47 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.45 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.43 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 96.4 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 96.38 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.37 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 96.34 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.28 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.21 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.15 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.15 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.07 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 96.06 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 95.98 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 95.88 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 95.79 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 95.73 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 95.6 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 95.31 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 95.02 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 94.63 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 94.39 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 94.28 | |
| PRK09039 | 343 | hypothetical protein; Validated | 94.23 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 94.19 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 94.1 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 94.02 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 93.7 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 93.67 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 93.5 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 93.39 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 93.34 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 93.24 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 93.22 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 93.19 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 93.15 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 93.13 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 93.11 | |
| PRK09039 | 343 | hypothetical protein; Validated | 93.05 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 93.02 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 92.57 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 92.42 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 92.39 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 92.29 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 92.12 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.96 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 91.75 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 91.71 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 91.7 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 91.57 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 91.53 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 91.46 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 91.37 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 91.33 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 91.18 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 90.92 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 90.59 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 90.57 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 90.45 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 90.29 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 90.18 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 90.04 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 89.88 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 89.81 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 89.45 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 89.37 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 89.28 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 89.0 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 88.99 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 88.76 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 88.42 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 88.42 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 88.38 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 88.3 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 88.23 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 88.16 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 88.12 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 87.54 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 87.05 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 86.64 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 86.6 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 86.58 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 86.2 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 85.82 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 85.76 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 85.62 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 85.61 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 85.57 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 85.55 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 85.52 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 85.49 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 84.7 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 84.34 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 84.13 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 84.11 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 83.99 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 83.79 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 83.25 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 83.09 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 83.02 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 83.0 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 82.94 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 82.88 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 82.72 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 82.68 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 82.65 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 82.51 | |
| COG3352 | 157 | FlaC Putative archaeal flagellar protein C [Cell m | 81.75 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 81.75 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 81.62 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 81.36 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 81.25 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 81.18 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 81.09 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 80.45 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 80.43 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 80.05 |
| >PF07899 Frigida: Frigida-like protein; InterPro: IPR012474 This family is composed of plant proteins that are similar to FRIGIDA protein expressed by Arabidopsis thaliana (Mouse-ear cress) (Q9FDW0 from SWISSPROT) | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.4e-63 Score=502.97 Aligned_cols=204 Identities=38% Similarity=0.588 Sum_probs=193.4
Q ss_pred CCcchhhHHHHHhhhCChHHHHHHHHHhhcchhhhHHhHHHHhhhCCCchhHHHHHhcccCCCCCCCCCCcchhhHhHHH
Q 048095 318 LTDNEETRLLSLQSMNNGRSLQLILNQHLQKHDLIFGQISQTLTKACDPALLVLDAMQGFYPPHSRKGDMEFDVSIIKRT 397 (535)
Q Consensus 318 ~~~~~~~~L~~lC~~MD~~gL~~fv~~~~k~~~~lr~Ev~~AL~~A~DPAkLVLdai~~f~~~~~~~~~~~~~~~~~r~~ 397 (535)
.++.++++|.++|++|||+||++||++|+++++++|+|+|+||++|||||+||||||+|||+++++. ++++++.++||+
T Consensus 7 ~~~~~~~~L~~lC~~MD~~gL~~fv~~~~k~~~~lr~Ev~~AL~~A~DPAkLVLdai~~f~~~~~~~-~~~~~~~~~r~~ 85 (290)
T PF07899_consen 7 VEVKPRPELKSLCEKMDGKGLRKFVSENRKELASLREEVPAALRCAPDPAKLVLDAIEGFYPPGSKN-KKDSKLVDVRRA 85 (290)
T ss_pred CCcchHHHHHHHHHHCCHHHHHHHHHHhhhhHHHHHHHHHHHHHcCCChHHHHHHHHHcccCCcccc-ccCcchhhHHHH
Confidence 3456899999999999999999999999999999999999999999999999999999999998765 556678899999
Q ss_pred HHHHHhhhhhcCCCCChhHHHHHHHHHHHHHHhc-cccCCChHHHHHHHHHHHHhcCCCCCChHHHHHHHHHhhhhhhhH
Q 048095 398 CILLLEQLSNIAPDINPQVRDEAMKMAGEWKKKM-GVIGENSLEVLGFLHLLAAYRLAPAFDGNELESLLDIVAHYRQTA 476 (535)
Q Consensus 398 CilLLE~L~~~~p~i~~~vkeeA~~lA~~WK~~i-~~~~~~~lea~gFL~lla~fgi~s~Fd~del~~Lv~~va~~~~~~ 476 (535)
||+|||+|+.++|.++|+|+++|+++|.+||++| +.+++++++|||||||||+|||+++||.|||++||.+|++|+|||
T Consensus 86 cilLLE~L~~~~~~is~~vke~A~~lA~~WK~~l~~~~~~~~lea~gFL~lla~fgi~s~Fd~del~~Lv~~va~~~~a~ 165 (290)
T PF07899_consen 86 CILLLEQLMRISPEISPEVKEEAKKLAEEWKSKLDGVNNENSLEALGFLQLLAAFGIVSEFDEDELLKLVVSVARRKQAP 165 (290)
T ss_pred HHHHHHHHhhcCCCCCHHHHHHHHHHHHHHHHHHHhcccCCCHHHHHHHHHHHHcCCccccCHHHHHHHHHHhcchHhhH
Confidence 9999999999999999999999999999999999 777789999999999999999999999999999999999999999
Q ss_pred HHHHhcCCcccccchHHHhhhcC-chhhhhhhhhc------CchhHHhH-HhHh
Q 048095 477 KLRQSLGFADKVTVVPWSSIGMD-QAENSRMNHGI------GPAVFREQ-LQLQ 522 (535)
Q Consensus 477 ~L~~sLGL~~K~~diV~~LI~~g-qieAv~~~~~f------~p~~ll~~-~~~~ 522 (535)
+||++|||++||||||++||++| ||+||+|||+| +|+|||+. ++.+
T Consensus 166 ~L~~sLgl~~k~~d~V~~LI~~g~~ieAv~fi~~f~L~dkfpPv~lLk~yl~~~ 219 (290)
T PF07899_consen 166 ELCRSLGLSDKMPDIVEKLIKKGKQIEAVRFIYAFGLVDKFPPVPLLKSYLEDS 219 (290)
T ss_pred HHHHHcCchhhhHHHHHHHHHCCCccchHHHHHHHcCCCCCCCHHHHHHHHHHH
Confidence 99999999999999999999999 99999999975 69999999 6643
|
This protein is probably nuclear and is required for the regulation of flowering time in the late-flowering phenotype. It is known to increase RNA levels of flowering locus C. Allelic variation at the FRIGIDA locus is a major determinant of natural variation in flowering time []. |
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >COG3352 FlaC Putative archaeal flagellar protein C [Cell motility and secretion] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 535 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-13 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-06 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 1e-04 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 8e-04 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 3e-04 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 4e-04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 7e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 70.6 bits (173), Expect = 6e-13
Identities = 55/303 (18%), Positives = 130/303 (42%), Gaps = 23/303 (7%)
Query: 13 LKLQCKERQLRFLEKRIGESKGELALVQKEIEECNSELWCKEKELGLVQKRIRGCNGELQ 72
LK+ +E +++ ++ + +K + E++E + +E L+Q++++
Sbjct: 850 LKVTRQEEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELY- 908
Query: 73 SKQGELALVEKEIEESNSELQSKEIELGLLQKRVGECNCELECKQQQLGLAQSEEDLLKN 132
E EE L +K+ EL ++ + E +E ++++ Q+E K
Sbjct: 909 ----------AEAEEMRVRLAAKKQEL---EEILHEMEARIEEEEERSQQLQAE----KK 951
Query: 133 SLKNSIEHWSQKLNLTKEELSLLQKSIRECKGELDSKERQLAVVQKRIGECNNELQLKEN 192
++ + ++L + LQ G++ E + +++ + + E +L E
Sbjct: 952 KMQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEE 1011
Query: 193 ELNLVKTVVEHCLQKLNLKKEELSLLQKSNGEWNGQLECGERQLE-LRLEPESGIKDCSQ 251
++ + T L + K + L+ L+ + +LE ++ E R E E +
Sbjct: 1012 RVSDLTTN----LAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEG 1067
Query: 252 QIELKEKKLRQIQSSIEECEKELAIKERHISDYEEKLKAKEKLYDEIKKSIKELESAKKE 311
+ +++ ++Q+ I E + +LA KE + +L+ + + K I+ELES +
Sbjct: 1068 ESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISD 1127
Query: 312 LEQ 314
L++
Sbjct: 1128 LQE 1130
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C Length = 409 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 535 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.91 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.79 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.54 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.43 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.58 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.45 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.68 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 94.86 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 93.97 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 93.6 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 93.45 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 93.23 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 93.17 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 92.97 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 92.93 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 92.61 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 92.61 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 91.84 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 91.77 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 91.72 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 91.49 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 91.36 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 91.19 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 91.05 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 90.82 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 90.41 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 90.34 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 90.17 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 89.37 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 89.33 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 88.51 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 88.24 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 88.2 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 87.48 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 87.33 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 87.28 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 86.93 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 86.84 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 86.7 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 85.23 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 82.72 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 82.05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 82.02 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 80.18 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=98.91 E-value=3.9e-05 Score=73.23 Aligned_cols=106 Identities=16% Similarity=0.234 Sum_probs=66.4
Q ss_pred hhhhhhHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHH
Q 048095 9 RGFNLKLQCKERQLRFLEKRIGESKGELALVQKEIEECNSELWCKEKELGLVQKRIRGCNGELQSKQGELALVEKEIEES 88 (535)
Q Consensus 9 ~~~~~KL~~te~dLerved~i~ElEkqle~Laek~~Elk~EL~~LE~eLeeLK~eIeE~e~eIe~~qkeIe~le~eIee~ 88 (535)
.++.+|+...+.+++.+...+.++...+..+...+..+...+..+...+..+...+......+...+..+..+...+..+
T Consensus 2 ~~~~~~~~~l~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 81 (284)
T 1c1g_A 2 DAIKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKYSEALKDAQEKLELAEKKATDA 81 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 45666777777777777777777777777776666666666666666666666666666666666666666555555555
Q ss_pred HHHHHHHHHHHHHHHHHHhhhhhhHH
Q 048095 89 NSELQSKEIELGLLQKRVGECNCELE 114 (535)
Q Consensus 89 e~El~~~eeEL~~lqk~l~E~~~el~ 114 (535)
...+......+..+...+..+..++.
T Consensus 82 ~~~~~~~~~~~~~~~~~~~~~~~~~~ 107 (284)
T 1c1g_A 82 EADVASLNRRIQLFEEELDRAQERLA 107 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 55555555555555555544444443
|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00