Citrus Sinensis ID: 048142


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
YVEDSACEEALLLFREVQHKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMALKDVMTLTALIVVLAMCGQGNKALEYFYEMQIRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLELLPDNGGSYVILSNRYSSSRKWKKVKRIRELMAERNIKKPPGCILIEVDGVVHEFVKAGFVPNKSEVLFDMDEEEKETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVCNDCHTATNIISKVYNRETVVMDRNRFHHFKNGSCSCKDFW
ccccccccHHHHHHHHHHHcccccccEEHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHcccccHHHHHHHHHHHcHHccccccccccHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEcccccccccHHccccHHHHHHHHHHccHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHcccEEEEEccccccccccccccccccc
ccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccEcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEEccccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEccccccccccccEcccccc
YVEDSACEEALLLFREVQhkgltgdkVTMVSLLLACTHLgalevgmwlhpyiMKKNIEVDVGLGMALKDVMTLTALIVVLAMCGQGNKALEYFYEMQirgvkpdaITFVGVLVACShaglvderISHFNlmsekygirpsiehyGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLEllpdnggsyVILSNRYSSSRKWKKVKRIRELMAErnikkppgcilieVDGVVHEFVkagfvpnksevlfdMDEEEKETALNLHTEKLAITfglvspmpGVLIRIIKNLRVCNDCHTATNIISkvynretvvmdrnrfhhfkngscsckdfw
YVEDSACEEALLLFREVQHKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMALKDVMTLTALIVVLAMCGQGNKALEYFYEMQIRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLEllpdnggsyvilsnrysssrkwkkvKRIRELmaernikkppgciLIEVDGVVHEFVKAGFVPNKSEVLFDMDEEEKETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVCNDCHTatniiskvynrETVVMDRnrfhhfkngscsckdfw
YVEDSACEEALLLFREVQHKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMALKDVMTLTALIVVLAMCGQGNKALEYFYEMQIRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIHDNleaaeraaqqllellPDNGGSYVILSNRYSSSRKWKKVKRIRELMAERNIKKPPGCILIEVDGVVHEFVKAGFVPNKSEVLFDMDEEEKETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVCNDCHTATNIISKVYNRETVVMDRNRFHHFKNGSCSCKDFW
******CEEALLLFREVQHKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMALKDVMTLTALIVVLAMCGQGNKALEYFYEMQIRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLELLPDNGGSYVILSNRYSSSRKWKKVKRIRELMAERNIKKPPGCILIEVDGVVHEFVKAGFVPNKSEVLFDMDE**KETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVCNDCHTATNIISKVYNRETVVMDRNRFHHFKNGSCSC****
YV**SACEEALLLFREVQHKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMALKDVMTLTALIVVLAMCGQGNKALEYFYEMQIRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLELLPDNGGSYVILSNRYSSSRKWKKVKRIRELMAERNIKKPPGCILIEVDGVVHEFVKAGFVPNKSEVLFDMDEEEKETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVCNDCHTATNIISKVYNRETVVMDRNRFHHFKNGSCSCKDFW
YVEDSACEEALLLFREVQHKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMALKDVMTLTALIVVLAMCGQGNKALEYFYEMQIRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLELLPDNGGSYVILSNRY********VKRIRELMAERNIKKPPGCILIEVDGVVHEFVKAGFVPNKSEVLFDMDEEEKETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVCNDCHTATNIISKVYNRETVVMDRNRFHHFKNGSCSCKDFW
**EDSACEEALLLFREVQHKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMALKDVMTLTALIVVLAMCGQGNKALEYFYEMQIRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLELLPDNGGSYVILSNRYSSSRKWKKVKRIRELMAERNIKKPPGCILIEVDGVVHEFVKAGFVPNKSEVLFDMDEEEKETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVCNDCHTATNIISKVYNRETVVMDRNRFHHFKNGSCSCKDFW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YVEDSACEEALLLFREVQHKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMALKDVMTLTALIVVLAMCGQGNKALEYFYEMQIRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLELLPDNGGSYVILSNRYSSSRKWKKVKRIRELMAERNIKKPPGCILIEVDGVVHEFVKAGFVPNKSEVLFDMDEEEKETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVCNDCHTATNIISKVYNRETVVMDRNRFHHFKNGSCSCKDFW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query352 2.2.26 [Sep-21-2011]
O82380738 Pentatricopeptide repeat- yes no 1.0 0.476 0.437 6e-90
Q9FG16622 Pentatricopeptide repeat- no no 1.0 0.565 0.401 7e-89
Q683I9573 Pentatricopeptide repeat- no no 1.0 0.614 0.429 4e-88
Q9FI80646 Pentatricopeptide repeat- no no 0.980 0.534 0.414 2e-87
Q9FJY7620 Pentatricopeptide repeat- no no 1.0 0.567 0.411 1e-86
Q9FND7612 Putative pentatricopeptid no no 1.0 0.575 0.429 4e-86
Q9LN01741 Pentatricopeptide repeat- no no 1.0 0.475 0.422 4e-85
Q9SZT8632 Pentatricopeptide repeat- no no 1.0 0.556 0.415 4e-85
A8MQA3595 Pentatricopeptide repeat- no no 1.0 0.591 0.431 5e-85
Q9LW32659 Pentatricopeptide repeat- no no 1.0 0.534 0.413 9e-85
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function desciption
 Score =  331 bits (848), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 175/400 (43%), Positives = 240/400 (60%), Gaps = 48/400 (12%)

Query: 1   YVEDSACEEALLLFREVQ-HKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEV 59
           Y ++    EAL++F E+Q  K +  +++T+VS L AC  +GALE+G W+H YI K  I +
Sbjct: 339 YEQNGKPNEALIVFHELQLQKNMKLNQITLVSTLSACAQVGALELGRWIHSYIKKHGIRM 398

Query: 60  DVGLGMAL----------------------KDVMTLTALIVVLAMCGQGNKALEYFYEMQ 97
           +  +  AL                      +DV   +A+I  LAM G GN+A++ FY+MQ
Sbjct: 399 NFHVTSALIHMYSKCGDLEKSREVFNSVEKRDVFVWSAMIGGLAMHGCGNEAVDMFYKMQ 458

Query: 98  IRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRI 157
              VKP+ +TF  V  ACSH GLVDE  S F+ M   YGI P  +HY C+V +LGR+G +
Sbjct: 459 EANVKPNGVTFTNVFCACSHTGLVDEAESLFHQMESNYGIVPEEKHYACIVDVLGRSGYL 518

Query: 158 AKAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLELLPDNGGSYVILSNRY 217
            KA + I+ MP+     V G LLGAC+IH NL  AE A  +LLEL P N G++V+LSN Y
Sbjct: 519 EKAVKFIEAMPIPPSTSVWGALLGACKIHANLNLAEMACTRLLELEPRNDGAHVLLSNIY 578

Query: 218 SSSRKWKKVKRIRELMAERNIKKPPGCILIEVDGVVHEFVKA------------------ 259
           +   KW+ V  +R+ M    +KK PGC  IE+DG++HEF+                    
Sbjct: 579 AKLGKWENVSELRKHMRVTGLKKEPGCSSIEIDGMIHEFLSGDNAHPMSEKVYGKLHEVM 638

Query: 260 ------GFVPNKSEVLFDMDEEE-KETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVC 312
                 G+ P  S+VL  ++EEE KE +LNLH+EKLAI +GL+S     +IR+IKNLRVC
Sbjct: 639 EKLKSNGYEPEISQVLQIIEEEEMKEQSLNLHSEKLAICYGLISTEAPKVIRVIKNLRVC 698

Query: 313 NDCHTATNIISKVYNRETVVMDRNRFHHFKNGSCSCKDFW 352
            DCH+   +IS++Y+RE +V DR RFHHF+NG CSC DFW
Sbjct: 699 GDCHSVAKLISQLYDREIIVRDRYRFHHFRNGQCSCNDFW 738





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protein At5g06540 OS=Arabidopsis thaliana GN=PCMP-H88 PE=2 SV=1 Back     alignment and function description
>sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protein At3g62890 OS=Arabidopsis thaliana GN=PCMP-H82 PE=2 SV=1 Back     alignment and function description
>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1 Back     alignment and function description
>sp|Q9FND7|PP410_ARATH Putative pentatricopeptide repeat-containing protein At5g40405 OS=Arabidopsis thaliana GN=PCMP-H14 PE=3 SV=1 Back     alignment and function description
>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protein At4g37380, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H48 PE=3 SV=1 Back     alignment and function description
>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2 Back     alignment and function description
>sp|Q9LW32|PP258_ARATH Pentatricopeptide repeat-containing protein At3g26782, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H34 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
224114351 660 predicted protein [Populus trichocarpa] 1.0 0.533 0.655 1e-145
297738895 580 unnamed protein product [Vitis vinifera] 1.0 0.606 0.645 1e-141
225445386 711 PREDICTED: pentatricopeptide repeat-cont 1.0 0.495 0.645 1e-141
224134923 635 predicted protein [Populus trichocarpa] 1.0 0.554 0.469 1e-101
225442904 724 PREDICTED: putative pentatricopeptide re 1.0 0.486 0.467 1e-101
225456890 698 PREDICTED: pentatricopeptide repeat-cont 1.0 0.504 0.472 1e-100
356528966 712 PREDICTED: putative pentatricopeptide re 0.977 0.483 0.469 2e-99
225423499 738 PREDICTED: pentatricopeptide repeat-cont 1.0 0.476 0.481 4e-99
449464596 734 PREDICTED: pentatricopeptide repeat-cont 1.0 0.479 0.467 4e-97
359497398 640 PREDICTED: pentatricopeptide repeat-cont 1.0 0.55 0.477 1e-95
>gi|224114351|ref|XP_002332376.1| predicted protein [Populus trichocarpa] gi|222832200|gb|EEE70677.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  521 bits (1341), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 261/398 (65%), Positives = 301/398 (75%), Gaps = 46/398 (11%)

Query: 1   YVEDSACEEALLLFREVQHKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVD 60
           +VEDS  EEALLLFRE+Q KG+ GDKVTM SLLLACTHLGALE+G WLH YI K+ I+VD
Sbjct: 263 HVEDSNYEEALLLFREMQTKGIKGDKVTMASLLLACTHLGALELGKWLHAYIKKQRIDVD 322

Query: 61  VGLGMAL----------------------KDVMTLTALIVVLAMCGQGNKALEYFYEMQI 98
           V LG AL                      KDVMT TALI+ LAMCGQ   AL+YF EM I
Sbjct: 323 VALGTALVDMYAKCGSIETAIQVFHEMPEKDVMTWTALILGLAMCGQAENALQYFDEMHI 382

Query: 99  RGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRIA 158
           +GVKPDAITFVGVL ACSHAG VDE ISHFN MS+ YGI+P+IEHYG LV ILGRAGRIA
Sbjct: 383 KGVKPDAITFVGVLAACSHAGFVDEGISHFNSMSDTYGIQPTIEHYGGLVDILGRAGRIA 442

Query: 159 KAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLELLPDNGGSYVILSNRYS 218
           +AEELIK+MPMA D FVLGGLLGACRIH NLEAAERAA+QLLE+ P + G+YV+LSN Y 
Sbjct: 443 EAEELIKSMPMAPDQFVLGGLLGACRIHGNLEAAERAAKQLLEIDPYHSGTYVLLSNIYK 502

Query: 219 SSRKWKKVKRIRELMAERNIKKPPGCILIEVDGVVHEFVK-------------------- 258
           SS+KW++ KR RELMAER ++KPPGC  IEV GVVHEFVK                    
Sbjct: 503 SSKKWEEAKRTRELMAERGMRKPPGCSQIEVHGVVHEFVKGDSSHRQSSEINEMLEDMIS 562

Query: 259 ----AGFVPNKSEVLFDMDEEEKETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVCND 314
               AG+VP+KSEVLFDM EEEKET L+LH+EKLAI FGL+S   G  IR++KNLR+C+D
Sbjct: 563 KLKNAGYVPDKSEVLFDMAEEEKETELSLHSEKLAIAFGLLSTSVGTPIRVVKNLRICSD 622

Query: 315 CHTATNIISKVYNRETVVMDRNRFHHFKNGSCSCKDFW 352
           CH+AT +ISK+YNRE +V DRNRFHHFK+G+CSC+ FW
Sbjct: 623 CHSATKLISKLYNREIIVRDRNRFHHFKDGTCSCRGFW 660




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297738895|emb|CBI28140.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225445386|ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134923|ref|XP_002327523.1| predicted protein [Populus trichocarpa] gi|222836077|gb|EEE74498.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225442904|ref|XP_002264123.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456890|ref|XP_002277458.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356528966|ref|XP_003533068.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Glycine max] Back     alignment and taxonomy information
>gi|225423499|ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449464596|ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449529868|ref|XP_004171920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359497398|ref|XP_002270940.2| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
TAIR|locus:2126352632 AT4G37380 [Arabidopsis thalian 0.582 0.324 0.427 3e-75
TAIR|locus:2103483890 OTP84 "ORGANELLE TRANSCRIPT PR 0.573 0.226 0.389 6.1e-72
TAIR|locus:2144143622 AT5G06540 [Arabidopsis thalian 0.613 0.347 0.389 2.1e-71
TAIR|locus:2081635573 AT3G62890 [Arabidopsis thalian 0.670 0.411 0.386 3.3e-71
TAIR|locus:2205200741 OTP82 "AT1G08070" [Arabidopsis 0.593 0.282 0.385 8.3e-70
TAIR|locus:2154389646 LPA66 "LOW PSII ACCUMULATION 6 0.616 0.335 0.401 1.6e-69
TAIR|locus:4010713895595 AT4G21065 "AT4G21065" [Arabido 0.585 0.346 0.410 6.3e-69
TAIR|locus:4010713776659 AT3G26782 [Arabidopsis thalian 0.548 0.292 0.440 1.6e-68
TAIR|locus:2154855620 AT5G66520 "AT5G66520" [Arabido 0.622 0.353 0.396 4.5e-68
TAIR|locus:1009023396612 AT5G40405 "AT5G40405" [Arabido 0.590 0.339 0.420 1.6e-67
TAIR|locus:2126352 AT4G37380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 415 (151.1 bits), Expect = 3.0e-75, Sum P(3) = 3.0e-75
 Identities = 88/206 (42%), Positives = 122/206 (59%)

Query:    68 KDVMTLTALIVVLAMCGQGNKALEYFYEMQ-IRGVKPDAITFVGVLVACSHAGLVDERIS 126
             KD++   A+I   AM G    AL  F EMQ I G++P  ITF+G L AC+HAGLV+E I 
Sbjct:   323 KDIVAWNAMIAGYAMHGYSQDALRLFNEMQGITGLQPTDITFIGTLQACAHAGLVNEGIR 382

Query:   127 HFNLMSEKYGIRPSIEHYGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIH 186
              F  M ++YGI+P IEHYGCLV +LGRAG++ +A E IKNM M  D  +   +LG+C++H
Sbjct:   383 IFESMGQEYGIKPKIEHYGCLVSLLGRAGQLKRAYETIKNMNMDADSVLWSSVLGSCKLH 442

Query:   187 DNXXXXXXXXXXXXXXXPDNGGSYVILSNRYSSSRKWKKVKRIRELMAERNIKKPPGCIL 246
              +                 N G YV+LSN Y+S   ++ V ++R LM E+ I K PG   
Sbjct:   443 GDFVLGKEIAEYLIGLNIKNSGIYVLLSNIYASVGDYEGVAKVRNLMKEKGIVKEPGIST 502

Query:   247 IEVDGVVHEFVKAGFVPNKSEVLFDM 272
             IE++  VHEF       +KS+ ++ M
Sbjct:   503 IEIENKVHEFRAGDREHSKSKEIYTM 528


GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009062 "fatty acid catabolic process" evidence=RCA
TAIR|locus:2103483 OTP84 "ORGANELLE TRANSCRIPT PROCESSING 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144143 AT5G06540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081635 AT3G62890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205200 OTP82 "AT1G08070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154389 LPA66 "LOW PSII ACCUMULATION 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713895 AT4G21065 "AT4G21065" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713776 AT3G26782 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154855 AT5G66520 "AT5G66520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023396 AT5G40405 "AT5G40405" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_scaffold_215000001
hypothetical protein (660 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-83
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-76
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-15
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 1e-12
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-06
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-06
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-04
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 0.004
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  270 bits (692), Expect = 1e-83
 Identities = 142/388 (36%), Positives = 206/388 (53%), Gaps = 45/388 (11%)

Query: 7   CEEALLLFREVQHKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMA 66
           C EAL+ FR++    L  + VT+++ L AC  +GAL  G  +H ++++  I  D  L  A
Sbjct: 471 CFEALIFFRQMLLT-LKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNA 529

Query: 67  L---------------------KDVMTLTALIVVLAMCGQGNKALEYFYEMQIRGVKPDA 105
           L                     KDV++   L+      G+G+ A+E F  M   GV PD 
Sbjct: 530 LLDLYVRCGRMNYAWNQFNSHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDE 589

Query: 106 ITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRIAKAEELIK 165
           +TF+ +L ACS +G+V + + +F+ M EKY I P+++HY C+V +LGRAG++ +A   I 
Sbjct: 590 VTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFIN 649

Query: 166 NMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLELLPDNGGSYVILSNRYSSSRKWKK 225
            MP+  D  V G LL ACRIH ++E  E AAQ + EL P++ G Y++L N Y+ + KW +
Sbjct: 650 KMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDE 709

Query: 226 VKRIRELMAERNIKKPPGCILIEVDGVVHEF---------------VKAGFVPNKSEVLF 270
           V R+R+ M E  +   PGC  +EV G VH F               V  GF         
Sbjct: 710 VARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGL 769

Query: 271 DMDEEE--------KETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVCNDCHTATNII 322
              E          K+     H+E+LAI FGL++ +PG+ I + KNL +C +CH     I
Sbjct: 770 AGSESSSMDEIEVSKDDIFCGHSERLAIAFGLINTVPGMPIWVTKNLYMCENCHNTVKFI 829

Query: 323 SKVYNRETVVMDRNRFHHFKNGSCSCKD 350
           SK+  RE  V D  +FHHFK+G CSC D
Sbjct: 830 SKIVRREISVRDTEQFHHFKDGECSCGD 857


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 352
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PRK11788389 tetratricopeptide repeat protein; Provisional 99.81
PRK11788389 tetratricopeptide repeat protein; Provisional 99.81
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.77
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.76
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.75
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.64
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.62
PF1304150 PPR_2: PPR repeat family 99.56
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.56
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.55
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.53
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.5
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.5
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.48
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.48
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.45
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.43
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.43
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.43
PF1304150 PPR_2: PPR repeat family 99.41
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.4
KOG1126638 consensus DNA-binding cell division cycle control 99.39
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.38
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.37
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.37
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.34
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.29
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.29
PRK12370553 invasion protein regulator; Provisional 99.29
PRK12370553 invasion protein regulator; Provisional 99.27
KOG1126638 consensus DNA-binding cell division cycle control 99.26
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.25
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.21
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.2
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.19
KOG2003840 consensus TPR repeat-containing protein [General f 99.19
PRK11189296 lipoprotein NlpI; Provisional 99.16
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.16
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.11
KOG1129478 consensus TPR repeat-containing protein [General f 99.1
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.08
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.05
PRK11189296 lipoprotein NlpI; Provisional 99.02
PRK14574 822 hmsH outer membrane protein; Provisional 99.02
KOG0547606 consensus Translocase of outer mitochondrial membr 98.94
PF1285434 PPR_1: PPR repeat 98.92
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.9
PF1285434 PPR_1: PPR repeat 98.9
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.88
KOG0547606 consensus Translocase of outer mitochondrial membr 98.87
PRK14574 822 hmsH outer membrane protein; Provisional 98.86
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.84
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.83
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.83
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.82
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.81
KOG1125579 consensus TPR repeat-containing protein [General f 98.81
KOG2003840 consensus TPR repeat-containing protein [General f 98.77
KOG1128777 consensus Uncharacterized conserved protein, conta 98.76
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.76
KOG2076 895 consensus RNA polymerase III transcription factor 98.75
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.73
KOG2076 895 consensus RNA polymerase III transcription factor 98.72
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.68
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.64
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.62
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.61
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.6
PLN02789320 farnesyltranstransferase 98.59
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.5
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.5
KOG1128777 consensus Uncharacterized conserved protein, conta 98.48
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.48
PRK10370198 formate-dependent nitrite reductase complex subuni 98.47
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.45
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.42
KOG1129478 consensus TPR repeat-containing protein [General f 98.41
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.4
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.4
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.38
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.38
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.37
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.37
PRK15359144 type III secretion system chaperone protein SscB; 98.37
PRK15359144 type III secretion system chaperone protein SscB; 98.37
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.36
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.33
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.33
PRK10370198 formate-dependent nitrite reductase complex subuni 98.28
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.28
PLN02789320 farnesyltranstransferase 98.27
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.25
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.24
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.24
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.23
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.2
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.19
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.18
KOG1915677 consensus Cell cycle control protein (crooked neck 98.17
KOG1125579 consensus TPR repeat-containing protein [General f 98.15
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.13
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.13
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.11
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.1
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.1
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.07
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.06
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.05
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.04
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.04
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.03
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.02
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.01
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.0
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.99
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.97
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.97
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.95
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.94
PRK04841903 transcriptional regulator MalT; Provisional 97.93
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.92
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.89
PRK04841903 transcriptional regulator MalT; Provisional 97.84
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.84
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.83
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.82
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.82
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.82
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.81
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.8
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.78
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.77
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.76
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.74
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.72
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.71
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.65
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.64
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.63
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.6
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.6
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.6
KOG2376652 consensus Signal recognition particle, subunit Srp 97.6
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.59
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.56
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 97.55
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.55
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.52
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.49
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.45
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.45
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.44
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.44
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.43
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.42
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.4
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.38
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.34
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.3
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.28
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.27
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.26
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.25
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.24
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.24
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.23
KOG0553304 consensus TPR repeat-containing protein [General f 97.22
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.17
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.16
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.16
KOG0553304 consensus TPR repeat-containing protein [General f 97.15
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.15
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.15
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.11
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.11
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.1
PF12688120 TPR_5: Tetratrico peptide repeat 97.1
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.08
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.99
smart00299140 CLH Clathrin heavy chain repeat homology. 96.94
PF12688120 TPR_5: Tetratrico peptide repeat 96.94
PF1337173 TPR_9: Tetratricopeptide repeat 96.93
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.92
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 96.92
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.91
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.82
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.82
COG4700251 Uncharacterized protein conserved in bacteria cont 96.79
PRK10803263 tol-pal system protein YbgF; Provisional 96.78
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.76
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.72
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.67
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.66
PRK10803263 tol-pal system protein YbgF; Provisional 96.58
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.51
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.5
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.48
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.45
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.4
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 96.39
KOG3941406 consensus Intermediate in Toll signal transduction 96.27
PF1337173 TPR_9: Tetratricopeptide repeat 96.26
PRK15331165 chaperone protein SicA; Provisional 96.24
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.17
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.14
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.04
PRK15331165 chaperone protein SicA; Provisional 96.04
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.03
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.99
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.97
PF1342844 TPR_14: Tetratricopeptide repeat 95.89
smart00299140 CLH Clathrin heavy chain repeat homology. 95.82
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.8
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.8
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.77
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.74
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.7
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.68
COG4700251 Uncharacterized protein conserved in bacteria cont 95.67
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.51
PF1343134 TPR_17: Tetratricopeptide repeat 95.37
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.35
KOG3941406 consensus Intermediate in Toll signal transduction 95.22
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 95.2
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.1
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 95.09
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.97
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 94.9
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.73
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.43
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.41
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.29
COG3629280 DnrI DNA-binding transcriptional activator of the 94.26
KOG4555175 consensus TPR repeat-containing protein [Function 94.24
COG3898531 Uncharacterized membrane-bound protein [Function u 94.11
PF13512142 TPR_18: Tetratricopeptide repeat 94.11
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 94.0
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.0
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.95
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.93
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.87
COG3629280 DnrI DNA-binding transcriptional activator of the 93.84
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.33
KOG1585308 consensus Protein required for fusion of vesicles 93.3
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.27
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.26
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.56
PF13512142 TPR_18: Tetratricopeptide repeat 92.26
PRK11906458 transcriptional regulator; Provisional 92.23
KOG1941 518 consensus Acetylcholine receptor-associated protei 92.07
KOG2610491 consensus Uncharacterized conserved protein [Funct 91.94
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 91.76
PF1342844 TPR_14: Tetratricopeptide repeat 91.66
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.66
PRK11906458 transcriptional regulator; Provisional 91.63
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 91.56
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.32
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.29
KOG2610491 consensus Uncharacterized conserved protein [Funct 91.12
KOG4555175 consensus TPR repeat-containing protein [Function 90.89
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.78
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 90.58
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.57
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.54
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 90.52
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.41
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 90.32
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 90.26
COG3947361 Response regulator containing CheY-like receiver a 90.18
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.06
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.89
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.4
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 89.35
PF13170297 DUF4003: Protein of unknown function (DUF4003) 89.31
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 89.23
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 89.15
COG4105254 ComL DNA uptake lipoprotein [General function pred 89.02
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 88.9
COG0457291 NrfG FOG: TPR repeat [General function prediction 88.7
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.6
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.6
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 88.2
KOG4570418 consensus Uncharacterized conserved protein [Funct 88.18
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 88.08
COG4105254 ComL DNA uptake lipoprotein [General function pred 88.08
KOG4570418 consensus Uncharacterized conserved protein [Funct 88.01
PF13762145 MNE1: Mitochondrial splicing apparatus component 87.97
PF1343134 TPR_17: Tetratricopeptide repeat 87.95
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.95
COG3898531 Uncharacterized membrane-bound protein [Function u 87.56
COG4649221 Uncharacterized protein conserved in bacteria [Fun 87.2
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.18
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 86.72
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 86.68
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 86.63
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.12
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 86.12
PF13929292 mRNA_stabil: mRNA stabilisation 85.86
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 85.35
COG4455273 ImpE Protein of avirulence locus involved in tempe 84.74
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 84.51
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 83.86
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 83.79
KOG4234271 consensus TPR repeat-containing protein [General f 83.51
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.76
PF13929292 mRNA_stabil: mRNA stabilisation 82.48
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 81.32
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 81.17
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 80.47
KOG1550552 consensus Extracellular protein SEL-1 and related 80.1
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 80.09
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=3e-75  Score=566.42  Aligned_cols=352  Identities=36%  Similarity=0.627  Sum_probs=342.2

Q ss_pred             CccCCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCChHHHHHHHHHHHHcCCCCCccccccC-------------
Q 048142            1 YVEDSACEEALLLFREVQHKGLTGDKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMAL-------------   67 (352)
Q Consensus         1 y~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~li~~~~~~g~~~~a~~~~~~m~~~g~~~~~~~~~~l-------------   67 (352)
                      |++.|++++|+++|++|...|+.||..||++++.+|++.|++++|.+++.+|.+.|+.+|..+++++             
T Consensus       300 y~~~g~~~eA~~lf~~M~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~i~~~m~~~g~~~d~~~~~~Li~~y~k~G~~~~A  379 (697)
T PLN03081        300 YALHGYSEEALCLYYEMRDSGVSIDQFTFSIMIRIFSRLALLEHAKQAHAGLIRTGFPLDIVANTALVDLYSKWGRMEDA  379 (697)
T ss_pred             HHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhccchHHHHHHHHHHHHhCCCCCeeehHHHHHHHHHCCCHHHH
Confidence            5789999999999999999999999999999999999999999999999999999999999999888             


Q ss_pred             ---------CcHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCCCHhHHHHHHHHHhccCCHHHHHHHHHHhhHhcCCC
Q 048142           68 ---------KDVMTLTALIVVLAMCGQGNKALEYFYEMQIRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIR  138 (352)
Q Consensus        68 ---------~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~m~~~~g~~  138 (352)
                               ||+++||+||.+|++.|+.++|+++|++|.+.|+.||..||+++|.+|++.|++++|.++|+.|.+++|+.
T Consensus       380 ~~vf~~m~~~d~~t~n~lI~~y~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~~~~a~~~f~~m~~~~g~~  459 (697)
T PLN03081        380 RNVFDRMPRKNLISWNALIAGYGNHGRGTKAVEMFERMIAEGVAPNHVTFLAVLSACRYSGLSEQGWEIFQSMSENHRIK  459 (697)
T ss_pred             HHHHHhCCCCCeeeHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHhcCCcHHHHHHHHHHHHHhcCCC
Confidence                     99999999999999999999999999999999999999999999999999999999999999999877999


Q ss_pred             CChhHHHHHHHHHHHcCCHHHHHHHHHhCCCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCCcchHHHHHHHHh
Q 048142          139 PSIEHYGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAERAAQQLLELLPDNGGSYVILSNRYS  218 (352)
Q Consensus       139 p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~p~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~li~~~~  218 (352)
                      |+..+|++|+++|++.|++++|.+++++|+..|+..+|++|+.+|..+|+++.|..+++++.+..|.+..+|+.|++.|+
T Consensus       460 p~~~~y~~li~~l~r~G~~~eA~~~~~~~~~~p~~~~~~~Ll~a~~~~g~~~~a~~~~~~l~~~~p~~~~~y~~L~~~y~  539 (697)
T PLN03081        460 PRAMHYACMIELLGREGLLDEAYAMIRRAPFKPTVNMWAALLTACRIHKNLELGRLAAEKLYGMGPEKLNNYVVLLNLYN  539 (697)
T ss_pred             CCccchHhHHHHHHhcCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCcHHHHHHHHHHhCCCCCCCcchHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999989999999999999999


Q ss_pred             hcCChHHHHHHHHHHHhcCCCCCCceeEEEEcceeehhh------------------------hcCcccCchhhhhcCCH
Q 048142          219 SSRKWKKVKRIRELMAERNIKKPPGCILIEVDGVVHEFV------------------------KAGFVPNKSEVLFDMDE  274 (352)
Q Consensus       219 ~~g~~~~a~~~~~~m~~~g~~p~~~~~~~~~~~~~~~~~------------------------~~G~~~~~~~~~~~~~~  274 (352)
                      +.|++++|.++++.|+++|+++.++++|+.+.+.+|.|.                        +.|+.|+...++.++++
T Consensus       540 ~~G~~~~A~~v~~~m~~~g~~k~~g~s~i~~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~gy~~~~~~~~~~~~~  619 (697)
T PLN03081        540 SSGRQAEAAKVVETLKRKGLSMHPACTWIEVKKQDHSFFSGDRLHPQSREIYQKLDELMKEISEYGYVAEENELLPDVDE  619 (697)
T ss_pred             hCCCHHHHHHHHHHHHHcCCccCCCeeEEEECCeEEEEccCCCCCccHHHHHHHHHHHHHHHHHcCCCCCcchhhccccH
Confidence            999999999999999999999999999999887666554                        78999999999999999


Q ss_pred             HHHhhhhhhhhHHHHHHHhhhCCCCCCcEEEEcccccccCccchhHHHhhhhcceEEeecCCccccccCCccCCCCCC
Q 048142          275 EEKETALNLHTEKLAITFGLVSPMPGVLIRIIKNLRVCNDCHTATNIISKVYNRETVVMDRNRFHHFKNGSCSCKDFW  352 (352)
Q Consensus       275 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~i~~~~~l~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~  352 (352)
                      +.++..+..|||+||++||+++++++.+|+|+||||+|+|||+|+|+||++.+|+|||||.+|||||++|+|||+|||
T Consensus       620 ~~~~~~~~~hsekla~a~~l~~~~~~~~i~i~knlr~c~dch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d~w  697 (697)
T PLN03081        620 DEEKVSGRYHSEKLAIAFGLINTSEWTPLQITQSHRICKDCHKVIKFIALVTKREIVVRDASRFHHFKLGKCSCGDYW  697 (697)
T ss_pred             HHHHHHHHhccHHHHHHhhCccCCCCCeEEEecCCEECCCchhhHHHHhhhcceEEEEecCCccccCCCCcccccccC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999999999



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 55.6 bits (132), Expect = 2e-08
 Identities = 24/226 (10%), Positives = 63/226 (27%), Gaps = 17/226 (7%)

Query: 18  QHKGLTGDKVTMVSLLLACTHLG----ALEVGMWLHPYIMKKNIEVDVGLGMALKDVMTL 73
               L+G +  +++    C        A  + +  H    K+ +            +   
Sbjct: 119 SQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLL----------TLDMY 168

Query: 74  TALIVVLAMCGQGNKALEYFYEMQIRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSE 133
            A+++  A  G   + +   + ++  G+ PD +++   L            I        
Sbjct: 169 NAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMS 228

Query: 134 KYGIRPSIEHYGCLVYILGRAGRIAKAEELIKNMPMALDHFVLGGLLGACRIHDNLEAAE 193
           + G++        L+    RA  +    ++    P       L   +   ++  ++ A +
Sbjct: 229 QEGLKLQALFTAVLLSEEDRATVLKAVHKV---KPTFSLPPQLPPPVNTSKLLRDVYAKD 285

Query: 194 RAAQQLLELLPDNGGSYVILSNRYSSSRKWKKVKRIRELMAERNIK 239
                    LP      +     +        V  + +        
Sbjct: 286 GRVSYPKLHLPLKTLQCLFEKQLHMELASRVCVVSVEKPTLPSKEV 331


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.92
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.9
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.85
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.84
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.83
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.81
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.8
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.77
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.74
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.74
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.73
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.73
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.71
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.71
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.69
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.68
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.68
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.65
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.65
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.65
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.64
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.64
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.64
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.64
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.63
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.62
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.62
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.61
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.61
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.6
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.6
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.59
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.55
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.55
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.55
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.53
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.53
3u4t_A272 TPR repeat-containing protein; structural genomics 99.53
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.5
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.49
3u4t_A272 TPR repeat-containing protein; structural genomics 99.45
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.45
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.44
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.44
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.4
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.39
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.37
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.36
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.35
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.33
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.33
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.33
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.33
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.33
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.32
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.32
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.29
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.27
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.26
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.25
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.25
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.23
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.21
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.16
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.15
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.15
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.14
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.13
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.12
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.12
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.11
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.09
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.07
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.06
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.06
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.04
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.03
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.03
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.02
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.0
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.0
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.0
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.99
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.99
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.99
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.94
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.94
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.91
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.9
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.9
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.9
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.9
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.88
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.88
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.86
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.85
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.83
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.81
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.8
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.76
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.76
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.75
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.74
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.74
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.73
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.73
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.71
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.71
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.67
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.66
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.66
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.65
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.63
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.63
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.6
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.6
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.58
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.58
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.57
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.57
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.57
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.56
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.55
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.55
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.54
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.52
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.51
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.51
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.51
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.5
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.48
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.47
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.45
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.43
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.43
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.43
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.4
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.4
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.39
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.38
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.37
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.35
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.35
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.35
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.34
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.32
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.3
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.3
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.3
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.29
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.29
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.29
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.28
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.28
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.27
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.27
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.26
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.25
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.25
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.23
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.19
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.17
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.15
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.15
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.11
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.11
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.1
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.08
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.05
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.04
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.03
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.03
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.02
3k9i_A117 BH0479 protein; putative protein binding protein, 98.01
3k9i_A117 BH0479 protein; putative protein binding protein, 98.0
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.98
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.96
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.9
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.89
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.86
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.85
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.84
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.82
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.77
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.63
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.63
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.63
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.6
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.58
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.57
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.55
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.48
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.45
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.44
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.43
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.39
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.38
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.36
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.35
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.21
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.13
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.88
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.77
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.75
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.56
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.43
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.4
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.32
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.28
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.94
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.94
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.86
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.84
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.59
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.1
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.5
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 94.44
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.32
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.17
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.04
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.91
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.36
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 91.98
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.77
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 91.4
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 91.21
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.37
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.12
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.02
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 89.86
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 89.6
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 89.08
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 88.66
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 87.85
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 86.74
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 84.2
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 83.03
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 82.42
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 81.12
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=3.6e-34  Score=266.58  Aligned_cols=219  Identities=18%  Similarity=0.238  Sum_probs=184.5

Q ss_pred             hHHHHHHHHHHHCCCCCCH-HHHHHHHHHHhccCChHHHHHHHHHHHHcCCCCCccccccCCcHHHHHHHHHHHHhcCC-
Q 048142            8 EEALLLFREVQHKGLTGDK-VTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMALKDVMTLTALIVVLAMCGQ-   85 (352)
Q Consensus         8 ~~A~~~~~~m~~~g~~p~~-~t~~~li~~~~~~g~~~~a~~~~~~m~~~g~~~~~~~~~~l~~~~~~~~li~~~~~~g~-   85 (352)
                      ..+..+++++++.+..+.+ ..++.+|++|++.|++++|.++|++|.+.|+.         ||.++||+||.+|++.+. 
T Consensus         7 s~~e~L~~~~~~k~~~~spe~~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~---------pd~~tyn~Li~~c~~~~~~   77 (501)
T 4g26_A            7 SPSENLSRKAKKKAIQQSPEALLKQKLDMCSKKGDVLEALRLYDEARRNGVQ---------LSQYHYNVLLYVCSLAEAA   77 (501)
T ss_dssp             -----------------CHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTCC---------CCHHHHHHHHHHHTTCCCC
T ss_pred             chHHHHHHHHHHhcccCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCC---------CCHhHHHHHHHHHHhCCch
Confidence            4566777888888877654 46889999999999999999999999999999         899999999999998765 


Q ss_pred             --------hHHHHHHHHHHHHcCCCCCHhHHHHHHHHHhccCCHHHHHHHHHHhhHhcCCCCChhHHHHHHHHHHHcCCH
Q 048142           86 --------GNKALEYFYEMQIRGVKPDAITFVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHYGCLVYILGRAGRI  157 (352)
Q Consensus        86 --------~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~m~~~~g~~p~~~~~~~li~~~~~~g~~  157 (352)
                              +++|.++|++|.+.|+.||..||++||.+|++.|++++|.++|++|.+. |+.||..+||+||.+|++.|++
T Consensus        78 ~~~~~~~~l~~A~~lf~~M~~~G~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~-g~~Pd~~tyn~lI~~~~~~g~~  156 (501)
T 4g26_A           78 TESSPNPGLSRGFDIFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAF-GIQPRLRSYGPALFGFCRKGDA  156 (501)
T ss_dssp             SSSSCCHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHT-TCCCCHHHHHHHHHHHHHTTCH
T ss_pred             hhhhhcchHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHc-CCCCccceehHHHHHHHHCCCH
Confidence                    6889999999999999999999999999999999999999999999997 9999999999999999999999


Q ss_pred             HHHHHHHHhC---CCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHHH-hCCCCcchHHHHHHHHhhcC------ChHHHH
Q 048142          158 AKAEELIKNM---PMALDHFVLGGLLGACRIHDNLEAAERAAQQLLE-LLPDNGGSYVILSNRYSSSR------KWKKVK  227 (352)
Q Consensus       158 ~~A~~~~~~m---~~~p~~~~~~~li~~~~~~g~~~~a~~~~~~~~~-~~~~~~~~~~~li~~~~~~g------~~~~a~  227 (352)
                      ++|.++|++|   |+.||..||++||.+|++.|++++|.+++++|.+ +..|+..||+.++..|+..+      ...++.
T Consensus       157 ~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~~a~~~g~~~~d~~  236 (501)
T 4g26_A          157 DKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNADKVYKTLQRLRDLVRQVSKSTFDMIEEWFKSEVATKTGVKKWDVK  236 (501)
T ss_dssp             HHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSBCHHHHHHHHHHHHSHHHHTCCBSCCCHH
T ss_pred             HHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhCCCHHHHHHHHHHHHHhCCCcCHHHHHHHHHHHhcCcchhhhhhhhhhh
Confidence            9999999999   8999999999999999999999999999999987 67899999999999987643      222355


Q ss_pred             HHHHHHHhc
Q 048142          228 RIRELMAER  236 (352)
Q Consensus       228 ~~~~~m~~~  236 (352)
                      .+...+...
T Consensus       237 ~~~~~~~~~  245 (501)
T 4g26_A          237 KIRDAVVSG  245 (501)
T ss_dssp             HHHHHHHHH
T ss_pred             hhhhhHhcc
Confidence            555555543



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 352
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-05
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.7 bits (99), Expect = 4e-05
 Identities = 29/162 (17%), Positives = 55/162 (33%), Gaps = 9/162 (5%)

Query: 68  KDVMTLTALIVVLAMCGQGNKALEYFYEM-QIRGVKPDAITFVGVLVACSHAGLVDERIS 126
             +     L  VL      ++A+  +     +          +         GL+D  I 
Sbjct: 201 NFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLAC--VYYEQGLIDLAID 258

Query: 127 HFNLMSEKYGIRPSI-EHYGCLVYILGRAGRIAKAEELIKN--MPMALDHFVLGGLLGAC 183
            +    E   ++P   + Y  L   L   G +A+AE+               L  L    
Sbjct: 259 TYRRAIE---LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIK 315

Query: 184 RIHDNLEAAERAAQQLLELLPDNGGSYVILSNRYSSSRKWKK 225
           R   N+E A R  ++ LE+ P+   ++  L++      K ++
Sbjct: 316 REQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQE 357


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.65
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.64
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.61
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.39
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.19
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.17
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.11
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.11
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.11
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.06
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.0
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.74
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.6
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.56
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.55
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.5
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.48
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.47
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.46
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.38
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.36
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.33
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.32
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.12
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.12
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.02
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.02
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.0
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.0
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.95
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.94
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.94
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.84
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.81
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.8
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.8
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.73
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.65
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.56
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.52
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.48
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.44
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.39
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.31
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.28
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.12
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.09
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.94
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.79
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.32
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.25
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.59
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.44
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.79
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 91.03
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 90.61
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 87.6
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 87.41
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 83.62
d1khda169 Anthranilate phosphoribosyltransferase (TrpD) {Pec 81.99
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65  E-value=2e-14  Score=124.16  Aligned_cols=220  Identities=14%  Similarity=0.010  Sum_probs=181.2

Q ss_pred             ccCCChhHHHHHHHHHHHCCCCC-CHHHHHHHHHHHhccCChHHHHHHHHHHHHcCCCCCccccccCCcHHHHHHHHHHH
Q 048142            2 VEDSACEEALLLFREVQHKGLTG-DKVTMVSLLLACTHLGALEVGMWLHPYIMKKNIEVDVGLGMALKDVMTLTALIVVL   80 (352)
Q Consensus         2 ~~~g~~~~A~~~~~~m~~~g~~p-~~~t~~~li~~~~~~g~~~~a~~~~~~m~~~g~~~~~~~~~~l~~~~~~~~li~~~   80 (352)
                      .+.|++++|+..|++..+.  .| +..+|..+..++...|++++|...+.+..+...          .+...|..+...|
T Consensus        30 ~~~g~~~~A~~~~~~al~~--~P~~~~a~~~lg~~~~~~~~~~~A~~~~~~al~~~p----------~~~~~~~~la~~~   97 (323)
T d1fcha_          30 LQEGDLPNAVLLFEAAVQQ--DPKHMEAWQYLGTTQAENEQELLAISALRRCLELKP----------DNQTALMALAVSF   97 (323)
T ss_dssp             HHTTCHHHHHHHHHHHHHS--CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT----------TCHHHHHHHHHHH
T ss_pred             HHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCChHHHHHHHHhhhcccc----------ccccccccccccc
Confidence            4689999999999999985  45 578899999999999999999999999988653          4567899999999


Q ss_pred             HhcCChHHHHHHHHHHHHcCCCCCHhH----------------HHHHHHHHhccCCHHHHHHHHHHhhHhcCCCCChhHH
Q 048142           81 AMCGQGNKALEYFYEMQIRGVKPDAIT----------------FVGVLVACSHAGLVDERISHFNLMSEKYGIRPSIEHY  144 (352)
Q Consensus        81 ~~~g~~~~A~~~~~~m~~~g~~p~~~t----------------~~~ll~~~~~~g~~~~a~~~~~~m~~~~g~~p~~~~~  144 (352)
                      ...|++++|++.+++....  .|+...                ....+..+...+...+|...+.+..+...-.++..++
T Consensus        98 ~~~~~~~~A~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~al~~~p~~~~~~~~  175 (323)
T d1fcha_          98 TNESLQRQACEILRDWLRY--TPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQ  175 (323)
T ss_dssp             HHTTCHHHHHHHHHHHHHT--STTTGGGCC---------------CTTHHHHHHHHHHHHHHHHHHHHHHSTTSCCHHHH
T ss_pred             cccccccccccchhhHHHh--ccchHHHHHhhhhhhhhcccccchhhHHHHHHhhHHHHHHHHHHHHHHHhhcccccccc
Confidence            9999999999999998764  232111                1111223334466778888888877642334467788


Q ss_pred             HHHHHHHHHcCCHHHHHHHHHhC-CCCC-cHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCCcchHHHHHHHHhhcCC
Q 048142          145 GCLVYILGRAGRIAKAEELIKNM-PMAL-DHFVLGGLLGACRIHDNLEAAERAAQQLLELLPDNGGSYVILSNRYSSSRK  222 (352)
Q Consensus       145 ~~li~~~~~~g~~~~A~~~~~~m-~~~p-~~~~~~~li~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~li~~~~~~g~  222 (352)
                      ..+...+...|++++|...|++. ...| +...|..+...+...|++++|.+.|++..+..|.++.+|..+..+|.+.|+
T Consensus       176 ~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~g~  255 (323)
T d1fcha_         176 CGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGA  255 (323)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTC
T ss_pred             hhhHHHHHHHHHHhhhhcccccccccccccccchhhhhhcccccccchhHHHHHHHHHHHhhccHHHHHHHHHHHHHCCC
Confidence            88999999999999999999986 3344 478899999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHh
Q 048142          223 WKKVKRIRELMAE  235 (352)
Q Consensus       223 ~~~a~~~~~~m~~  235 (352)
                      +++|.+.|++..+
T Consensus       256 ~~~A~~~~~~al~  268 (323)
T d1fcha_         256 HREAVEHFLEALN  268 (323)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
Confidence            9999999998765



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1khda1 a.46.2.1 (A:12-80) Anthranilate phosphoribosyltransferase (TrpD) {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure