Citrus Sinensis ID: 048274

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33

MRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANNFDLMYEQVKAMKDGVSVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPCGRKLTCSYPGIKFSYGPDAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIITSKAAAPVEAKA

cccccEEEEEEccccccHHHHHHHHHcccEEEEEccccccccccHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEccccEEEEEcccccccHHHHHHcccEEEEcccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHccccccEEcEEEEccccccccccccccEEEEEEEEEccccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEEEEEccHHHHHHHHHHHcccccccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccc

ccccEEEEEEEccccccccHHHHHHHHHcEEEEEcccHHcccHHHHHHHcccccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccEEEccccEEEEEcEcccccHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHccHcHcccEEEEEcccccccHHHHHHHHHHHHHHHHccccccccEEEEccccEEEEEccccccccccccEEEEEccccccccEEEEEEEccccccHHHHHHHHHHccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEccc

mrrltsvfggaaeppkggnpdsntlisdtttviclddyhsldrtgrkekgvtaldprannfDLMYEQVKAMKDGvsvekpiynhvtglldppelikppkilvieglhpMYDARVRELLDFSIYLDISNEVKFAWKIQRDMTERGHSLESIKASIEarkpdfdayidpqKQYADAVIEVlptqlipddnegkVLRVRLIMKEGvkyfspvylfdegstiewipcgrkltcsypgikfsygpdayfgheVSILEMdgkfdrldELIYVESHLSNLSTKFYGEVTQQMLkhadfpgsnngtglFQTIVGLKIRDLYEQIITskaaapveaka

mrrltsvfggaaeppkggnpdsntlISDTTTVICLDDyhsldrtgrkekgvtaldprannFDLMYEQVKAMKDGVSVEKPIYNHVtglldppeliKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLptqlipddnegkVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPCGRKLTCSYPGIKFSYGPDAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIItskaaapveaka

************************LISDTTTVICLDDYHSLDRTG****GVTALDPRANNFDLMYEQVKAMKDGVSVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDM******************PDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPCGRKLTCSYPGIKFSYGPDAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIIT***********

*RRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANNFDLMYEQVKAMKDGVSVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPCGRKLTCSYPGIKFSYGPDAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIITSKAAAP*****

**RLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANNFDLMYEQVKAMKDGVSVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPCGRKLTCSYPGIKFSYGPDAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQIITSKAAAPV****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		329	2.2.26 [Sep-21-2011]
P26302		404	Phosphoribulokinase, chlo	N/A	no	0.993	0.809	0.914	0.0
P25697		395	Phosphoribulokinase, chlo	yes	no	1.0	0.832	0.911	0.0
P27774		397	Phosphoribulokinase, chlo	N/A	no	0.963	0.798	0.921	1e-176
P09559		402	Phosphoribulokinase, chlo	N/A	no	0.975	0.798	0.866	1e-171
P19824		375	Phosphoribulokinase, chlo	N/A	no	0.981	0.861	0.766	1e-149
P37101		332	Phosphoribulokinase OS=Sy	N/A	no	0.927	0.918	0.657	1e-127
P85112		89	Phosphoribulokinase, chlo	N/A	no	0.182	0.674	0.878	6e-26
B5BF73		213	Uridine kinase OS=Salmone	yes	no	0.367	0.568	0.333	3e-17
Q5PDX6		213	Uridine kinase OS=Salmone	yes	no	0.367	0.568	0.333	3e-17
B5RBW3		213	Uridine kinase OS=Salmone	yes	no	0.367	0.568	0.333	4e-17

>sp\|P26302\|KPPR_WHEAT Phosphoribulokinase, chloroplastic OS=Triticum aestivum PE=2 SV=1	Back alignment and function desciption

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/327 (91%), Positives = 314/327 (96%)

Query: 1   MRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANN 60
           MRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDP+AN+
Sbjct: 75  MRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPKAND 134

Query: 61  FDLMYEQVKAMKDGVSVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDARVRELLDF 120
           FDLMYEQVKA+K+G ++EKPIYNHVTGLLDP ELI+PPKI VIEGLHPMYD RVRELLDF
Sbjct: 135 FDLMYEQVKAIKEGKAIEKPIYNHVTGLLDPAELIQPPKIFVIEGLHPMYDERVRELLDF 194

Query: 121 SIYLDISNEVKFAWKIQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLP 180
           SIYLDISNEVKFAWKIQRDM ERGHSLESIKASIEARKPDFDA+IDPQKQYADAVIEVLP
Sbjct: 195 SIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFIDPQKQYADAVIEVLP 254

Query: 181 TQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPCGRKLTCSYPGIKFSYGP 240
           TQLIPDDNEGKVLRV+LIMKEG+K+F+PVYLFDEGSTI WIPCGRKLTCSYPGIKFSYGP
Sbjct: 255 TQLIPDDNEGKVLRVKLIMKEGIKFFNPVYLFDEGSTINWIPCGRKLTCSYPGIKFSYGP 314

Query: 241 DAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGL 300
           D YFG EVS+LEMDG+FDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGL
Sbjct: 315 DTYFGQEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGL 374

Query: 301 FQTIVGLKIRDLYEQIITSKAAAPVEA 327
           FQTIVGLKIRDLYEQII  +A  P EA
Sbjct: 375 FQTIVGLKIRDLYEQIIAERAGVPAEA 401

Triticum aestivum (taxid: 4565)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 1EC: 9

>sp\|P25697\|KPPR_ARATH Phosphoribulokinase, chloroplastic OS=Arabidopsis thaliana GN=At1g32060 PE=1 SV=1	Back alignment and function description

>sp\|P27774\|KPPR_MESCR Phosphoribulokinase, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1	Back alignment and function description

>sp\|P09559\|KPPR_SPIOL Phosphoribulokinase, chloroplastic OS=Spinacia oleracea PE=1 SV=1	Back alignment and function description

>sp\|P19824\|KPPR_CHLRE Phosphoribulokinase, chloroplastic OS=Chlamydomonas reinhardtii GN=PRKA PE=1 SV=1	Back alignment and function description

>sp\|P37101\|KPPR_SYNY3 Phosphoribulokinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=prk PE=2 SV=1	Back alignment and function description

>sp\|P85112\|KPPR_VITSX Phosphoribulokinase, chloroplastic (Fragments) OS=Vitis sp. PE=1 SV=1	Back alignment and function description

>sp\|B5BF73\|URK_SALPK Uridine kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=udk PE=3 SV=1	Back alignment and function description

>sp\|Q5PDX6\|URK_SALPA Uridine kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=udk PE=3 SV=1	Back alignment and function description

>sp\|B5RBW3\|URK_SALG2 Uridine kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=udk PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		329
224071429		405	predicted protein [Populus trichocarpa]	0.993	0.807	0.932	0.0
224138316		405	predicted protein [Populus trichocarpa]	0.993	0.807	0.938	0.0
225470804		408	PREDICTED: phosphoribulokinase, chloropl	0.993	0.801	0.923	0.0
255555933		403	phosphoribulose kinase, putative [Ricinu	0.996	0.813	0.942	0.0
147859917		408	hypothetical protein VITISV_011191 [Viti	0.993	0.801	0.920	0.0
356495988		407	PREDICTED: phosphoribulokinase, chloropl	1.0	0.808	0.920	0.0
356531479		407	PREDICTED: phosphoribulokinase, chloropl	1.0	0.808	0.920	0.0
449453332		418	PREDICTED: phosphoribulokinase, chloropl	1.0	0.787	0.921	0.0
255646270		407	unknown [Glycine max]	1.0	0.808	0.914	0.0
357484753		411	Phosphoribulokinase [Medicago truncatula	0.993	0.795	0.917	1e-180

>gi\|224071429\|ref\|XP_002303455.1\| predicted protein [Populus trichocarpa] gi\|222840887\|gb\|EEE78434.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/327 (93%), Positives = 320/327 (97%)

Query: 1   MRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANN 60
           MRRLTSVFGGAAEPP+GGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANN
Sbjct: 76  MRRLTSVFGGAAEPPRGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANN 135

Query: 61  FDLMYEQVKAMKDGVSVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDARVRELLDF 120
           FDLMYEQVKA+KDG +VEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYD RVR+LLDF
Sbjct: 136 FDLMYEQVKAIKDGTAVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDQRVRDLLDF 195

Query: 121 SIYLDISNEVKFAWKIQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLP 180
           SIYLDISNEVKFAWKIQRDM ERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLP
Sbjct: 196 SIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLP 255

Query: 181 TQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPCGRKLTCSYPGIKFSYGP 240
           TQLIPDDNEGKVLRV+LIMKEGV++FSPVYLFDEGS+I WIPCGRKLTCSYPGIKFSYGP
Sbjct: 256 TQLIPDDNEGKVLRVKLIMKEGVEFFSPVYLFDEGSSISWIPCGRKLTCSYPGIKFSYGP 315

Query: 241 DAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGL 300
           DAY+GHEVS+LEMDG+FDRLDELIYVESHLSN+STKFYGEVTQQMLKHADFPGSNNGTGL
Sbjct: 316 DAYYGHEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEVTQQMLKHADFPGSNNGTGL 375

Query: 301 FQTIVGLKIRDLYEQIITSKAAAPVEA 327
           FQTIVGLKIRDL+EQI+ S+A  PVEA
Sbjct: 376 FQTIVGLKIRDLFEQIVASRAKTPVEA 402

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224138316\|ref\|XP_002326572.1\| predicted protein [Populus trichocarpa] gi\|222833894\|gb\|EEE72371.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225470804\|ref\|XP_002263724.1\| PREDICTED: phosphoribulokinase, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255555933\|ref\|XP_002519002.1\| phosphoribulose kinase, putative [Ricinus communis] gi\|223541989\|gb\|EEF43535.1\| phosphoribulose kinase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|147859917\|emb\|CAN78901.1\| hypothetical protein VITISV_011191 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356495988\|ref\|XP_003516852.1\| PREDICTED: phosphoribulokinase, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|356531479\|ref\|XP_003534305.1\| PREDICTED: phosphoribulokinase, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|449453332\|ref\|XP_004144412.1\| PREDICTED: phosphoribulokinase, chloroplastic-like [Cucumis sativus] gi\|449500068\|ref\|XP_004160995.1\| PREDICTED: phosphoribulokinase, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255646270\|gb\|ACU23619.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|357484753\|ref\|XP_003612664.1\| Phosphoribulokinase [Medicago truncatula] gi\|355513999\|gb\|AES95622.1\| Phosphoribulokinase [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		329
TAIR\|locus:2195366		395	PRK "phosphoribulokinase" [Ara	1.0	0.832	0.911	3.1e-163
UNIPROTKB\|P0A8F4		213	udk "uridine kinase / cytidine	0.422	0.652	0.316	3.6e-18
TIGR_CMR\|SO_2617		212	SO_2617 "uridine kinase" [Shew	0.452	0.702	0.303	8.1e-16
DICTYBASE\|DDB_G0274559		243	udkB "uridine kinase" [Dictyos	0.440	0.596	0.308	8.9e-15
WB\|WBGene00008948		569	F19B6.1 [Caenorhabditis elegan	0.367	0.212	0.333	1.1e-14
UNIPROTKB\|Q9KT67		213	udk "Uridine kinase" [Vibrio c	0.437	0.676	0.293	2.5e-14
TIGR_CMR\|VC_1038		213	VC_1038 "uridine kinase" [Vibr	0.437	0.676	0.293	2.5e-14
TIGR_CMR\|CBU_0872		215	CBU_0872 "uridine kinase" [Cox	0.468	0.716	0.278	7.2e-14
TIGR_CMR\|CPS_1974		216	CPS_1974 "uridine kinase" [Col	0.458	0.699	0.282	1.6e-13
FB\|FBgn0263398		260	CG6364 [Drosophila melanogaste	0.398	0.503	0.303	2.3e-13

TAIR\|locus:2195366 PRK "phosphoribulokinase" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1589 (564.4 bits), Expect = 3.1e-163, P = 3.1e-163
 Identities = 300/329 (91%), Positives = 317/329 (96%)

Query:     1 MRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANN 60
             MRRLTSVFGGAA+PPKGGNPDSNTLISDTTTVICLDDYHSLDR GRKE+ VTALDPRAN+
Sbjct:    67 MRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKEQKVTALDPRAND 126

Query:    61 FDLMYEQVKAMKDGVSVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDARVRELLDF 120
             FDLMYEQVKA+K+G++VEKPIYNHVTGLLDPPELI+PPKILVIEGLHPM+D RVR+LLDF
Sbjct:   127 FDLMYEQVKALKNGIAVEKPIYNHVTGLLDPPELIQPPKILVIEGLHPMFDERVRDLLDF 186

Query:   121 SIYLDISNEVKFAWKIQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLP 180
             SIYLDISNEVKFAWKIQRDM ERGHSLESIKASIEARKPDFDA+IDPQKQYADAVIEVLP
Sbjct:   187 SIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFIDPQKQYADAVIEVLP 246

Query:   181 TQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPCGRKLTCSYPGIKFSYGP 240
             T LIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTI WIPCGRKLTCSYPGIKF+Y P
Sbjct:   247 TTLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFNYEP 306

Query:   241 DAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGL 300
             D+YF HEVS+LEMDG+FDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGL
Sbjct:   307 DSYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGL 366

Query:   301 FQTIVGLKIRDLYEQIITSKAAAPVEAKA 329
             FQTIVGLKIRDLYEQ+I +KA A  EAKA
Sbjct:   367 FQTIVGLKIRDLYEQLIANKATARAEAKA 395

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0005975 "carbohydrate metabolic process" evidence=IEA

GO:0008152 "metabolic process" evidence=IEA

GO:0008974 "phosphoribulokinase activity" evidence=IEA;ISS

GO:0009058 "biosynthetic process" evidence=ISS

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0016301 "kinase activity" evidence=IEA

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009535 "chloroplast thylakoid membrane" evidence=IDA

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0005515 "protein binding" evidence=IPI

GO:0009579 "thylakoid" evidence=IDA

GO:0009409 "response to cold" evidence=IEP;RCA

GO:0010319 "stromule" evidence=IDA

GO:0042742 "defense response to bacterium" evidence=IEP;RCA

GO:0016020 "membrane" evidence=IDA

GO:0048046 "apoplast" evidence=IDA

GO:0005829 "cytosol" evidence=RCA

GO:0000165 "MAPK cascade" evidence=RCA

GO:0006098 "pentose-phosphate shunt" evidence=RCA

GO:0006364 "rRNA processing" evidence=RCA

GO:0006612 "protein targeting to membrane" evidence=RCA

GO:0009595 "detection of biotic stimulus" evidence=RCA

GO:0009637 "response to blue light" evidence=RCA

GO:0009657 "plastid organization" evidence=RCA

GO:0009697 "salicylic acid biosynthetic process" evidence=RCA

GO:0009773 "photosynthetic electron transport in photosystem I" evidence=RCA

GO:0009814 "defense response, incompatible interaction" evidence=RCA

GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA

GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA

GO:0009902 "chloroplast relocation" evidence=RCA

GO:0010103 "stomatal complex morphogenesis" evidence=RCA

GO:0010114 "response to red light" evidence=RCA

GO:0010200 "response to chitin" evidence=RCA

GO:0010207 "photosystem II assembly" evidence=RCA

GO:0010218 "response to far red light" evidence=RCA

GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA

GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA

GO:0015979 "photosynthesis" evidence=RCA

GO:0019344 "cysteine biosynthetic process" evidence=RCA

GO:0019684 "photosynthesis, light reaction" evidence=RCA

GO:0031348 "negative regulation of defense response" evidence=RCA

GO:0035304 "regulation of protein dephosphorylation" evidence=RCA

GO:0043900 "regulation of multi-organism process" evidence=RCA

GO:0050832 "defense response to fungus" evidence=RCA

UNIPROTKB\|P0A8F4 udk "uridine kinase / cytidine kinase" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_2617 SO_2617 "uridine kinase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0274559 udkB "uridine kinase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

WB\|WBGene00008948 F19B6.1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KT67 udk "Uridine kinase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_1038 VC_1038 "uridine kinase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_0872 CBU_0872 "uridine kinase" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_1974 CPS_1974 "uridine kinase" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

FB\|FBgn0263398 CG6364 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P37101	KPPR_SYNY3	2, ., 7, ., 1, ., 1, 9	0.6574	0.9270	0.9186	N/A	no
P09559	KPPR_SPIOL	2, ., 7, ., 1, ., 1, 9	0.8660	0.9756	0.7985	N/A	no
P19824	KPPR_CHLRE	2, ., 7, ., 1, ., 1, 9	0.7661	0.9817	0.8613	N/A	no
P27774	KPPR_MESCR	2, ., 7, ., 1, ., 1, 9	0.9211	0.9635	0.7984	N/A	no
P25697	KPPR_ARATH	2, ., 7, ., 1, ., 1, 9	0.9118	1.0	0.8329	yes	no
P26302	KPPR_WHEAT	2, ., 7, ., 1, ., 1, 9	0.9143	0.9939	0.8094	N/A	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.7.1.19	0.979
3rd Layer	2.7.1	0.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		329
PLN02348		395	PLN02348, PLN02348, phosphoribulokinase	0.0
cd02026		273	cd02026, PRK, Phosphoribulokinase (PRK) is an enzy	1e-177
PRK07429		327	PRK07429, PRK07429, phosphoribulokinase; Provision	1e-156
pfam00485		197	pfam00485, PRK, Phosphoribulokinase / Uridine kina	9e-88
COG0572		218	COG0572, Udk, Uridine kinase [Nucleotide transport	9e-51
cd02023		198	cd02023, UMPK, Uridine monophosphate kinase (UMPK,	4e-31
PRK05480		209	PRK05480, PRK05480, uridine/cytidine kinase; Provi	2e-28
TIGR00235		207	TIGR00235, udk, uridine kinase	4e-28
PTZ00301		210	PTZ00301, PTZ00301, uridine kinase; Provisional	7e-11
cd02028		179	cd02028, UMPK_like, Uridine monophosphate kinase_l	2e-10
cd02029		277	cd02029, PRK_like, Phosphoribulokinase-like (PRK-l	2e-08
COG1072		283	COG1072, CoaA, Panthothenate kinase [Coenzyme meta	8e-07
PLN02318		656	PLN02318, PLN02318, phosphoribulokinase/uridine ki	1e-06
COG3954		289	COG3954, PrkB, Phosphoribulokinase [Energy product	2e-06
PRK05439		311	PRK05439, PRK05439, pantothenate kinase; Provision	2e-05
cd02025		220	cd02025, PanK, Pantothenate kinase (PanK) catalyze	9e-05
TIGR00554		290	TIGR00554, panK_bact, pantothenate kinase, bacteri	1e-04
PRK15453		290	PRK15453, PRK15453, phosphoribulokinase; Provision	2e-04
PRK06696		223	PRK06696, PRK06696, uridine kinase; Validated	0.001

>gnl\|CDD\|215198 PLN02348, PLN02348, phosphoribulokinase	Back alignment and domain information

 Score =  719 bits (1858), Expect = 0.0
 Identities = 298/329 (90%), Positives = 312/329 (94%)

Query: 1   MRRLTSVFGGAAEPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANN 60
           MRRLTSVFGGAA+PPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANN
Sbjct: 66  MRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANN 125

Query: 61  FDLMYEQVKAMKDGVSVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDARVRELLDF 120
           FDLMYEQVKA+K+G +VEKPIYNHVTGLLDPPELI+PPKILVIEGLHPMYD RVR+LLDF
Sbjct: 126 FDLMYEQVKALKEGKAVEKPIYNHVTGLLDPPELIEPPKILVIEGLHPMYDERVRDLLDF 185

Query: 121 SIYLDISNEVKFAWKIQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLP 180
           SIYLDIS++VKFAWKIQRDM ERGHSLESIKASIEARKPDFDAYIDPQKQYAD VIEVLP
Sbjct: 186 SIYLDISDDVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYIDPQKQYADVVIEVLP 245

Query: 181 TQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPCGRKLTCSYPGIKFSYGP 240
           TQLIPDDNEGKVLRVRLIMKEGVK F PVYLFDEGSTI WIPCGRKLTCSYPGIKF YGP
Sbjct: 246 TQLIPDDNEGKVLRVRLIMKEGVKNFDPVYLFDEGSTISWIPCGRKLTCSYPGIKFFYGP 305

Query: 241 DAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGL 300
           D YFGHEVS+LEMDG+FD+LDELIYVESHLSN STKFYGEVTQQMLKHADFPGSNNGTGL
Sbjct: 306 DTYFGHEVSVLEMDGQFDKLDELIYVESHLSNTSTKFYGEVTQQMLKHADFPGSNNGTGL 365

Query: 301 FQTIVGLKIRDLYEQIITSKAAAPVEAKA 329
           FQTIVGLKIRDLYE+I+  +  A  EA A
Sbjct: 366 FQTIVGLKIRDLYERIVAKRKVAAGEATA 394

Length = 395

>gnl\|CDD\|238984 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>gnl\|CDD\|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional	Back alignment and domain information

>gnl\|CDD\|201257 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family	Back alignment and domain information

>gnl\|CDD\|223645 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|238981 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>gnl\|CDD\|235492 PRK05480, PRK05480, uridine/cytidine kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|232890 TIGR00235, udk, uridine kinase	Back alignment and domain information

>gnl\|CDD\|140322 PTZ00301, PTZ00301, uridine kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|238986 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>gnl\|CDD\|238987 cd02029, PRK_like, Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>gnl\|CDD\|223998 COG1072, CoaA, Panthothenate kinase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|177952 PLN02318, PLN02318, phosphoribulokinase/uridine kinase	Back alignment and domain information

>gnl\|CDD\|226463 COG3954, PrkB, Phosphoribulokinase [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|235466 PRK05439, PRK05439, pantothenate kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|238983 cd02025, PanK, Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>gnl\|CDD\|200027 TIGR00554, panK_bact, pantothenate kinase, bacterial type	Back alignment and domain information

>gnl\|CDD\|237970 PRK15453, PRK15453, phosphoribulokinase; Provisional	Back alignment and domain information

>gnl\|CDD\|180660 PRK06696, PRK06696, uridine kinase; Validated	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		329
PLN02348		395	phosphoribulokinase	100.0
PRK07429		327	phosphoribulokinase; Provisional	100.0
cd02026		273	PRK Phosphoribulokinase (PRK) is an enzyme involve	100.0
cd02029		277	PRK_like Phosphoribulokinase-like (PRK-like) is a	100.0
PRK15453		290	phosphoribulokinase; Provisional	100.0
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	100.0
COG3954		289	PrkB Phosphoribulokinase [Energy production and co	100.0
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	100.0
PTZ00301		210	uridine kinase; Provisional	100.0
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	100.0
PLN02318		656	phosphoribulokinase/uridine kinase	99.97
PRK05439		311	pantothenate kinase; Provisional	99.97
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	99.97
PRK05480		209	uridine/cytidine kinase; Provisional	99.97
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	99.96
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	99.96
TIGR00235		207	udk uridine kinase. Model contains a number of lon	99.95
KOG4203		473	consensus Armadillo/beta-Catenin/plakoglobin [Sign	99.93
PRK06696		223	uridine kinase; Validated	99.93
PRK07667		193	uridine kinase; Provisional	99.91
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	99.91
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	99.9
COG1072		283	CoaA Panthothenate kinase [Coenzyme metabolism]	99.86
PRK06547		172	hypothetical protein; Provisional	99.81
PLN03046		460	D-glycerate 3-kinase; Provisional	99.79
PLN02796		347	D-glycerate 3-kinase	99.72
PRK08233		182	hypothetical protein; Provisional	99.7
cd02022		179	DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2	99.65
PF01121		180	CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th	99.63
PRK00081		194	coaE dephospho-CoA kinase; Reviewed	99.59
PRK14733		204	coaE dephospho-CoA kinase; Provisional	99.59
PRK14730		195	coaE dephospho-CoA kinase; Provisional	99.59
PRK14734		200	coaE dephospho-CoA kinase; Provisional	99.57
PLN02422		232	dephospho-CoA kinase	99.56
KOG3308		225	consensus Uncharacterized protein of the uridine k	99.54
PTZ00451		244	dephospho-CoA kinase; Provisional	99.54
PRK14732		196	coaE dephospho-CoA kinase; Provisional	99.54
KOG2702		323	consensus Predicted panthothenate kinase/uridine k	99.53
COG0237		201	CoaE Dephospho-CoA kinase [Coenzyme metabolism]	99.52
PRK14731		208	coaE dephospho-CoA kinase; Provisional	99.49
COG4240		300	Predicted kinase [General function prediction only	99.48
TIGR00152		188	dephospho-CoA kinase. This model produces scores i	99.46
KOG2878		282	consensus Predicted kinase [General function predi	99.46
PRK03333		395	coaE dephospho-CoA kinase/protein folding accessor	99.44
KOG3220		225	consensus Similar to bacterial dephospho-CoA kinas	99.34
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	99.24
PRK13477		512	bifunctional pantoate ligase/cytidylate kinase; Pr	99.15
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	99.09
PRK01184		184	hypothetical protein; Provisional	99.05
PRK06217		183	hypothetical protein; Validated	98.98
TIGR02173		171	cyt_kin_arch cytidylate kinase, putative. Proteins	98.94
PRK06762		166	hypothetical protein; Provisional	98.9
PRK08118		167	topology modulation protein; Reviewed	98.86
PRK04182		180	cytidylate kinase; Provisional	98.83
PRK07261		171	topology modulation protein; Provisional	98.76
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	98.72
PRK00023		225	cmk cytidylate kinase; Provisional	98.71
TIGR00017		217	cmk cytidylate kinase. This family consists of cyt	98.69
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	98.66
PRK05541		176	adenylylsulfate kinase; Provisional	98.65
PRK00625		173	shikimate kinase; Provisional	98.55
PRK08356		195	hypothetical protein; Provisional	98.51
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	98.49
PRK04040		188	adenylate kinase; Provisional	98.49
COG0283		222	Cmk Cytidylate kinase [Nucleotide transport and me	98.42
PRK13949		169	shikimate kinase; Provisional	98.42
PRK14528		186	adenylate kinase; Provisional	98.41
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	98.39
PRK00131		175	aroK shikimate kinase; Reviewed	98.36
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	98.35
PRK14737		186	gmk guanylate kinase; Provisional	98.33
PRK11860		661	bifunctional 3-phosphoshikimate 1-carboxyvinyltran	98.32
PRK14531		183	adenylate kinase; Provisional	98.3
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	98.28
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	98.22
PRK14530		215	adenylate kinase; Provisional	98.21
PRK05057		172	aroK shikimate kinase I; Reviewed	98.2
PRK03839		180	putative kinase; Provisional	98.17
PRK13946		184	shikimate kinase; Provisional	98.14
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	98.13
PRK03731		171	aroL shikimate kinase II; Reviewed	98.12
PRK13947		171	shikimate kinase; Provisional	98.12
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	98.08
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	98.07
PLN02200		234	adenylate kinase family protein	98.06
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	98.05
PRK08154		309	anaerobic benzoate catabolism transcriptional regu	98.01
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	98.0
PRK13808		333	adenylate kinase; Provisional	97.98
PHA02530		300	pseT polynucleotide kinase; Provisional	97.95
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	97.93
PRK00889		175	adenylylsulfate kinase; Provisional	97.92
PRK00279		215	adk adenylate kinase; Reviewed	97.91
PRK02496		184	adk adenylate kinase; Provisional	97.91
PRK03846		198	adenylylsulfate kinase; Provisional	97.89
TIGR01351		210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	97.86
PRK14527		191	adenylate kinase; Provisional	97.86
TIGR03575		340	selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti	97.84
PRK14532		188	adenylate kinase; Provisional	97.84
PRK12269		863	bifunctional cytidylate kinase/ribosomal protein S	97.79
PRK13948		182	shikimate kinase; Provisional	97.78
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	97.76
PRK00300		205	gmk guanylate kinase; Provisional	97.73
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	97.71
COG0703		172	AroK Shikimate kinase [Amino acid transport and me	97.68
PLN02199		303	shikimate kinase	97.66
PTZ00088		229	adenylate kinase 1; Provisional	97.64
TIGR00041		195	DTMP_kinase thymidylate kinase. Function: phosphor	97.63
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	97.6
smart00072		184	GuKc Guanylate kinase homologues. Active enzymes c	97.6
TIGR00455		184	apsK adenylylsulfate kinase (apsK). Important resi	97.59
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	97.59
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	97.59
COG3265		161	GntK Gluconate kinase [Carbohydrate transport and	97.58
PRK13951		488	bifunctional shikimate kinase/3-dehydroquinate syn	97.52
PRK09825		176	idnK D-gluconate kinase; Provisional	97.5
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	97.49
PRK00091		307	miaA tRNA delta(2)-isopentenylpyrophosphate transf	97.46
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	97.45
PRK00698		205	tmk thymidylate kinase; Validated	97.42
PRK13975		196	thymidylate kinase; Provisional	97.39
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	97.36
PRK14021		542	bifunctional shikimate kinase/3-dehydroquinate syn	97.33
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	97.32
KOG3354		191	consensus Gluconate kinase [Carbohydrate transport	97.32
PRK14526		211	adenylate kinase; Provisional	97.29
KOG3079		195	consensus Uridylate kinase/adenylate kinase [Nucle	97.21
PRK13973		213	thymidylate kinase; Provisional	97.16
PHA00729		226	NTP-binding motif containing protein	97.13
PF00625		183	Guanylate_kin: Guanylate kinase; InterPro: IPR0081	97.13
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	97.12
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	97.1
cd02030		219	NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO	97.08
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	97.07
cd01673		193	dNK Deoxyribonucleoside kinase (dNK) catalyzes the	97.05
PF01202		158	SKI: Shikimate kinase; InterPro: IPR000623 Shikima	97.02
PF00406		151	ADK: Adenylate kinase; InterPro: IPR000850 Adenyla	96.99
PRK05537		568	bifunctional sulfate adenylyltransferase subunit 1	96.98
PLN02674		244	adenylate kinase	96.97
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	96.88
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	96.87
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	96.85
PRK05416		288	glmZ(sRNA)-inactivating NTPase; Provisional	96.85
PLN02459		261	probable adenylate kinase	96.81
PF03668		284	ATP_bind_2: P-loop ATPase protein family; InterPro	96.8
PRK11545		163	gntK gluconate kinase 1; Provisional	96.8
PLN02842		505	nucleotide kinase	96.77
PRK14738		206	gmk guanylate kinase; Provisional	96.72
PRK14529		223	adenylate kinase; Provisional	96.61
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	96.48
COG4639		168	Predicted kinase [General function prediction only	96.41
PF01591		222	6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130	96.39
KOG3062		281	consensus RNA polymerase II elongator associated p	96.33
PF03308		266	ArgK: ArgK protein; InterPro: IPR005129 Bacterial	96.26
smart00382		148	AAA ATPases associated with a variety of cellular	96.2
cd03115		173	SRP The signal recognition particle (SRP) mediates	96.18
TIGR00174		287	miaA tRNA isopentenyltransferase (miaA). Catalyzes	96.12
PRK09435		332	membrane ATPase/protein kinase; Provisional	96.1
PLN02840		421	tRNA dimethylallyltransferase	96.05
PRK04220		301	2-phosphoglycerate kinase; Provisional	96.01
PF06414		199	Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e	96.0
COG0125		208	Tmk Thymidylate kinase [Nucleotide transport and m	95.96
TIGR00064		272	ftsY signal recognition particle-docking protein F	95.95
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	95.93
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	95.92
KOG1384		348	consensus tRNA delta(2)-isopentenylpyrophosphate t	95.91
PRK13974		212	thymidylate kinase; Provisional	95.91
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	95.85
PRK13768		253	GTPase; Provisional	95.83
PRK12338		319	hypothetical protein; Provisional	95.77
PRK13976		209	thymidylate kinase; Provisional	95.72
COG1855		604	ATPase (PilT family) [General function prediction	95.72
COG0529		197	CysC Adenylylsulfate kinase and related kinases [I	95.7
PRK10416		318	signal recognition particle-docking protein FtsY;	95.69
PF07931		174	CPT: Chloramphenicol phosphotransferase-like prote	95.68
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	95.65
PF13189		179	Cytidylate_kin2: Cytidylate kinase-like family; PD	95.64
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	95.59
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	95.56
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	95.53
COG1763		161	MobB Molybdopterin-guanine dinucleotide biosynthes	95.52
PRK14729		300	miaA tRNA delta(2)-isopentenylpyrophosphate transf	95.51
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	95.5
PRK06761		282	hypothetical protein; Provisional	95.5
PF02223		186	Thymidylate_kin: Thymidylate kinase; InterPro: IPR	95.5
PLN02165		334	adenylate isopentenyltransferase	95.5
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	95.47
PRK10867		433	signal recognition particle protein; Provisional	95.46
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	95.34
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	95.28
PRK14974		336	cell division protein FtsY; Provisional	95.26
PRK12339		197	2-phosphoglycerate kinase; Provisional	95.2
PRK14493		274	putative bifunctional molybdopterin-guanine dinucl	95.15
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	95.09
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	95.08
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	95.07
COG4618		580	ArpD ABC-type protease/lipase transport system, AT	95.0
PLN02748		468	tRNA dimethylallyltransferase	95.0
TIGR00101		199	ureG urease accessory protein UreG. This model rep	94.98
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	94.98
PRK04296		190	thymidine kinase; Provisional	94.97
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	94.94
TIGR00959		428	ffh signal recognition particle protein. This mode	94.92
PLN02772		398	guanylate kinase	94.92
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	94.91
PRK00771		437	signal recognition particle protein Srp54; Provisi	94.87
KOG1533		290	consensus Predicted GTPase [General function predi	94.87
PRK13185		270	chlL protochlorophyllide reductase iron-sulfur ATP	94.84
PF13173		128	AAA_14: AAA domain	94.81
TIGR00176		155	mobB molybdopterin-guanine dinucleotide biosynthes	94.8
COG4619		223	ABC-type uncharacterized transport system, ATPase	94.79
COG4172		534	ABC-type uncharacterized transport system, duplica	94.73
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	94.71
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	94.71
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	94.67
COG3709		192	Uncharacterized component of phosphonate metabolis	94.63
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	94.56
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	94.55
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	94.55
cd03114		148	ArgK-like The function of this protein family is u	94.54
cd03116		159	MobB Molybdenum is an essential trace element in t	94.51
COG0324		308	MiaA tRNA delta(2)-isopentenylpyrophosphate transf	94.45
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	94.41
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	94.41
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	94.39
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	94.32
cd02034		116	CooC The accessory protein CooC, which contains a	94.3
PTZ00322		664	6-phosphofructo-2-kinase/fructose-2,6-biphosphatas	94.23
COG1341		398	Predicted GTPase or GTP-binding protein [General f	94.16
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	94.16
PF00004		132	AAA: ATPase family associated with various cellula	94.1
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	94.07
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	94.04
COG4185		187	Uncharacterized protein conserved in bacteria [Fun	93.99
cd02117		212	NifH_like This family contains the NifH (iron prot	93.96
PRK13233		275	nifH nitrogenase reductase; Reviewed	93.94
KOG1534		273	consensus Putative transcription factor FET5 [Tran	93.87
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	93.86
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	93.85
TIGR02203		571	MsbA_lipidA lipid A export permease/ATP-binding pr	93.82
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	93.81
PF05729		166	NACHT: NACHT domain	93.79
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	93.79
TIGR01287		275	nifH nitrogenase iron protein. This model describe	93.76
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	93.72
COG1123		539	ATPase components of various ABC-type transport sy	93.69
PRK10463		290	hydrogenase nickel incorporation protein HypB; Pro	93.65
PRK07933		213	thymidylate kinase; Validated	93.64
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	93.62
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	93.44
PF13245		76	AAA_19: Part of AAA domain	93.4
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	93.38
COG0444		316	DppD ABC-type dipeptide/oligopeptide/nickel transp	93.35
COG3172		187	NadR Predicted ATPase/kinase involved in NAD metab	93.34
PF01935		229	DUF87: Domain of unknown function DUF87; InterPro:	93.29
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	93.28
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	93.28
cd01394		218	radB RadB. The archaeal protein radB shares simila	93.25
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	93.16
PRK13232		273	nifH nitrogenase reductase; Reviewed	93.13
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	93.09
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	93.09
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	93.06
PLN02924		220	thymidylate kinase	93.05
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	92.98
PRK11022		326	dppD dipeptide transporter ATP-binding subunit; Pr	92.98
PRK14490		369	putative bifunctional molybdopterin-guanine dinucl	92.93
PRK11300		255	livG leucine/isoleucine/valine transporter ATP-bin	92.91
PRK14495		452	putative molybdopterin-guanine dinucleotide biosyn	92.9
PRK13235		274	nifH nitrogenase reductase; Reviewed	92.84
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	92.82
cd02040		270	NifH NifH gene encodes component II (iron protein)	92.82
TIGR01188		302	drrA daunorubicin resistance ABC transporter ATP-b	92.82
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	92.81
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	92.81
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	92.79
PRK12337		475	2-phosphoglycerate kinase; Provisional	92.76
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	92.71
PRK13851		344	type IV secretion system protein VirB11; Provision	92.71
PRK08099		399	bifunctional DNA-binding transcriptional repressor	92.7
PRK01077		451	cobyrinic acid a,c-diamide synthase; Validated	92.65
KOG0635		207	consensus Adenosine 5'-phosphosulfate kinase [Inor	92.62
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	92.6
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	92.59
PF12846		304	AAA_10: AAA-like domain	92.59
COG3640		255	CooC CO dehydrogenase maturation factor [Cell divi	92.58
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	92.57
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	92.57
PRK14494		229	putative molybdopterin-guanine dinucleotide biosyn	92.56
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	92.49
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	92.46
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	92.44
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	92.42
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	92.41
PHA03132		580	thymidine kinase; Provisional	92.4
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	92.4
TIGR03410		230	urea_trans_UrtE urea ABC transporter, ATP-binding	92.35
KOG3877		393	consensus NADH:ubiquinone oxidoreductase, NDUFA10/	92.3
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	92.3
PRK13764		602	ATPase; Provisional	92.28
PRK13538		204	cytochrome c biogenesis protein CcmA; Provisional	92.26
COG2019		189	AdkA Archaeal adenylate kinase [Nucleotide transpo	92.26
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	92.26
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	92.23
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	92.22
TIGR02237		209	recomb_radB DNA repair and recombination protein R	92.21
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	92.19
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	92.14
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	92.14
TIGR03797		686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	92.13
PRK09473		330	oppD oligopeptide transporter ATP-binding componen	92.1
cd03269		210	ABC_putative_ATPase This subfamily is involved in	92.1
PHA02575		227	1 deoxynucleoside monophosphate kinase; Provisiona	92.09
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	92.09
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	92.08
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	92.07
COG0411		250	LivG ABC-type branched-chain amino acid transport	92.05
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	92.05
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	92.04
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	92.03
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	92.02
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	92.0
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	91.99
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	91.98
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	91.97
PRK11308		327	dppF dipeptide transporter ATP-binding subunit; Pr	91.95
PRK13537		306	nodulation ABC transporter NodI; Provisional	91.92
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	91.91
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	91.9
COG1127		263	Ttg2A ABC-type transport system involved in resist	91.9
PF13555		62	AAA_29: P-loop containing region of AAA domain	91.84
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	91.83
cd02032		267	Bchl_like This family of proteins contains bchL an	91.82
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	91.82
TIGR03796		710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	91.81
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	91.79
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	91.77
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	91.76
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	91.75
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	91.75
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	91.74
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	91.74
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	91.73
cd03234		226	ABCG_White The White subfamily represents ABC tran	91.73
COG4598		256	HisP ABC-type histidine transport system, ATPase c	91.72
cd03298		211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	91.69
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	91.68
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	91.66
PRK14267		253	phosphate ABC transporter ATP-binding protein; Pro	91.65
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	91.64
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	91.64
COG4148		352	ModC ABC-type molybdate transport system, ATPase c	91.59
PRK15455		644	PrkA family serine protein kinase; Provisional	91.59
PRK10818		270	cell division inhibitor MinD; Provisional	91.59
PRK13833		323	conjugal transfer protein TrbB; Provisional	91.58
TIGR02204		576	MsbA_rel ABC transporter, permease/ATP-binding pro	91.58
PF02367		123	UPF0079: Uncharacterised P-loop hydrolase UPF0079;	91.58
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	91.56
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	91.55
COG2074		299	2-phosphoglycerate kinase [Carbohydrate transport	91.53
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	91.51
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	91.5
PRK03695		248	vitamin B12-transporter ATPase; Provisional	91.48
PRK14249		251	phosphate ABC transporter ATP-binding protein; Pro	91.48
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	91.47
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	91.44
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	91.4
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	91.4
PF01745		233	IPT: Isopentenyl transferase; InterPro: IPR002648	91.39
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	91.35
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	91.34
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	91.34
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	91.33
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	91.32
TIGR01277		213	thiQ thiamine ABC transporter, ATP-binding protein	91.32
PRK09354		349	recA recombinase A; Provisional	91.32
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	91.31
cd03252		237	ABCC_Hemolysin The ABC-transporter hemolysin B is	91.31
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	91.3
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	91.28
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	91.27
cd03246		173	ABCC_Protease_Secretion This family represents the	91.27
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	91.26
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	91.26
cd03251		234	ABCC_MsbA MsbA is an essential ABC transporter, cl	91.25
COG4555		245	NatA ABC-type Na+ transport system, ATPase compone	91.24
TIGR01288		303	nodI ATP-binding ABC transporter family nodulation	91.22
PTZ00035		337	Rad51 protein; Provisional	91.22
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	91.2
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	91.2
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	91.18
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	91.17
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	91.16
TIGR03005		252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	91.15
PRK10908		222	cell division protein FtsE; Provisional	91.14
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	91.14
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	91.14
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	91.13
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	91.11
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	91.1
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	91.1
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	91.08
TIGR00972		247	3a0107s01c2 phosphate ABC transporter, ATP-binding	91.06
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	91.05
CHL00072		290	chlL photochlorophyllide reductase subunit L	91.05
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	91.04
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	91.04
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	91.04
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	91.04
TIGR01193		708	bacteriocin_ABC ABC-type bacteriocin transporter.	91.04
PRK10771		232	thiQ thiamine transporter ATP-binding subunit; Pro	91.03
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	91.01
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	90.96
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	90.96
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	90.96
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	90.94
PRK14251		251	phosphate ABC transporter ATP-binding protein; Pro	90.89
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	90.88
PRK10646		153	ADP-binding protein; Provisional	90.86
cd03112		158	CobW_like The function of this protein family is u	90.85
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	90.85
cd03253		236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	90.85
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	90.84
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	90.84
KOG0780		483	consensus Signal recognition particle, subunit Srp	90.83
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	90.82
PRK09493		240	glnQ glutamine ABC transporter ATP-binding protein	90.82
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	90.81
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	90.81
COG1131		293	CcmA ABC-type multidrug transport system, ATPase c	90.8
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	90.79
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	90.78
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	90.76
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	90.76
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	90.76
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	90.74
TIGR01526		325	nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr	90.72
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	90.69
PRK13234		295	nifH nitrogenase reductase; Reviewed	90.68
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	90.68
TIGR01281		268	DPOR_bchL light-independent protochlorophyllide re	90.68
COG1135		339	AbcC ABC-type metal ion transport system, ATPase c	90.67
PRK11614		237	livF leucine/isoleucine/valine transporter ATP-bin	90.66
PRK15093		330	antimicrobial peptide ABC transporter ATP-binding	90.66
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	90.66
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	90.65
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	90.65
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	90.65
COG2274		709	SunT ABC-type bacteriocin/lantibiotic exporters, c	90.64
PRK13548		258	hmuV hemin importer ATP-binding subunit; Provision	90.64
COG0802		149	Predicted ATPase or kinase [General function predi	90.63
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	90.59
PRK14256		252	phosphate ABC transporter ATP-binding protein; Pro	90.59
TIGR02533		486	type_II_gspE general secretory pathway protein E.	90.59
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	90.58
cd01918		149	HprK_C HprK/P, the bifunctional histidine-containi	90.56
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	90.54
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	90.51
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	90.51
PRK14253		249	phosphate ABC transporter ATP-binding protein; Pro	90.51
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	90.5
PLN03187		344	meiotic recombination protein DMC1 homolog; Provis	90.49
KOG4235		244	consensus Mitochondrial thymidine kinase 2/deoxygu	90.49
cd03215		182	ABC_Carb_Monos_II This family represents domain II	90.46
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	90.41
cd03216		163	ABC_Carb_Monos_I This family represents the domain	90.39
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	90.39
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	90.36
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	90.33
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	90.33
PRK13230		279	nitrogenase reductase-like protein; Reviewed	90.31
PRK14270		251	phosphate ABC transporter ATP-binding protein; Pro	90.29
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	90.27
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	90.27
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	90.26
TIGR03522		301	GldA_ABC_ATP gliding motility-associated ABC trans	90.26
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	90.25
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	90.23
PRK14244		251	phosphate ABC transporter ATP-binding protein; Pro	90.22
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	90.21
PF00005		137	ABC_tran: ABC transporter This structure is on hol	90.2
PRK13547		272	hmuV hemin importer ATP-binding subunit; Provision	90.19
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	90.18
TIGR03375		694	type_I_sec_LssB type I secretion system ATPase, Ls	90.18
TIGR02016		296	BchX chlorophyllide reductase iron protein subunit	90.17
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	90.16
CHL00175		281	minD septum-site determining protein; Validated	90.16
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	90.15
PRK13231		264	nitrogenase reductase-like protein; Reviewed	90.14
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	90.13
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	90.12
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	90.12
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	90.11
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	90.11
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	90.1
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	90.1
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	90.08
TIGR00958		711	3a01208 Conjugate Transporter-2 (CT2) Family prote	90.02
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	90.02
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	90.01

>PLN02348 phosphoribulokinase	Back alignment and domain information

Probab=100.00  E-value=3.5e-102  Score=758.68  Aligned_cols=327  Identities=83%  Similarity=1.290  Sum_probs=314.8

Q ss_pred             cEEEEEEcCCCCCCCc-HHHHHHhccc-----------------CCeEEEEccceecCCchhhhhhccCCCCccccchhH
Q 048274            2 RRLTSVFGGAAEPPKG-GNPDSNTLIS-----------------DTTTVICLDDYHSLDRTGRKEKGVTALDPRANNFDL   63 (329)
Q Consensus         2 r~IIgI~GgsgSGKST-a~~la~~L~~-----------------~~v~vI~~Ddyhr~dr~~~~~~~~~~~~Pea~d~d~   63 (329)
                      +.||||+|++|||||| ++.|++.|+.                 +.+++||+||||+++++++++.+.++++|+++|+|+
T Consensus        49 p~IIGIaG~SGSGKSTfA~~L~~~Lg~~~~~~~~~~~~~~~l~~~~~~VI~lDDYh~~dr~~r~~~g~t~ldP~a~dfDl  128 (395)
T PLN02348         49 TVVIGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRTGRKEKGVTALDPRANNFDL  128 (395)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHhhccCCCccccccccccccCceEEEEcccccCCChhhHhhcCCccCCcccccHHH
Confidence            4699999999999999 9999999963                 468999999999999998888899999999999999


Q ss_pred             HHHHHHHHhcCCceeccccccccCCCCCCcccCCCcEEEEEccccccchhhhccCCEEEEEECCHHHHHHHhhccccccc
Q 048274           64 MYEQVKAMKDGVSVEKPIYNHVTGLLDPPELIKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMTER  143 (329)
Q Consensus        64 L~~~L~~L~~G~~i~~P~Yd~~tg~~~~~~~i~p~~vlIvEGl~~l~~~~lr~~~D~~IyVD~~~evrl~rkI~RD~~eR  143 (329)
                      |.++|.+|++|+++.+|+|||.+|++++++.++|.+||||||+|+++++.+++++|++||||++++++++||++||+++|
T Consensus       129 l~~~L~~Lk~G~~I~~PiYDh~tg~~~~~e~I~p~~VVIVEGlh~L~~e~lr~l~D~~IyVd~~~dvrl~RRI~RD~~eR  208 (395)
T PLN02348        129 MYEQVKALKEGKAVEKPIYNHVTGLLDPPELIEPPKILVIEGLHPMYDERVRDLLDFSIYLDISDDVKFAWKIQRDMAER  208 (395)
T ss_pred             HHHHHHHHHCCCcEEeeccccCCCCcCCcEEcCCCcEEEEechhhccCccccccCcEEEEEECCHHHHHHHHHHhhHhhc
Confidence            99999999999999999999999999999999999999999999999889999999999999999999999999999999


Q ss_pred             CCchhhHHHHHhhcccchhhhccccCCCCcEEEecCCCCCCCCCCCCceEEEEEEEecCCCCCCccccccCCCccccccc
Q 048274          144 GHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTIEWIPC  223 (329)
Q Consensus       144 G~s~E~V~~~i~~r~pd~~~yI~Pqk~~ADiVI~~~p~~~~p~~~~~~~l~~r~~~~~~~~~~~~~~l~~~~~~~~~~~~  223 (329)
                      |+|.|+|.++|++|+|+|.+||.||+.+||+||+.+|++++|.++++++|||||+||+++++|||+||||+||+|+|+||
T Consensus       209 G~S~EeV~~~i~ar~pd~~~yI~pqk~~ADiVI~v~p~~l~~~~~~~~~l~vrli~~~~~~~~~~~~l~d~~~~~~~~~~  288 (395)
T PLN02348        209 GHSLESIKASIEARKPDFDAYIDPQKQYADVVIEVLPTQLIPDDNEGKVLRVRLIMKEGVKNFDPVYLFDEGSTISWIPC  288 (395)
T ss_pred             CCCHHHHHHHHHhcCcchhhhcccccccCCEEEEecCCcCCCCCCCCceEEEEEEecCCCCCCCcceeeccCCccccccc
Confidence            99999999999999999999999999999999999999999977888999999999999999999999999999999999


Q ss_pred             CCcccccCCCeeEEecCCccCCceeeEEEEcCCCCChhHHHHHHHhhccccccchhhHHHHHHhccCCCCCCChhHHHHH
Q 048274          224 GRKLTCSYPGIKFSYGPDAYFGHEVSILEMDGKFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGLFQT  303 (329)
Q Consensus       224 ~~~~~~~~~~~~~~~~~~~~~g~~~~~l~~dg~~~~~~e~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~  303 (329)
                      |++|+||||||+|.|++|+|||++|+||||||+|++||||||||+||+||||||||||||||+||+++|||+|||||||+
T Consensus       289 ~~~~~~~~~~~~~~~~~d~~~g~~v~~l~~dg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  368 (395)
T PLN02348        289 GRKLTCSYPGIKFFYGPDTYFGHEVSVLEMDGQFDKLDELIYVESHLSNTSTKFYGEVTQQMLKHADFPGSNNGTGLFQT  368 (395)
T ss_pred             cccccCCCCCeEEEeeccccCCeeeeEEEecCcccchhHHHHHHHHhccCCcchhHHHHHHHHhcCCCCCCCCCccHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhhcccCcccc
Q 048274          304 IVGLKIRDLYEQIITSKAAAPVEAK  328 (329)
Q Consensus       304 ~~~~~~~~~~~~~~~~~~~~~~~~~  328 (329)
                      |+|||||++||++|++.+++++.+.
T Consensus       369 ~~~~~~~~~~~~~~~~~~~~~~~~~  393 (395)
T PLN02348        369 IVGLKIRDLYERIVAKRKVAAGEAT  393 (395)
T ss_pred             HHHHHHHHHHHHHhccccccccccc
Confidence            9999999999999998776666554

>PRK07429 phosphoribulokinase; Provisional	Back alignment and domain information

>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>PRK15453 phosphoribulokinase; Provisional	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG3954 PrkB Phosphoribulokinase [Energy production and conversion]	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>PLN02318 phosphoribulokinase/uridine kinase	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>KOG4203 consensus Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism]	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>PLN03046 D-glycerate 3-kinase; Provisional	Back alignment and domain information

>PLN02796 D-glycerate 3-kinase	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2	Back alignment and domain information

>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2	Back alignment and domain information

>PRK00081 coaE dephospho-CoA kinase; Reviewed	Back alignment and domain information

>PRK14733 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>PRK14730 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>PRK14734 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>PLN02422 dephospho-CoA kinase	Back alignment and domain information

>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism]	Back alignment and domain information

>PTZ00451 dephospho-CoA kinase; Provisional	Back alignment and domain information

>PRK14732 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism]	Back alignment and domain information

>PRK14731 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>COG4240 Predicted kinase [General function prediction only]	Back alignment and domain information

>TIGR00152 dephospho-CoA kinase	Back alignment and domain information

>KOG2878 consensus Predicted kinase [General function prediction only]	Back alignment and domain information

>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional	Back alignment and domain information

>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism]	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PRK01184 hypothetical protein; Provisional	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>TIGR02173 cyt_kin_arch cytidylate kinase, putative	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PRK04182 cytidylate kinase; Provisional	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK00023 cmk cytidylate kinase; Provisional	Back alignment and domain information

>TIGR00017 cmk cytidylate kinase	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>PRK08356 hypothetical protein; Provisional	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>PRK14528 adenylate kinase; Provisional	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>PRK05057 aroK shikimate kinase I; Reviewed	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>PRK13946 shikimate kinase; Provisional	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>PRK03731 aroL shikimate kinase II; Reviewed	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>PRK13808 adenylate kinase; Provisional	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>PRK00279 adk adenylate kinase; Reviewed	Back alignment and domain information

>PRK02496 adk adenylate kinase; Provisional	Back alignment and domain information

>PRK03846 adenylylsulfate kinase; Provisional	Back alignment and domain information

>TIGR01351 adk adenylate kinases	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional	Back alignment and domain information

>PRK13948 shikimate kinase; Provisional	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02199 shikimate kinase	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>TIGR00041 DTMP_kinase thymidylate kinase	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>smart00072 GuKc Guanylate kinase homologues	Back alignment and domain information

>TIGR00455 apsK adenylylsulfate kinase (apsK)	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional	Back alignment and domain information

>PRK09825 idnK D-gluconate kinase; Provisional	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>PRK00698 tmk thymidylate kinase; Validated	Back alignment and domain information

>PRK13975 thymidylate kinase; Provisional	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK14526 adenylate kinase; Provisional	Back alignment and domain information

>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK13973 thymidylate kinase; Provisional	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK)	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs)	Back alignment and domain information

>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2	Back alignment and domain information

>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells	Back alignment and domain information

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated	Back alignment and domain information

>PLN02674 adenylate kinase	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional	Back alignment and domain information

>PLN02459 probable adenylate kinase	Back alignment and domain information

>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins	Back alignment and domain information

>PRK11545 gntK gluconate kinase 1; Provisional	Back alignment and domain information

>PLN02842 nucleotide kinase	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>PRK14529 adenylate kinase; Provisional	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>COG4639 Predicted kinase [General function prediction only]	Back alignment and domain information

>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2	Back alignment and domain information

>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only]	Back alignment and domain information

>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>TIGR00174 miaA tRNA isopentenyltransferase (miaA)	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>PLN02840 tRNA dimethylallyltransferase	Back alignment and domain information

>PRK04220 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []	Back alignment and domain information

>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK13974 thymidylate kinase; Provisional	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>PRK12338 hypothetical protein; Provisional	Back alignment and domain information

>PRK13976 thymidylate kinase; Provisional	Back alignment and domain information

>COG1855 ATPase (PilT family) [General function prediction only]	Back alignment and domain information

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]	Back alignment and domain information

>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK06761 hypothetical protein; Provisional	Back alignment and domain information

>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2	Back alignment and domain information

>PLN02165 adenylate isopentenyltransferase	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK12339 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]	Back alignment and domain information

>PLN02748 tRNA dimethylallyltransferase	Back alignment and domain information

>TIGR00101 ureG urease accessory protein UreG	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>KOG1533 consensus Predicted GTPase [General function prediction only]	Back alignment and domain information

>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes	Back alignment and domain information

>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional	Back alignment and domain information

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>COG4185 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase	Back alignment and domain information

>PRK13233 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>KOG1534 consensus Putative transcription factor FET5 [Transcription]	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>TIGR01287 nifH nitrogenase iron protein	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional	Back alignment and domain information

>PRK07933 thymidylate kinase; Validated	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism]	Back alignment and domain information

>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK13232 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>PLN02924 thymidylate kinase	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional	Back alignment and domain information

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional	Back alignment and domain information

>PRK13235 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase	Back alignment and domain information

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>PRK12337 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional	Back alignment and domain information

>PRK01077 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>PHA03132 thymidine kinase; Provisional	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE	Back alignment and domain information

>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion]	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13537 nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02032 Bchl_like This family of proteins contains bchL and chlL	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>PRK10818 cell division inhibitor MinD; Provisional	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>PRK03695 vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid []	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>PTZ00035 Rad51 protein; Provisional	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>CHL00072 chlL photochlorophyllide reductase subunit L	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter	Back alignment and domain information

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10646 ADP-binding protein; Provisional	Back alignment and domain information

>cd03112 CobW_like The function of this protein family is unkown	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>PRK13234 nifH nitrogenase reductase; Reviewed	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein	Back alignment and domain information

>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>COG0802 Predicted ATPase or kinase [General function prediction only]	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN03187 meiotic recombination protein DMC1 homolog; Provisional	Back alignment and domain information

>KOG4235 consensus Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13230 nitrogenase reductase-like protein; Reviewed	Back alignment and domain information

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family	Back alignment and domain information

>TIGR02016 BchX chlorophyllide reductase iron protein subunit X	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>CHL00175 minD septum-site determining protein; Validated	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK13231 nitrogenase reductase-like protein; Reviewed	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		329
3asy_A		211	Ligand-Free Structure Of Uridine Kinase From Thermu		1e-13
1udw_A		252	Crystal Structure Of Human Uridine-cytidine Kinase		8e-12
1xrj_A		261	Rapid Structure Determination Of Human Uridine-Cyti		9e-12
2jeo_A		245	Crystal Structure Of Human Uridine-Cytidine Kinase		2e-11

>pdb|3ASY|A Chain A, Ligand-Free Structure Of Uridine Kinase From Thermus Thermophilus Hb8 Length = 211

Back alignment and structure

Iteration: 1

Score = 73.9 bits (180), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 37/123 (30%), Positives = 71/123 (57%), Gaps = 2/123 (1%) Query: 56 PRANNFDLMYEQVKAMKDGVSVEKPIYNHVTGLLDPPEL-IKPPKILVIEGLHPMYDARV 114 P A + L E +A+ G+ VE P+Y+ P ++P ++++EG+ +Y + Sbjct: 62 PDAFDLALYLEHAQALLRGLPVEMPVYDFRAYTRSPRRTPVRPAPVVILEGILVLYPKEL 121 Query: 115 RELLDFSIYLDISNEVKFAWKIQRDMTERGHSLESIKAS-IEARKPDFDAYIDPQKQYAD 173 R+L+D +++D + +F +++RD+ ERG SLE + A +E KP +++P K+YAD Sbjct: 122 RDLMDLKVFVDADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYAD 181 Query: 174 AVI 176 ++ Sbjct: 182 VIV 184

PyMOL of 3asy

>pdb|1UDW|A Chain A, Crystal Structure Of Human Uridine-cytidine Kinase 2 Complexed With A Feedback-inhibitor, Ctp Length = 252

Back alignment and structure

>pdb|1XRJ|A Chain A, Rapid Structure Determination Of Human Uridine-Cytidine Kinase 2 Using A Conventional Laboratory X-Ray Source And A Single Samarium Derivative Length = 261

Back alignment and structure

>pdb|2JEO|A Chain A, Crystal Structure Of Human Uridine-Cytidine Kinase 1 Length = 245

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		329
3asz_A		211	Uridine kinase; cytidine phosphorylation, transfer	7e-56
1a7j_A		290	Phosphoribulokinase; transferase, calvin cycle; 2.	1e-53
1uj2_A		252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	6e-50
2jeo_A		245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	8e-50
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	4e-31
3aez_A		312	Pantothenate kinase; transferase, homodimer, COA b	3e-27
2qt1_A		207	Nicotinamide riboside kinase 1; non-protein kinase	2e-22
3c8u_A		208	Fructokinase; YP_612366.1, putative fructose trans	5e-22
1sq5_A		308	Pantothenate kinase; P-loop, transferase; HET: PAU	5e-15
3tqc_A		321	Pantothenate kinase; biosynthesis of cofactors, pr	2e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-07

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211	Back alignment and structure

 Score =  179 bits (457), Expect = 7e-56
 Identities = 42/153 (27%), Positives = 83/153 (54%), Gaps = 4/153 (2%)

Query: 28  DTTTVICLDDYH-SLDRTGRKEKG-VTALDPRANNFDLMYEQVKAMKDGVSVEKPIYNHV 85
           +   ++ +D Y+  L     +E+  V    P A +  L  E  +A+  G+ VE P+Y+  
Sbjct: 32  ERVALLPMDHYYKDLGHLPLEERLRVNYDHPDAFDLALYLEHAQALLRGLPVEMPVYDFR 91

Query: 86  TGLLDPPEL-IKPPKILVIEGLHPMYDARVRELLDFSIYLDISNEVKFAWKIQRDMTERG 144
                P    ++P  ++++EG+  +Y   +R+L+D  +++D   + +F  +++RD+ ERG
Sbjct: 92  AYTRSPRRTPVRPAPVVILEGILVLYPKELRDLMDLKVFVDADADERFIRRLKRDVLERG 151

Query: 145 HSLESIKAS-IEARKPDFDAYIDPQKQYADAVI 176
            SLE + A  +E  KP    +++P K+YAD ++
Sbjct: 152 RSLEGVVAQYLEQVKPMHLHFVEPTKRYADVIV 184

PyMOL of 3asz

>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Length = 290	Back alignment and structure

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Length = 252	Back alignment and structure

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Length = 245	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201	Back alignment and structure

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Length = 312	Back alignment and structure

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207	Back alignment and structure

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208	Back alignment and structure

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Length = 308	Back alignment and structure

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Length = 321	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		329
1a7j_A		290	Phosphoribulokinase; transferase, calvin cycle; 2.	100.0
3tqc_A		321	Pantothenate kinase; biosynthesis of cofactors, pr	99.95
1sq5_A		308	Pantothenate kinase; P-loop, transferase; HET: PAU	99.91
1uj2_A		252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	99.91
1odf_A		290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	99.9
3c8u_A		208	Fructokinase; YP_612366.1, putative fructose trans	99.88
2ga8_A		359	Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn	99.88
3asz_A		211	Uridine kinase; cytidine phosphorylation, transfer	99.86
3aez_A		312	Pantothenate kinase; transferase, homodimer, COA b	99.86
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	99.82
2jeo_A		245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	99.82
4i1u_A		210	Dephospho-COA kinase; structural genomics, niaid,	99.65
2qt1_A		207	Nicotinamide riboside kinase 1; non-protein kinase	99.58
2f6r_A		281	COA synthase, bifunctional coenzyme A synthase; 18	99.54
2grj_A		192	Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp	99.51
1jjv_A		206	Dephospho-COA kinase; P-loop nucleotide-binding fo	99.45
3ake_A		208	Cytidylate kinase; CMP kinase, CMP complex, open c	99.39
3d3q_A		340	TRNA delta(2)-isopentenylpyrophosphate transferase	99.38
1vht_A		218	Dephospho-COA kinase; structural genomics, transfe	99.32
1uf9_A		203	TT1252 protein; P-loop, nucleotide binding domain,	99.31
2if2_A		204	Dephospho-COA kinase; alpha-beta protein, structur	99.3
1cke_A		227	CK, MSSA, protein (cytidine monophosphate kinase);	99.19
1q3t_A		236	Cytidylate kinase; nucleotide monophosphate kinase	99.18
3lw7_A		179	Adenylate kinase related protein (ADKA-like); AMP,	99.1
2h92_A		219	Cytidylate kinase; rossmann fold, transferase; HET	98.99
3r20_A		233	Cytidylate kinase; structural genomics, seattle st	98.98
4e22_A		252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	98.93
1qf9_A		194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	98.87
1zuh_A		168	Shikimate kinase; alpha-beta protein, transferase;	98.83
3t61_A		202	Gluconokinase; PSI-biology, structural genomics, p	98.83
1tev_A		196	UMP-CMP kinase; ploop, NMP binding region, LID reg	98.81
2bwj_A		199	Adenylate kinase 5; phosphoryl transfer reaction,	98.8
2pt5_A		168	Shikimate kinase, SK; aromatic amino acid biosynth	98.79
1ukz_A		203	Uridylate kinase; transferase; HET: ADP AMP; 1.90A	98.79
2iyv_A		184	Shikimate kinase, SK; transferase, aromatic amino	98.75
3trf_A		185	Shikimate kinase, SK; amino acid biosynthesis, tra	98.69
1e6c_A		173	Shikimate kinase; phosphoryl transfer, ADP, shikim	98.64
4eun_A		200	Thermoresistant glucokinase; putative sugar kinase	98.59
3vaa_A		199	Shikimate kinase, SK; structural genomics, center	98.57
2pbr_A		195	DTMP kinase, thymidylate kinase; transferase, nucl	98.54
3kb2_A		173	SPBC2 prophage-derived uncharacterized protein YOR	98.54
3fb4_A		216	Adenylate kinase; psychrophIle, phosphotransferase	98.53
1kht_A		192	Adenylate kinase; phosphotransferase, signaling pr	98.52
1kag_A		173	SKI, shikimate kinase I; transferase, structural g	98.51
2j41_A		207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	98.5
1knq_A		175	Gluconate kinase; ALFA/beta structure, transferase	98.48
2vp4_A		230	Deoxynucleoside kinase; ATP-binding, DNA synthesis	98.48
3fdi_A		201	Uncharacterized protein; cytidylate kinase like pr	98.48
1nks_A		194	Adenylate kinase; thermophilic, transferase; HET:	98.46
3tr0_A		205	Guanylate kinase, GMP kinase; purines, pyrimidines	98.45
3dl0_A		216	Adenylate kinase; phosphotransferase, zinc coordin	98.44
3nwj_A		250	ATSK2; P loop, shikimate, nucleoside monophosphate	98.43
1y63_A		184	LMAJ004144AAA protein; structural genomics, protei	98.43
2cdn_A		201	Adenylate kinase; phosphoryl transfer, associative	98.42
2z0h_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	98.41
1via_A		175	Shikimate kinase; structural genomics, transferase	98.4
2c95_A		196	Adenylate kinase 1; transferase, AP4A, nucleotide	98.4
3iij_A		180	Coilin-interacting nuclear ATPase protein; alpha a	98.37
2jaq_A		205	Deoxyguanosine kinase; transferase, deoxyribonucle	98.36
3hdt_A		223	Putative kinase; structura genomics, PSI-2, protei	98.32
3tlx_A		243	Adenylate kinase 2; structural genomics, structura	98.31
2plr_A		213	DTMP kinase, probable thymidylate kinase; TMP-bind	98.25
3a4m_A		260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	98.23
1qhx_A		178	CPT, protein (chloramphenicol phosphotransferase);	98.19
2pez_A		179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	98.19
2qor_A		204	Guanylate kinase; phosphotransferase, purine metab	98.17
3cm0_A		186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	98.16
2rhm_A		193	Putative kinase; P-loop containing nucleoside trip	98.14
1zd8_A		227	GTP:AMP phosphotransferase mitochondrial; ATP:AMP	98.11
1ly1_A		181	Polynucleotide kinase; PNK, phosphatase, transfera	98.09
2wwf_A		212	Thymidilate kinase, putative; transferase, malaria	98.09
3a00_A		186	Guanylate kinase, GMP kinase; domain movement, dim	98.07
2ze6_A		253	Isopentenyl transferase; crown GALL tumor, cytokin	98.04
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	98.03
1zak_A		222	Adenylate kinase; ATP:AMP-phosphotransferase, tran	98.03
3lnc_A		231	Guanylate kinase, GMP kinase; ALS collaborative cr	97.98
2xb4_A		223	Adenylate kinase; ATP-binding, nucleotide-binding,	97.96
1e4v_A		214	Adenylate kinase; transferase(phosphotransferase);	97.96
1aky_A		220	Adenylate kinase; ATP:AMP phosphotransferase, myok	97.95
3umf_A		217	Adenylate kinase; rossmann fold, transferase; 2.05	97.9
2vli_A		183	Antibiotic resistance protein; transferase, tunica	97.87
1m7g_A		211	Adenylylsulfate kinase; APS kinase, transferase, s	97.84
1nn5_A		215	Similar to deoxythymidylate kinase (thymidylate K;	97.82
3be4_A		217	Adenylate kinase; malaria, cryptosporidium parvum	97.81
3tau_A		208	Guanylate kinase, GMP kinase; structural genomics,	97.81
3uie_A		200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	97.65
3gmt_A		230	Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle	97.64
4eaq_A		229	DTMP kinase, thymidylate kinase; structural genomi	97.62
1ak2_A		233	Adenylate kinase isoenzyme-2; nucleoside monophosp	97.58
1x6v_B		630	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	97.56
2axn_A		520	6-phosphofructo-2-kinase/fructose-2,6- biphosphata	97.53
1gtv_A		214	TMK, thymidylate kinase; transferase, transferase	97.46
2gks_A		546	Bifunctional SAT/APS kinase; transferase, sulfuryl	97.45
1dek_A		241	Deoxynucleoside monophosphate kinase; transferase,	97.45
2yvu_A		186	Probable adenylyl-sulfate kinase; transferase, str	97.43
3sr0_A		206	Adenylate kinase; phosphoryl transfer analogue, AL	97.42
2ocp_A		241	DGK, deoxyguanosine kinase; protein-nucleotide com	97.33
3a8t_A		339	Adenylate isopentenyltransferase; rossmann fold pr	97.13
3zvl_A		416	Bifunctional polynucleotide phosphatase/kinase; hy	97.09
1m8p_A		573	Sulfate adenylyltransferase; rossmann fold, phosph	97.02
3crm_A		323	TRNA delta(2)-isopentenylpyrophosphate transferase	97.02
4hlc_A		205	DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri	96.98
2bdt_A		189	BH3686; alpha-beta protein, structural genomics, P	96.96
3cr8_A		552	Sulfate adenylyltranferase, adenylylsulfate kinase	96.91
3exa_A		322	TRNA delta(2)-isopentenylpyrophosphate transferase	96.86
1ex7_A		186	Guanylate kinase; substrate-induced FIT, domain mo	96.86
1bif_A		469	6-phosphofructo-2-kinase/ fructose-2,6-bisphospha;	96.81
3eph_A		409	TRNA isopentenyltransferase; transferase, alternat	96.72
3lv8_A		236	DTMP kinase, thymidylate kinase; structural genomi	96.7
3ch4_B		202	Pmkase, phosphomevalonate kinase; parallel beta-sh	96.67
1zp6_A		191	Hypothetical protein ATU3015; alpha-beta protein.,	96.65
1gvn_B		287	Zeta; postsegregational killing system, plasmid; 1	96.62
3hjn_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	96.59
3foz_A		316	TRNA delta(2)-isopentenylpyrophosphate transferas;	96.51
3ld9_A		223	DTMP kinase, thymidylate kinase; ssgcid, NIH, niai	96.51
2p5t_B		253	PEZT; postsegregational killing system, phosphoryl	96.48
2v54_A		204	DTMP kinase, thymidylate kinase; nucleotide biosyn	96.32
1kgd_A		180	CASK, peripheral plasma membrane CASK; maguk, guan	96.01
1xjc_A		169	MOBB protein homolog; structural genomics, midwest	95.77
1np6_A		174	Molybdopterin-guanine dinucleotide biosynthesis pr	95.67
2f1r_A		171	Molybdopterin-guanine dinucleotide biosynthesis pr	95.67
1vma_A		306	Cell division protein FTSY; TM0570, structural gen	95.52
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	95.36
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	95.22
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	95.14
2bbw_A		246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	95.03
1rj9_A		304	FTSY, signal recognition protein; SRP-GTPase domai	95.03
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	94.96
3b9q_A		302	Chloroplast SRP receptor homolog, alpha subunit CP	94.93
2ehv_A		251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	94.9
1znw_A		207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	94.87
1zu4_A		320	FTSY; GTPase, signal recognition particle, SRP, re	94.87
3e70_C		328	DPA, signal recognition particle receptor; FTSY, S	94.85
1nij_A		318	Hypothetical protein YJIA; structural genomics, P-	94.69
1lvg_A		198	Guanylate kinase, GMP kinase; transferase; HET: AD	94.68
4edh_A		213	DTMP kinase, thymidylate kinase; structural genomi	94.48
2og2_A		359	Putative signal recognition particle receptor; nuc	94.46
1j8m_F		297	SRP54, signal recognition 54 kDa protein; signalin	94.46
2v3c_C		432	SRP54, signal recognition 54 kDa protein; nucleoti	94.42
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	94.37
2eyu_A		261	Twitching motility protein PILT; pilus retraction	94.31
2qmh_A		205	HPR kinase/phosphorylase; V267F mutation, ATP-bind	94.28
4tmk_A		213	Protein (thymidylate kinase); ATP:DTMP phosphotran	94.21
1z6g_A		218	Guanylate kinase; structural genomics, SGC, struct	94.18
3tif_A		235	Uncharacterized ABC transporter ATP-binding prote;	94.18
2yhs_A		503	FTSY, cell division protein FTSY; cell cycle, prot	94.17
1ye8_A		178	Protein THEP1, hypothetical UPF0334 kinase-like pr	94.11
2i3b_A		189	HCR-ntpase, human cancer-related ntpase; AAA, ross	94.08
3p32_A		355	Probable GTPase RV1496/MT1543; structural genomics	94.05
2cvh_A		220	DNA repair and recombination protein RADB; filamen	94.04
1s96_A		219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	93.97
2xxa_A		433	Signal recognition particle protein; protein trans	93.95
4g1u_C		266	Hemin import ATP-binding protein HMUV; membrane tr	93.91
1yrb_A		262	ATP(GTP)binding protein; GTPase, P-loop, rossman f	93.87
1g8f_A		511	Sulfate adenylyltransferase; alpha-beta protein, b	93.83
2j37_W		504	Signal recognition particle 54 kDa protein (SRP54)	93.74
1ls1_A		295	Signal recognition particle protein; FFH, SRP54, S	93.71
3jvv_A		356	Twitching mobility protein; hexameric P-loop ATPas	93.7
3ney_A		197	55 kDa erythrocyte membrane protein; structural ge	93.66
1c9k_A		180	COBU, adenosylcobinamide kinase; alpha/beta struct	93.63
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	93.59
4gp7_A		171	Metallophosphoesterase; polynucleotide kinase phos	93.59
2ffh_A		425	Protein (FFH); SRP54, signal recognition particle,	93.56
1htw_A		158	HI0065; nucleotide-binding fold, structural genomi	93.32
4a74_A		231	DNA repair and recombination protein RADA; hydrola	93.2
1p5z_B		263	DCK, deoxycytidine kinase; nucleoside kinase, P-lo	93.19
3b85_A		208	Phosphate starvation-inducible protein; PHOH2, ATP	93.08
1n0w_A		243	DNA repair protein RAD51 homolog 1; DNA repair, ho	93.03
2www_A		349	Methylmalonic aciduria type A protein, mitochondri	93.0
2wsm_A		221	Hydrogenase expression/formation protein (HYPB); m	92.96
3kjh_A		254	CO dehydrogenase/acetyl-COA synthase complex, acce	92.91
2onk_A		240	Molybdate/tungstate ABC transporter, ATP-binding p	92.83
2pcj_A		224	ABC transporter, lipoprotein-releasing system ATP-	92.82
2ewv_A		372	Twitching motility protein PILT; pilus retraction	92.79
3v9p_A		227	DTMP kinase, thymidylate kinase; ssgcid, STRU geno	92.76
1p9r_A		418	General secretion pathway protein E; bacterial typ	92.75
2qm8_A		337	GTPase/ATPase; G protein, G3E, metallochaperone, c	92.74
2ghi_A		260	Transport protein; multidrug resistance protein, M	92.63
3gfo_A		275	Cobalt import ATP-binding protein CBIO 1; structur	92.57
3bos_A		242	Putative DNA replication factor; P-loop containing	92.56
2ixe_A		271	Antigen peptide transporter 1; ABC ATPase, hydrola	92.55
2qi9_C		249	Vitamin B12 import ATP-binding protein BTUD; inner	92.53
1b0u_A		262	Histidine permease; ABC transporter, transport pro	92.51
2gza_A		361	Type IV secretion system protein VIRB11; ATPase, h	92.44
3tui_C		366	Methionine import ATP-binding protein METN; ABC-tr	92.36
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	92.33
1lw7_A		365	Transcriptional regulator NADR; NMN, NMN adenylyl	92.33
2afh_E		289	Nitrogenase iron protein 1; nitrogen fixation, iro	92.27
3hr8_A		356	Protein RECA; alpha and beta proteins (A/B, A+B),	92.27
2p67_A		341	LAO/AO transport system kinase; ARGK, structural G	92.22
4dzz_A		206	Plasmid partitioning protein PARF; deviant walker	92.19
2oap_1		511	GSPE-2, type II secretion system protein; hexameri	92.16
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	92.14
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	92.09
1g6h_A		257	High-affinity branched-chain amino acid transport	92.08
3zq6_A		324	Putative arsenical pump-driving ATPase; tail-ancho	92.05
1g3q_A		237	MIND ATPase, cell division inhibitor; alpha-beta-a	92.04
1ixz_A		254	ATP-dependent metalloprotease FTSH; AAA domain fol	92.01
1ji0_A		240	ABC transporter; ATP binding protein, structural g	92.01
2olj_A		263	Amino acid ABC transporter; ABC domain, ATPase, hy	92.0
3fwy_A		314	Light-independent protochlorophyllide reductase I	91.99
2v9p_A		305	Replication protein E1; AAA+ molecular motor, DNA	91.95
1cp2_A		269	CP2, nitrogenase iron protein; oxidoreductase; 1.9	91.93
2pze_A		229	Cystic fibrosis transmembrane conductance regulat;	91.92
3q9l_A		260	Septum site-determining protein MIND; ATPase, bact	91.88
2pt7_A		330	CAG-ALFA; ATPase, protein-protein complex, type IV	91.81
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	91.71
1nlf_A		279	Regulatory protein REPA; replicative DNA helicase	91.64
3end_A		307	Light-independent protochlorophyllide reductase ir	91.59
2ihy_A		279	ABC transporter, ATP-binding protein; ATPase, ABC	91.59
2nq2_C		253	Hypothetical ABC transporter ATP-binding protein H	91.57
3nh6_A		306	ATP-binding cassette SUB-family B member 6, mitoc;	91.56
3sop_A		270	Neuronal-specific septin-3; hydrolase; HET: GDP; 2	91.43
1hyq_A		263	MIND, cell division inhibitor (MIND-1); MINC, FTSZ	91.35
1lv7_A		257	FTSH; alpha/beta domain, four helix bundle, hydrol	91.27
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	91.25
3ug7_A		349	Arsenical pump-driving ATPase; tail-anchored, memb	91.18
2pjz_A		263	Hypothetical protein ST1066; ATP binding protein,	91.04
2x8a_A		274	Nuclear valosin-containing protein-like; nuclear p	91.0
3rlf_A		381	Maltose/maltodextrin import ATP-binding protein M;	90.95
3tmk_A		216	Thymidylate kinase; phosphotransferase; HET: T5A;	90.93
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	90.88
1iy2_A		278	ATP-dependent metalloprotease FTSH; AAA domain fol	90.84
3fvq_A		359	Fe(3+) IONS import ATP-binding protein FBPC; nucle	90.78
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	90.63
2hf9_A		226	Probable hydrogenase nickel incorporation protein	90.5
1svm_A		377	Large T antigen; AAA+ fold, viral protein; HET: AT	90.48
3gd7_A		390	Fusion complex of cystic fibrosis transmembrane co	90.38
3qf4_B		598	Uncharacterized ABC transporter ATP-binding prote	90.3
2cbz_A		237	Multidrug resistance-associated protein 1; ABC pro	90.26
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	90.16
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	90.14
2xj4_A		286	MIPZ; replication, cell division, ATPase, WACA; 1.	90.06
3kta_A		182	Chromosome segregation protein SMC; structural mai	89.99
1mv5_A		243	LMRA, multidrug resistance ABC transporter ATP-bin	89.98
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	89.91
2ff7_A		247	Alpha-hemolysin translocation ATP-binding protein	89.86
1z47_A		355	CYSA, putative ABC-transporter ATP-binding protein	89.61
3b5x_A		582	Lipid A export ATP-binding/permease protein MSBA;	89.57
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	89.54
2npi_A		460	Protein CLP1; CLP1-PCF11 complex, ATP binding, ter	89.53
1in4_A		334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	89.52
2yl4_A		595	ATP-binding cassette SUB-family B member 10, mitoc	89.43
1pzn_A		349	RAD51, DNA repair and recombination protein RAD51,	89.42
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	89.41
2it1_A		362	362AA long hypothetical maltose/maltodextrin trans	89.39
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	89.32
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	89.28
2d2e_A		250	SUFC protein; ABC-ATPase, SUF protein, 310-helix,	89.26
2yyz_A		359	Sugar ABC transporter, ATP-binding protein; sugar	89.23
1v43_A		372	Sugar-binding transport ATP-binding protein; ATPas	89.2
2dpy_A		438	FLII, flagellum-specific ATP synthase; beta barrel	89.19
1vpl_A		256	ABC transporter, ATP-binding protein; TM0544, stru	89.19
4ag6_A		392	VIRB4 ATPase, type IV secretory pathway VIRB4 comp	89.15
1g29_1		372	MALK, maltose transport protein MALK; ATPase, acti	89.14
1sgw_A		214	Putative ABC transporter; structural genomics, P p	89.12
3tqf_A		181	HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co	89.08
4f4c_A		1321	Multidrug resistance protein PGP-1; ABC transporte	89.07
1p6x_A		334	Thymidine kinase; P-loop, LID, transferase; HET: T	89.0
2obl_A		347	ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O	88.96
2yz2_A		266	Putative ABC transporter ATP-binding protein TM_0;	88.87
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	88.73
1e2k_A		331	Thymidine kinase; transferase, antiviral drug, enz	88.7
2zu0_C		267	Probable ATP-dependent transporter SUFC; iron-sulf	88.6
1of1_A		376	Thymidine kinase; transferase, antiviral drug, enz	88.56
3iqw_A		334	Tail-anchored protein targeting factor GET3; ATPas	88.54
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	88.29
3b60_A		582	Lipid A export ATP-binding/permease protein MSBA;	88.25
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	88.15
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	88.12
3ea0_A		245	ATPase, para family; alpha-beta-alpha sandwich, st	87.97
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	87.93
3d31_A		348	Sulfate/molybdate ABC transporter, ATP-binding pro	87.87
3cio_A		299	ETK, tyrosine-protein kinase ETK; WZC, escherichia	87.75
3bfv_A		271	CAPA1, CAPB2, membrane protein CAPA1, protein tyro	87.7
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	87.62
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	87.54
3k9g_A		267	PF-32 protein; ssgcid, SBRI, decode biostructures,	87.47
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	87.41
1oxx_K		353	GLCV, glucose, ABC transporter, ATP binding protei	87.39
4a82_A		578	Cystic fibrosis transmembrane conductance regulat;	87.31
3euj_A		483	Chromosome partition protein MUKB, linker; MUKB, M	87.26
2ph1_A		262	Nucleotide-binding protein; alpha-beta protein, st	87.14
3qf4_A		587	ABC transporter, ATP-binding protein; multidrug tr	87.08
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	87.06
1v5w_A		343	DMC1, meiotic recombination protein DMC1/LIM15 hom	86.98
1osn_A		341	Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra	86.89
2chg_A		226	Replication factor C small subunit; DNA-binding pr	86.67
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	86.63
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	86.48
2bbs_A		290	Cystic fibrosis transmembrane conductance regulato	86.38
2z43_A		324	DNA repair and recombination protein RADA; archaea	86.22
2woo_A		329	ATPase GET3; tail-anchored, membrane protein, targ	86.17
3ozx_A		538	RNAse L inhibitor; ATP binding cassette protein, h	86.16
2oze_A		298	ORF delta'; para, walker type atpases, DNA segrega	86.15
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	86.11
1xx6_A		191	Thymidine kinase; NESG, northeast structural genom	86.02
3hws_A		363	ATP-dependent CLP protease ATP-binding subunit CL;	86.01
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	86.01
1oix_A		191	RAS-related protein RAB-11A; small G protein, intr	85.75
1ihu_A		589	Arsenical pump-driving ATPase; aluminum fluoride,	85.73
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	85.68
3ozx_A		538	RNAse L inhibitor; ATP binding cassette protein, h	85.59
1tue_A		212	Replication protein E1; helicase, replication, E1E	85.43
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	85.4
3lda_A		400	DNA repair protein RAD51; DNA binding protein, ATP	85.39
2r2a_A		199	Uncharacterized protein; zonular occludens toxin,	85.36
1tq4_A		413	IIGP1, interferon-inducible GTPase; interferon gam	85.25
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	85.18
3m6a_A		543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	85.15
2ce2_X		166	GTPase HRAS; signaling protein, guanine nucleotide	85.01
3ez9_A		403	Para; DNA binding, winged-HTH, partition, biosynth	84.98
1u94_A		356	RECA protein, recombinase A; homologous recombinat	84.9
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	84.82
1um8_A		376	ATP-dependent CLP protease ATP-binding subunit CL;	84.82
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	84.66
3io3_A		348	DEHA2D07832P; chaperone, membrane traffic, ATPase;	84.51
1e9r_A		437	Conjugal transfer protein TRWB; coupling protein,	84.36
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	84.3
1w4r_A		195	Thymidine kinase; type II, human, cytosolic, phosp	84.24
3pg5_A		361	Uncharacterized protein; structural genomics, PSI-	84.2
1byi_A		224	Dethiobiotin synthase; biotin synthesis, cyclo-lig	84.12
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	84.09
3ez2_A		398	Plasmid partition protein A; type IA, DNA binding,	83.99
2dhr_A		499	FTSH; AAA+ protein, hexameric Zn metalloprotease,	83.86
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	83.83
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	83.81
2r8r_A		228	Sensor protein; KDPD, PFAM02702, MCSG, structural	83.79
2f9l_A		199	RAB11B, member RAS oncogene family; RAB11B GTPase,	83.79
1ko7_A		314	HPR kinase/phosphatase; protein kinase, phosphotra	83.7
3io5_A		333	Recombination and repair protein; storage dimer, i	83.62
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	83.58
1wcv_1		257	SOJ, segregation protein; ATPase, bacterial, chrom	83.55
2fna_A		357	Conserved hypothetical protein; structural genomic	83.43
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	83.12
1knx_A		312	Probable HPR(Ser) kinase/phosphatase; HPR kinase,	82.88
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	82.81
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	82.74
1pui_A		210	ENGB, probable GTP-binding protein ENGB; structura	82.62
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	82.53
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	82.49
3fkq_A		373	NTRC-like two-domain protein; RER070207001320, str	82.43
2woj_A		354	ATPase GET3; tail-anchored, membrane protein, targ	82.42
2qgz_A		308	Helicase loader, putative primosome component; str	82.4
2r62_A		268	Cell division protease FTSH homolog; ATPase domain	82.12
1g8p_A		350	Magnesium-chelatase 38 kDa subunit; parallel beta	82.1
2dyk_A		161	GTP-binding protein; GTPase, ribosome-binding prot	82.02
2wji_A		165	Ferrous iron transport protein B homolog; membrane	81.78
1g41_A		444	Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep	81.72
2i1q_A		322	DNA repair and recombination protein RADA; ATPase,	81.62
3d8b_A		357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	81.42
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	81.41
2qag_B		427	Septin-6, protein NEDD5; cell cycle, cell division	81.41
2yv5_A		302	YJEQ protein; hydrolase, GTPase, permutation, stru	80.9
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	80.69
4b4t_K		428	26S protease regulatory subunit 6B homolog; hydrol	80.68
1kao_A		167	RAP2A; GTP-binding protein, small G protein, GDP,	80.52
3k1j_A		604	LON protease, ATP-dependent protease LON; ATP-bind	80.49
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	80.29
2vhj_A		331	Ntpase P4, P4; non- hydrolysable ATP analogue, hyd	80.28
1c1y_A		167	RAS-related protein RAP-1A; GTP-binding proteins,	80.27
3cwq_A		209	Para family chromosome partitioning protein; alpha	80.13
1qhl_A		227	Protein (cell division protein MUKB); SMC, chromos	80.13
2c9o_A		456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	80.09
1u0l_A		301	Probable GTPase ENGC; permutation, OB-fold, zinc-f	80.01

>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6	Back alignment and structure

Probab=100.00  E-value=2.9e-40  Score=312.45  Aligned_cols=225  Identities=22%  Similarity=0.276  Sum_probs=183.9

Q ss_pred             cEEEEEEcCCCCCCCc-HHHHHHhccc--CCeEEEEccceecCCchhhh-------h---hccCCCCccccchhHHHHHH
Q 048274            2 RRLTSVFGGAAEPPKG-GNPDSNTLIS--DTTTVICLDDYHSLDRTGRK-------E---KGVTALDPRANNFDLMYEQV   68 (329)
Q Consensus         2 r~IIgI~GgsgSGKST-a~~la~~L~~--~~v~vI~~Ddyhr~dr~~~~-------~---~~~~~~~Pea~d~d~L~~~L   68 (329)
                      +.+|||+|++|||||| |+.|++.|+.  ..+.+|++|+||++++..+.       +   ..+.+|+|+++|++.+.+.|
T Consensus         5 ~~iIgItG~sGSGKSTva~~L~~~lg~~~~~~~vI~~D~~~r~~~~~~~~~~~~~~~~g~~~~~~fg~~~~d~~~l~~~l   84 (290)
T 1a7j_A            5 HPIISVTGSSGAGTSTVKHTFDQIFRREGVKAVSIEGDAFHRFNRADMKAELDRRYAAGDATFSHFSYEANELKELERVF   84 (290)
T ss_dssp             SCEEEEESCC---CCTHHHHHHHHHHHHTCCEEEEEGGGGBSCCHHHHHHHHHHHHHHTCTTCSTTSGGGBCHHHHHHHH
T ss_pred             ceEEEEECCCCCCHHHHHHHHHHHHhhcCCCeeEeecchhhcCCHHHhhhhhhhhhhccCcCcCCCChhhhcHHHHHHHH
Confidence            3589999999999999 8888887763  35899999999986443321       1   35678899999999999999


Q ss_pred             HHHhcCCceecccccc----------ccCCCCCCccc-CCCcEEEEEccccc---cchhhhccCCEEEEEECCHHHHHHH
Q 048274           69 KAMKDGVSVEKPIYNH----------VTGLLDPPELI-KPPKILVIEGLHPM---YDARVRELLDFSIYLDISNEVKFAW  134 (329)
Q Consensus        69 ~~L~~G~~i~~P~Yd~----------~tg~~~~~~~i-~p~~vlIvEGl~~l---~~~~lr~~~D~~IyVD~~~evrl~r  134 (329)
                      ..+++++.++.|.|+|          ..+.+.+|..+ .+.+++|+||++++   +...+++.+|++|||+++.+++++|
T Consensus        85 ~~l~~~~~i~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~vvIvEG~~~~~~~~~~~v~~~~D~~IfV~a~~~~rl~R  164 (290)
T 1a7j_A           85 REYGETGQGRTRTYVHDDAEAARTGVAPGNFTDWRDFDSDSHLLFYEGLHGAVVNSEVNIAGLADLKIGVVPVINLEWIQ  164 (290)
T ss_dssp             HHHHHHSCCEECCCC------CCSSCCTTSCCCCEECCSSCSEEEEEESCTTCBCSSCBCGGGCSEEEEEEECHHHHHHH
T ss_pred             HHHHcCCcccceeeccccccccccCCCCCccccccccCCCCCEEEEEecccccccchHhHHHhCCEEEEEECCHHHHHHH
Confidence            9999999999999965          23445566666 46889999999998   4457889999999999999999999


Q ss_pred             hhcccccccCCchhhHHHHHhhcccchhhhccccCCCCcEEEecCCC---------CCCCCCCCCc-eEEEEEEEecCCC
Q 048274          135 KIQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPT---------QLIPDDNEGK-VLRVRLIMKEGVK  204 (329)
Q Consensus       135 kI~RD~~eRG~s~E~V~~~i~~r~pd~~~yI~Pqk~~ADiVI~~~p~---------~~~p~~~~~~-~l~~r~~~~~~~~  204 (329)
                      +++||..+||+|.|++.+++.+|+|+|++||.|++++||++|+.+|+         ++||+++|++ +||+|     +++
T Consensus       165 rl~Rd~~~RG~s~e~v~~~i~~r~~~~~r~i~p~~~~AD~~~~~~~vIDns~~~~~~~ip~~~~~~~~~~~~-----~~~  239 (290)
T 1a7j_A          165 KIHRDRATRGYTTEAVTDVILRRMHAYVHCIVPQFSQTDINFQRVPVVDTSNPFIARWIPTADESVVVIRFR-----NPR  239 (290)
T ss_dssp             HHHHTSSSCCSCCCCHHHHHHHHHHHHHHHTGGGGGTCSEEEEEEESSCCSCGGGCCSCCCGGGEEEEEEES-----SCS
T ss_pred             HhhhhhhhcCCChHHHHHHHHHhCccHHHhhhhhhccCCEeeccCceecCCCccccccCCCCccceEEEEEc-----CCC
Confidence            99999999999999999999988999999999999999997776654         7899999998 77777     888


Q ss_pred             CCCcccccc--CCCcccccccCCcccccCCCeeE
Q 048274          205 YFSPVYLFD--EGSTIEWIPCGRKLTCSYPGIKF  236 (329)
Q Consensus       205 ~~~~~~l~~--~~~~~~~~~~~~~~~~~~~~~~~  236 (329)
                      ++||+||++  +||+++     |..|+..||-||
T Consensus       240 ~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~  268 (290)
T 1a7j_A          240 GIDFPYLTSMIHGSWMS-----RANSIVVPGNKL  268 (290)
T ss_dssp             SCCHHHHHHHSTTCEEE-----ETTEEEEEGGGH
T ss_pred             CCCHHHHHHhccccccc-----CCceEEeeCccH
Confidence            999999999  888766     444444444333

PyMOL of 1a7j

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}	Back alignment and structure

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*	Back alignment and structure

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*	Back alignment and structure

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6	Back alignment and structure

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}	Back alignment and structure

>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A*	Back alignment and structure

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*	Back alignment and structure

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6	Back alignment and structure

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*	Back alignment and structure

>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A*	Back alignment and structure

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*	Back alignment and structure

>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus}	Back alignment and structure

>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima}	Back alignment and structure

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1	Back alignment and structure

>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A*	Back alignment and structure

>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}	Back alignment and structure

>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A	Back alignment and structure

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1	Back alignment and structure

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}	Back alignment and structure

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*	Back alignment and structure

>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1	Back alignment and structure

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A	Back alignment and structure

>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus}	Back alignment and structure

>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A*	Back alignment and structure

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}	Back alignment and structure

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*	Back alignment and structure

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*	Back alignment and structure

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}	Back alignment and structure

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}	Back alignment and structure

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}	Back alignment and structure

>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A*	Back alignment and structure

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*	Back alignment and structure

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}	Back alignment and structure

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*	Back alignment and structure

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}	Back alignment and structure

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}	Back alignment and structure

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*	Back alignment and structure

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}	Back alignment and structure

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A	Back alignment and structure

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2	Back alignment and structure

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}	Back alignment and structure

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*	Back alignment and structure

>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A*	Back alignment and structure

>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum}	Back alignment and structure

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1	Back alignment and structure

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}	Back alignment and structure

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*	Back alignment and structure

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}	Back alignment and structure

>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1	Back alignment and structure

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A	Back alignment and structure

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2	Back alignment and structure

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A	Back alignment and structure

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A	Back alignment and structure

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*	Back alignment and structure

>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940}	Back alignment and structure

>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum}	Back alignment and structure

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}	Back alignment and structure

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*	Back alignment and structure

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*	Back alignment and structure

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*	Back alignment and structure

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}	Back alignment and structure

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}	Back alignment and structure

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}	Back alignment and structure

>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A*	Back alignment and structure

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1	Back alignment and structure

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*	Back alignment and structure

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1	Back alignment and structure

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}	Back alignment and structure

>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A*	Back alignment and structure

>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A*	Back alignment and structure

>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A*	Back alignment and structure

>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni}	Back alignment and structure

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}	Back alignment and structure

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*	Back alignment and structure

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*	Back alignment and structure

>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II}	Back alignment and structure

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*	Back alignment and structure

>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B}	Back alignment and structure

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A	Back alignment and structure

>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A*	Back alignment and structure

>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A*	Back alignment and structure

>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A*	Back alignment and structure

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*	Back alignment and structure

>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus}	Back alignment and structure

>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A*	Back alignment and structure

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}	Back alignment and structure

>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A*	Back alignment and structure

>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}	Back alignment and structure

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*	Back alignment and structure

>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A*	Back alignment and structure

>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A	Back alignment and structure

>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A*	Back alignment and structure

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25	Back alignment and structure

>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans}	Back alignment and structure

>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A	Back alignment and structure

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A	Back alignment and structure

>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A	Back alignment and structure

>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A*	Back alignment and structure

>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A*	Back alignment and structure

>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens}	Back alignment and structure

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25	Back alignment and structure

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*	Back alignment and structure

>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima}	Back alignment and structure

>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A	Back alignment and structure

>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis}	Back alignment and structure

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}	Back alignment and structure

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*	Back alignment and structure

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10	Back alignment and structure

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A	Back alignment and structure

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}	Back alignment and structure

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A	Back alignment and structure

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}	Back alignment and structure

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A	Back alignment and structure

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A	Back alignment and structure

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*	Back alignment and structure

>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1	Back alignment and structure

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1	Back alignment and structure

>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A*	Back alignment and structure

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F	Back alignment and structure

>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}	Back alignment and structure

>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A*	Back alignment and structure

>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A*	Back alignment and structure

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}	Back alignment and structure

>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A*	Back alignment and structure

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A	Back alignment and structure

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11	Back alignment and structure

>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*	Back alignment and structure

>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9	Back alignment and structure

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}	Back alignment and structure

>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A*	Back alignment and structure

>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A*	Back alignment and structure

>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A	Back alignment and structure

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*	Back alignment and structure

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*	Back alignment and structure

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0	Back alignment and structure

>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*	Back alignment and structure

>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A	Back alignment and structure

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A	Back alignment and structure

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*	Back alignment and structure

>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ...	Back alignment and structure

>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}	Back alignment and structure

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}	Back alignment and structure

>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A*	Back alignment and structure

>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12	Back alignment and structure

>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A	Back alignment and structure

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*	Back alignment and structure

>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A*	Back alignment and structure

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*	Back alignment and structure

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}	Back alignment and structure

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*	Back alignment and structure

>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C	Back alignment and structure

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12	Back alignment and structure

>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis}	Back alignment and structure

>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1	Back alignment and structure

>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A	Back alignment and structure

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}	Back alignment and structure

>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10	Back alignment and structure

>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A*	Back alignment and structure

>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*	Back alignment and structure

>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid}	Back alignment and structure

>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A*	Back alignment and structure

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*	Back alignment and structure

>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*	Back alignment and structure

>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2}	Back alignment and structure

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*	Back alignment and structure

>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10	Back alignment and structure

>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A	Back alignment and structure

>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A*	Back alignment and structure

>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A	Back alignment and structure

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}	Back alignment and structure

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}	Back alignment and structure

>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*	Back alignment and structure

>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens}	Back alignment and structure

>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10	Back alignment and structure

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A*	Back alignment and structure

>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}	Back alignment and structure

>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A	Back alignment and structure

>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A*	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20	Back alignment and structure

>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae}	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*	Back alignment and structure

>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A	Back alignment and structure

>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens}	Back alignment and structure

>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A	Back alignment and structure

>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X*	Back alignment and structure

>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*	Back alignment and structure

>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius}	Back alignment and structure

>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae}	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae}	Back alignment and structure

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*	Back alignment and structure

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii}	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A*	Back alignment and structure

>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima}	Back alignment and structure

>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A*	Back alignment and structure

>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium}	Back alignment and structure

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A	Back alignment and structure

>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A	Back alignment and structure

>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12	Back alignment and structure

>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii}	Back alignment and structure

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}	Back alignment and structure

>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A*	Back alignment and structure

>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A*	Back alignment and structure

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ...	Back alignment and structure

>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A	Back alignment and structure

>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1	Back alignment and structure

>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A*	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum}	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12	Back alignment and structure

>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli}	Back alignment and structure

>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A*	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A*	Back alignment and structure

>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A	Back alignment and structure

>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A*	Back alignment and structure

>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A*	Back alignment and structure

>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A	Back alignment and structure

>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*	Back alignment and structure

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*	Back alignment and structure

>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe}	Back alignment and structure

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}	Back alignment and structure

>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes}	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B*	Back alignment and structure

>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A*	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}	Back alignment and structure

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*	Back alignment and structure

>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58}	Back alignment and structure

>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A*	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A	Back alignment and structure

>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ...	Back alignment and structure

>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii}	Back alignment and structure

>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A*	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A*	Back alignment and structure

>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae}	Back alignment and structure

>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A	Back alignment and structure

>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus}	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV}	Back alignment and structure

>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A*	Back alignment and structure

>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2	Back alignment and structure

>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4}	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A*	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale}	Back alignment and structure

>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A*	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*	Back alignment and structure

>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G	Back alignment and structure

>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus}	Back alignment and structure

>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A*	Back alignment and structure

>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E*	Back alignment and structure

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*	Back alignment and structure

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus}	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R*	Back alignment and structure

>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus}	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A*	Back alignment and structure

>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D*	Back alignment and structure

>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP}	Back alignment and structure

>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12	Back alignment and structure

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A*	Back alignment and structure

>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		329
d1a7ja_		288	c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph	6e-51
d1uj2a_		213	c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho	6e-21
d1sq5a_		308	c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi	8e-19
d1rz3a_		198	c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci	1e-10

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Phosphoribulokinase
species: Rhodobacter sphaeroides [TaxId: 1063]

 Score =  168 bits (427), Expect = 6e-51
 Identities = 46/246 (18%), Positives = 74/246 (30%), Gaps = 44/246 (17%)

Query: 29  TTTVICLDDYHSLDRTGRKE----------KGVTALDPRANNFDLMYEQVKAMKDGVSVE 78
               I  D +H  +R   K              +     AN    +    +   +     
Sbjct: 34  KAVSIEGDAFHRFNRADMKAELDRRYAAGDATFSHFSYEANELKELERVFREYGETGQGR 93

Query: 79  KPIYNHVTG-----------LLDPPELIKPPKILVIEGLHPMY---DARVRELLDFSIYL 124
              Y H                D  +      +L  EGLH      +  +  L D  I +
Sbjct: 94  TRTYVHDDAEAARTGVAPGNFTDWRDFDSDSHLLFYEGLHGAVVNSEVNIAGLADLKIGV 153

Query: 125 DISNEVKFAWKIQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPT--- 181
                +++  KI RD   RG++ E++   I  R   +   I PQ    D   + +P    
Sbjct: 154 VPVINLEWIQKIHRDRATRGYTTEAVTDVILRRMHAYVHCIVPQFSQTDINFQRVPVVDT 213

Query: 182 ------QLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFD--EGSTIEWIPCGRKLTCSYPG 233
                 + IP  +E  V  +R     G+ +    YL     GS +      R  +   PG
Sbjct: 214 SNPFIARWIPTADESVV-VIRFRNPRGIDF---PYLTSMIHGSWMS-----RANSIVVPG 264

Query: 234 IKFSYG 239
            K    
Sbjct: 265 NKLDLA 270

PyMOL of d1a7ja_

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		329
d1a7ja_		288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	100.0
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	100.0
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	99.97
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	99.89
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	99.82
d1jjva_		205	Dephospho-CoA kinase {Haemophilus influenzae [TaxI	99.76
d1uf9a_		191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	99.69
d1vhta_		208	Dephospho-CoA kinase {Escherichia coli [TaxId: 562	99.68
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	98.87
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	98.75
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	98.73
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	98.66
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	98.63
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	98.61
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	98.57
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	98.54
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	98.49
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	98.45
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	98.38
d1q3ta_		223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	98.3
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	98.29
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	98.24
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	98.1
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	98.08
d1e4va1		179	Adenylate kinase {Escherichia coli [TaxId: 562]}	98.02
d1teva_		194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	98.01
d1deka_		241	Deoxynucleoside monophosphate kinase {Bacteriophag	97.87
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	97.83
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	97.81
d2cdna1		181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	97.71
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	97.69
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	97.63
d3adka_		194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	97.62
d1znwa1		182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	97.58
d1gsia_		208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	97.57
d2ak3a1		189	Adenylate kinase {Cow (Bos taurus), mitochondrial	97.56
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	97.52
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	97.51
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	97.47
d1s3ga1		182	Adenylate kinase {Bacillus globisporus [TaxId: 145	97.41
d2ocpa1		241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	97.38
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	97.37
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	97.36
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	97.33
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	97.31
d1akya1		180	Adenylate kinase {Baker's yeast (Saccharomyces cer	97.26
d1e2ka_		329	Thymidine kinase {Herpes simplex virus type 1, dif	97.26
d1p5zb_		241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	97.25
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	97.22
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	97.09
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	97.08
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	97.01
d1ls1a2		207	GTPase domain of the signal sequence recognition p	96.98
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	96.98
d1j8yf2		211	GTPase domain of the signal sequence recognition p	96.93
d1okkd2		207	GTPase domain of the signal recognition particle r	96.85
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	96.84
d2qy9a2		211	GTPase domain of the signal recognition particle r	96.84
d1s96a_		205	Guanylate kinase {Escherichia coli [TaxId: 562]}	96.82
d1vmaa2		213	GTPase domain of the signal recognition particle r	96.76
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	96.68
d1p6xa_		333	Thymidine kinase {Equine herpesvirus type 4 [TaxId	96.63
d1osna_		331	Thymidine kinase {Varicella-zoster virus [TaxId: 1	96.47
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	96.26
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	96.19
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	96.18
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	96.14
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	95.85
d1kgda_		178	Guanylate kinase-like domain of Cask {Human (Homo	95.8
d3b60a1		253	Multidrug resistance ABC transporter MsbA, C-termi	94.79
d1cp2a_		269	Nitrogenase iron protein {Clostridium pasteurianum	94.44
d2pmka1		241	Haemolysin B ATP-binding protein {Escherichia coli	94.42
d1ji0a_		240	Branched chain aminoacid ABC transporter {Thermoto	94.24
d1g3qa_		237	Cell division regulator MinD {Archaeon Pyrococcus	94.22
d1mv5a_		242	Multidrug resistance ABC transporter LmrA, C-termi	94.05
d1g6ha_		254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	93.89
d1tmka_		214	Thymidylate kinase {Baker's yeast (Saccharomyces c	93.88
d1l2ta_		230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	93.87
d3dhwc1		240	Methionine import ATP-binding protein MetN {Escher	93.81
d1jj7a_		251	Peptide transporter Tap1, C-terminal ABC domain {H	93.76
d1ihua1		296	Arsenite-translocating ATPase ArsA {Escherichia co	93.75
d1g2912		240	Maltose transport protein MalK, N-terminal domain	93.72
d2awna2		232	Maltose transport protein MalK, N-terminal domain	93.55
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	93.49
d1hyqa_		232	Cell division regulator MinD {Archaeon Archaeoglob	93.35
d1l7vc_		231	ABC transporter involved in vitamin B12 uptake, Bt	93.33
d1v43a3		239	Hypothetical protein PH0022, N-terminal domain {Py	93.17
d1ihua2		279	Arsenite-translocating ATPase ArsA {Escherichia co	93.07
d1b0ua_		258	ATP-binding subunit of the histidine permease {Sal	93.04
d3d31a2		229	Sulfate/molybdate ABC transporter, ATP-binding pro	93.01
d2onka1		240	Molybdate/tungstate import ATP-binding protein Wtp	92.8
d2afhe1		289	Nitrogenase iron protein {Azotobacter vinelandii [	92.65
d1sgwa_		200	Putative ABC transporter PF0895 {Pyrococcus furios	92.25
d1nija1		222	Hypothetical protein YjiA, N-terminal domain {Esch	92.12
d1vpla_		238	Putative ABC transporter TM0544 {Thermotoga mariti	92.08
d1r0wa_		281	Cystic fibrosis transmembrane conductance regulato	91.75
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	91.64
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	91.54
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	91.41
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	91.41
d1htwa_		158	Hypothetical protein HI0065 {Haemophilus influenza	91.27
d1oxxk2		242	Glucose transport protein GlcV, N-terminal domain	91.26
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	90.96
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	90.8
d1p9ra_		401	Extracellular secretion NTPase EpsE {Vibrio choler	90.49
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	90.46
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	90.35
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	89.97
d1n0wa_		242	DNA repair protein Rad51, catalytic domain {Human	89.58
d2hyda1		255	Putative multidrug export ATP-binding/permease pro	89.3
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	89.29
d1g41a_		443	HslU {Haemophilus influenzae [TaxId: 727]}	89.23
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	89.08
d1knxa2		177	HPr kinase HprK C-terminal domain {Mycoplasma pneu	88.99
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	88.85
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	88.82
d1kkma_		176	HPr kinase HprK C-terminal domain {Lactobacillus c	88.74
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	88.66
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	88.11
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	87.99
d1byia_		224	Dethiobiotin synthetase {Escherichia coli [TaxId:	87.96
d1pzna2		254	DNA repair protein Rad51, catalytic domain {Archae	86.27
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	86.17
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	86.01
d1ko7a2		169	HPr kinase HprK C-terminal domain {Staphylococcus	85.96
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	85.93
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	85.2
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	84.98
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	84.81
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	84.79
d1lnza2		185	Obg GTP-binding protein middle domain {Bacillus su	84.71
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	84.61
d1v5wa_		258	Meiotic recombination protein DMC1/LIM15 homolog {	84.37
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	84.08
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	84.01
d1g8pa_		333	ATPase subunit of magnesium chelatase, BchI {Rhodo	83.72
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	83.25
d1g8fa3		122	ATP sulfurylase C-terminal domain {Baker's yeast (	83.14
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	82.99
d1u0ja_		267	Rep 40 protein helicase domain {Adeno-associated v	82.93
d1c9ka_		180	Adenosylcobinamide kinase/adenosylcobinamide phosp	82.85
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	82.77
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	82.71
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	82.49
d1udxa2		180	Obg GTP-binding protein middle domain {Thermus the	81.69
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	81.31
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	80.96
d1r8sa_		160	ADP-ribosylation factor {Human (Homo sapiens), ARF	80.54

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Phosphoribulokinase
species: Rhodobacter sphaeroides [TaxId: 1063]

Probab=100.00  E-value=2.1e-56  Score=420.52  Aligned_cols=231  Identities=20%  Similarity=0.256  Sum_probs=200.7

Q ss_pred             EEEEEEcCCCCCCCc-HHHHHHhcccC--CeEEEEccceecCCchhhhh----------hccCCCCccccchhHHHHHHH
Q 048274            3 RLTSVFGGAAEPPKG-GNPDSNTLISD--TTTVICLDDYHSLDRTGRKE----------KGVTALDPRANNFDLMYEQVK   69 (329)
Q Consensus         3 ~IIgI~GgsgSGKST-a~~la~~L~~~--~v~vI~~Ddyhr~dr~~~~~----------~~~~~~~Pea~d~d~L~~~L~   69 (329)
                      .||||+|+||||||| ++.+++.|...  .+++|++|+||+++|.+++.          ..++||+|+|||+++|.++|+
T Consensus         5 pIIgIaG~SGSGKTTva~~l~~i~~~~~v~~~iI~~Dsfyr~~R~~~~~~~~~~~~~~~~~~~~~~P~A~d~dlL~~~l~   84 (288)
T d1a7ja_           5 PIISVTGSSGAGTSTVKHTFDQIFRREGVKAVSIEGDAFHRFNRADMKAELDRRYAAGDATFSHFSYEANELKELERVFR   84 (288)
T ss_dssp             CEEEEESCC---CCTHHHHHHHHHHHHTCCEEEEEGGGGBSCCHHHHHHHHHHHHHHTCTTCSTTSGGGBCHHHHHHHHH
T ss_pred             CEEEEECCCCCcHHHHHHHHHHHHhhcCCCeEEEeCCCCCccchhhhhhhhhhhhhhhccCCCCCCcccccHHHHHHHHH
Confidence            489999999999999 89999999754  67899999999998876542          268999999999999999999


Q ss_pred             HHhcCCceeccccccccCC----------CCCCcccC-CCcEEEEEcccccc---chhhhccCCEEEEEECCHHHHHHHh
Q 048274           70 AMKDGVSVEKPIYNHVTGL----------LDPPELIK-PPKILVIEGLHPMY---DARVRELLDFSIYLDISNEVKFAWK  135 (329)
Q Consensus        70 ~L~~G~~i~~P~Yd~~tg~----------~~~~~~i~-p~~vlIvEGl~~l~---~~~lr~~~D~~IyVD~~~evrl~rk  135 (329)
                      .|++|+++..|.|||.+++          +++|+.+. ++++|||||+|+++   +..+++++|++||||++.++++.||
T Consensus        85 ~L~~g~~i~~p~Ydh~~~~~~~~~~~~~~~t~~~~~~~~~dvIivEGlh~l~~~~~~~ir~~~DlkIfVd~d~dlrliRR  164 (288)
T d1a7ja_          85 EYGETGQGRTRTYVHDDAEAARTGVAPGNFTDWRDFDSDSHLLFYEGLHGAVVNSEVNIAGLADLKIGVVPVINLEWIQK  164 (288)
T ss_dssp             HHHHHSCCEECCCC------CCSSCCTTSCCCCEECCSSCSEEEEEESCTTCBCSSCBCGGGCSEEEEEEECHHHHHHHH
T ss_pred             HHHCCCcccceeeeeecCcccccccCCCCCCcceeecCCCceEEEechhhccccchhhhHhhcCeEEEEECCCCeEEEee
Confidence            9999999999999998764          55676654 78999999999998   4459999999999999999999999


Q ss_pred             hcccccccCCchhhHHHHHhhcccchhhhccccCCCCcEEEecCCC---------CCCCCCCCCceEEEEEEEecCCCCC
Q 048274          136 IQRDMTERGHSLESIKASIEARKPDFDAYIDPQKQYADAVIEVLPT---------QLIPDDNEGKVLRVRLIMKEGVKYF  206 (329)
Q Consensus       136 I~RD~~eRG~s~E~V~~~i~~r~pd~~~yI~Pqk~~ADiVI~~~p~---------~~~p~~~~~~~l~~r~~~~~~~~~~  206 (329)
                      |+||+.+||||.|+|+++|+++||+|.+||+||+++|||||+++|+         ++||+++||++ .+||   .+++++
T Consensus       165 I~RD~~eRG~s~E~V~~~i~rrmpdy~~yI~Pq~~~aDI~~~r~p~~dt~~p~~~~~ip~~~e~~~-v~~~---~~~~~~  240 (288)
T d1a7ja_         165 IHRDRATRGYTTEAVTDVILRRMHAYVHCIVPQFSQTDINFQRVPVVDTSNPFIARWIPTADESVV-VIRF---RNPRGI  240 (288)
T ss_dssp             HHHTSSSCCSCCCCHHHHHHHHHHHHHHHTGGGGGTCSEEEEEEESSCCSCGGGCCSCCCGGGEEE-EEEE---SSCSSC
T ss_pred             ehhhhhhcCCCHHHHHHHHHhcchHHHHHHHHhhhceeEEEEecCcccccCcchhccCCCCcccEE-EEEe---cCcccC
Confidence            9999999999999999999999999999999999999999999998         77999999984 3555   377889


Q ss_pred             Ccccccc--CCCcccccccCCcccccCCCeeEEecCCc
Q 048274          207 SPVYLFD--EGSTIEWIPCGRKLTCSYPGIKFSYGPDA  242 (329)
Q Consensus       207 ~~~~l~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  242 (329)
                      ||+||++  +||.++     +.+||..||.+|.+..+.
T Consensus       241 d~~~l~~~~~~s~~s-----~~~~~v~p~~~~~~~m~~  273 (288)
T d1a7ja_         241 DFPYLTSMIHGSWMS-----RANSIVVPGNKLDLAMQL  273 (288)
T ss_dssp             CHHHHHHHSTTCEEE-----ETTEEEEEGGGHHHHHHH
T ss_pred             CHHHHHHhhcccccc-----CCceEEECChhHHHHHHH
Confidence            9999999  999988     999999999999766543

PyMOL of d1a7ja_

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}	Back information, alignment and structure

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}	Back information, alignment and structure

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}	Back information, alignment and structure

>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}	Back information, alignment and structure

>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}	Back information, alignment and structure

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}	Back information, alignment and structure

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}	Back information, alignment and structure

>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}	Back information, alignment and structure