Citrus Sinensis ID: 048469
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 239 | ||||||
| 356521805 | 374 | PREDICTED: uncharacterized protein LOC10 | 0.640 | 0.409 | 0.421 | 5e-36 | |
| 359477226 | 470 | PREDICTED: uncharacterized protein C757. | 0.652 | 0.331 | 0.425 | 2e-34 | |
| 357478903 | 376 | hypothetical protein MTR_4g121590 [Medic | 0.640 | 0.406 | 0.406 | 2e-33 | |
| 357473789 | 376 | hypothetical protein MTR_4g073090 [Medic | 0.640 | 0.406 | 0.401 | 3e-32 | |
| 357478899 | 376 | hypothetical protein MTR_4g121570 [Medic | 0.640 | 0.406 | 0.392 | 6e-32 | |
| 225431890 | 376 | PREDICTED: uncharacterized protein C757. | 0.652 | 0.414 | 0.397 | 2e-30 | |
| 118489550 | 377 | unknown [Populus trichocarpa x Populus d | 0.640 | 0.405 | 0.377 | 6e-30 | |
| 224132716 | 377 | predicted protein [Populus trichocarpa] | 0.644 | 0.408 | 0.371 | 1e-29 | |
| 224132720 | 377 | predicted protein [Populus trichocarpa] | 0.640 | 0.405 | 0.377 | 2e-29 | |
| 255556316 | 210 | conserved hypothetical protein [Ricinus | 0.292 | 0.333 | 0.633 | 4e-17 |
| >gi|356521805|ref|XP_003529541.1| PREDICTED: uncharacterized protein LOC100812240 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 157 bits (396), Expect = 5e-36, Method: Compositional matrix adjust.
Identities = 88/209 (42%), Positives = 110/209 (52%), Gaps = 56/209 (26%)
Query: 1 MVIGIVSMADLSFTEALKSPIALGGPWEVYGSAWCPKQSWFPSSAVDHYITFDATNSGNT 60
+++G+ + LS E LK P LGGPW+VYG+A P SWF S VDH+ITFDA +S +T
Sbjct: 9 LIVGVTGLTGLSLAETLKKPNCLGGPWKVYGAARRPPPSWFSPSMVDHFITFDAEDSSDT 68
Query: 61 TEKLSLLFNEITH----------------------------------------------- 73
KLS + +E+TH
Sbjct: 69 RAKLSPIAHEVTHLFWVTFQIHADEEYNATVNKTMLLNLLTALKSSTTSRLAHVTVQTGT 128
Query: 74 ------VHDPAHSAHANSHDPPLREDLSRLPCQNFYCALEDLVASYMPVISYSIHRSSII 127
V DP HS H PP E++ RLP NFY ALEDLVASY P ++YS+HRSSII
Sbjct: 129 KHYMGPVFDPVHSTQLIGHQPPFDENMPRLPYPNFYYALEDLVASYAPSLTYSVHRSSII 188
Query: 128 IGSSSRSVYNSLLTL---DVICKVFGVEF 153
IG+SSRSVYN+LLTL VIC+ G+ F
Sbjct: 189 IGASSRSVYNALLTLATYAVICRHVGLAF 217
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359477226|ref|XP_002276059.2| PREDICTED: uncharacterized protein C757.02c-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357478903|ref|XP_003609737.1| hypothetical protein MTR_4g121590 [Medicago truncatula] gi|355510792|gb|AES91934.1| hypothetical protein MTR_4g121590 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357473789|ref|XP_003607179.1| hypothetical protein MTR_4g073090 [Medicago truncatula] gi|355508234|gb|AES89376.1| hypothetical protein MTR_4g073090 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357478899|ref|XP_003609735.1| hypothetical protein MTR_4g121570 [Medicago truncatula] gi|355510790|gb|AES91932.1| hypothetical protein MTR_4g121570 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225431890|ref|XP_002276159.1| PREDICTED: uncharacterized protein C757.02c-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|118489550|gb|ABK96577.1| unknown [Populus trichocarpa x Populus deltoides] | Back alignment and taxonomy information |
|---|
| >gi|224132716|ref|XP_002327863.1| predicted protein [Populus trichocarpa] gi|222837272|gb|EEE75651.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224132720|ref|XP_002327864.1| predicted protein [Populus trichocarpa] gi|222837273|gb|EEE75652.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255556316|ref|XP_002519192.1| conserved hypothetical protein [Ricinus communis] gi|223541507|gb|EEF43056.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 239 | ||||||
| TAIR|locus:2135932 | 388 | VEP1 "VEIN PATTERNING 1" [Arab | 0.389 | 0.239 | 0.329 | 1.1e-21 |
| TAIR|locus:2135932 VEP1 "VEIN PATTERNING 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 137 (53.3 bits), Expect = 1.1e-21, Sum P(3) = 1.1e-21
Identities = 32/97 (32%), Positives = 56/97 (57%)
Query: 144 VICKVFGVEFVPFDENDDFDFVGMMKPKAKVWDEIAEQHGLYNINKLEEITCFEALINVL 203
++ + FG+E F+E + V MMK K +VW+E+ +++ L KLEE+ + +V+
Sbjct: 289 ILAEQFGIEEYGFEEGKNLGLVEMMKGKERVWEEMVKENQLQE-KKLEEVGVWW-FADVI 346
Query: 204 HFGFQHVC-SMNKSREFGFFKFADTLKSLGMWVTKLR 239
G + + SMNKS+E+GF F ++ S W+ K +
Sbjct: 347 -LGVEGMIDSMNKSKEYGFLGFRNSNNSFISWIDKYK 382
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 239 | |||
| cd08948 | 308 | cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta | 3e-08 |
| >gnl|CDD|187652 cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta-reductase-like proteins (5beta-POR), atypical (a) SDRs | Back alignment and domain information |
|---|
Score = 53.0 bits (128), Expect = 3e-08
Identities = 25/74 (33%), Positives = 33/74 (44%), Gaps = 5/74 (6%)
Query: 86 HDPPLREDLSRLPCQNFYCALEDLVASYM--PVISYSIHRSSIIIGSSSRSVYNSLLTLD 143
+ P RED RL NFY EDL+ ++S+ R IIG + + N LTL
Sbjct: 134 PEEPAREDPPRLLPPNFYYDQEDLLFEAAKGKGWTWSVLRPDAIIGFAPGNAMNLALTLA 193
Query: 144 V---ICKVFGVEFV 154
V IC+ G
Sbjct: 194 VYAAICRELGAPLR 207
|
5beta-POR catalyzes the reduction of progesterone to 5beta-pregnane-3,20-dione in Digitalis plants. This subgroup of atypical-extended SDRs, shares the structure of an extended SDR, but has a different glycine-rich nucleotide binding motif (GXXGXXG) and lacks the YXXXK active site motif of classical and extended SDRs. Tyr-179 and Lys 147 are present in the active site, but not in the usual SDR configuration. Given these differences, it has been proposed that this subfamily represents a new SDR class. Other atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 308 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 239 | |||
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 99.81 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 99.81 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 99.8 | |
| COG1087 | 329 | GalE UDP-glucose 4-epimerase [Cell envelope biogen | 99.8 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 99.8 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 99.79 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 99.78 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 99.77 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 99.77 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 99.76 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 99.76 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 99.76 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 99.75 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 99.75 | |
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 99.75 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 99.74 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 99.74 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 99.74 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 99.73 | |
| COG1088 | 340 | RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope | 99.73 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 99.73 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro | 99.73 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 99.72 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 99.72 | |
| PLN02725 | 306 | GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas | 99.72 | |
| COG0451 | 314 | WcaG Nucleoside-diphosphate-sugar epimerases [Cell | 99.71 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 99.71 | |
| PF01073 | 280 | 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso | 99.7 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 99.7 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 99.7 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 99.69 | |
| PRK10084 | 352 | dTDP-glucose 4,6 dehydratase; Provisional | 99.68 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 99.68 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 99.67 | |
| TIGR02197 | 314 | heptose_epim ADP-L-glycero-D-manno-heptose-6-epime | 99.67 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 99.66 | |
| PF01370 | 236 | Epimerase: NAD dependent epimerase/dehydratase fam | 99.62 | |
| KOG1430 | 361 | consensus C-3 sterol dehydrogenase/3-beta-hydroxys | 99.61 | |
| TIGR01179 | 328 | galE UDP-glucose-4-epimerase. This enzyme intercon | 99.61 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 99.61 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 99.6 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 99.59 | |
| PRK05865 | 854 | hypothetical protein; Provisional | 99.59 | |
| KOG1371 | 343 | consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo | 99.58 | |
| COG1091 | 281 | RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo | 99.56 | |
| KOG0747 | 331 | consensus Putative NAD+-dependent epimerases [Carb | 99.55 | |
| KOG1429 | 350 | consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro | 99.55 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 99.54 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 99.53 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 99.51 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 99.41 | |
| COG1090 | 297 | Predicted nucleoside-diphosphate sugar epimerase [ | 99.38 | |
| PF07993 | 249 | NAD_binding_4: Male sterility protein; InterPro: I | 99.29 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 99.28 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 99.26 | |
| COG1089 | 345 | Gmd GDP-D-mannose dehydratase [Cell envelope bioge | 99.24 | |
| KOG1431 | 315 | consensus GDP-L-fucose synthetase [Carbohydrate tr | 99.18 | |
| COG3320 | 382 | Putative dehydrogenase domain of multifunctional n | 99.18 | |
| TIGR01746 | 367 | Thioester-redct thioester reductase domain. It has | 99.18 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 99.17 | |
| PLN02996 | 491 | fatty acyl-CoA reductase | 99.11 | |
| PRK12320 | 699 | hypothetical protein; Provisional | 99.1 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 99.09 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 99.08 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 99.05 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 99.04 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 99.03 | |
| PLN02503 | 605 | fatty acyl-CoA reductase 2 | 98.91 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 98.9 | |
| COG0702 | 275 | Predicted nucleoside-diphosphate-sugar epimerases | 98.88 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 98.86 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.84 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 98.82 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 98.79 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 98.79 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 98.77 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.72 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 98.7 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 98.7 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 98.68 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 98.68 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 98.68 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 98.67 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 98.67 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 98.66 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 98.66 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 98.66 | |
| PRK07041 | 230 | short chain dehydrogenase; Provisional | 98.65 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 98.65 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 98.65 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 98.64 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 98.64 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 98.63 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 98.63 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 98.63 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 98.63 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 98.63 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.63 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 98.62 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 98.6 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 98.6 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.6 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 98.6 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 98.59 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 98.59 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 98.59 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 98.59 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 98.58 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 98.58 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 98.57 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 98.57 | |
| PRK09009 | 235 | C factor cell-cell signaling protein; Provisional | 98.57 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 98.56 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 98.55 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 98.55 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.54 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 98.54 | |
| PRK05717 | 255 | oxidoreductase; Validated | 98.54 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 98.53 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 98.53 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 98.53 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 98.53 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 98.52 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 98.52 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 98.52 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 98.52 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 98.51 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 98.51 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 98.51 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 98.51 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 98.51 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 98.51 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 98.51 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 98.51 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 98.5 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 98.5 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 98.5 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 98.5 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 98.5 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.49 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 98.49 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 98.49 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 98.49 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 98.49 | |
| PRK08643 | 256 | acetoin reductase; Validated | 98.48 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 98.48 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 98.48 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 98.48 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 98.48 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.48 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 98.48 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 98.47 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 98.46 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 98.46 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.46 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 98.46 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 98.45 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 98.45 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 98.45 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 98.45 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 98.45 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 98.45 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 98.45 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 98.45 | |
| TIGR01830 | 239 | 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re | 98.45 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 98.44 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 98.44 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 98.44 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 98.43 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 98.43 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 98.43 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 98.43 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 98.42 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 98.42 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 98.42 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 98.42 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 98.42 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 98.42 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 98.41 | |
| TIGR01829 | 242 | AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy | 98.41 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 98.4 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 98.4 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 98.39 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 98.39 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 98.39 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 98.39 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 98.39 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 98.39 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.39 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 98.39 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 98.39 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 98.38 | |
| PRK09730 | 247 | putative NAD(P)-binding oxidoreductase; Provisiona | 98.38 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.38 | |
| TIGR02685 | 267 | pter_reduc_Leis pteridine reductase. Pteridine red | 98.38 | |
| PRK07578 | 199 | short chain dehydrogenase; Provisional | 98.38 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 98.37 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 98.37 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 98.37 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 98.36 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 98.36 | |
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown speci | 98.36 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 98.35 | |
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 98.35 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 98.35 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.35 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 98.35 | |
| KOG2865 | 391 | consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 | 98.35 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 98.35 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 98.34 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 98.34 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 98.33 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 98.33 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.32 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 98.32 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 98.32 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 98.31 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 98.31 | |
| TIGR01831 | 239 | fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas | 98.31 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 98.31 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 98.3 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 98.3 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 98.29 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 98.27 | |
| PRK06123 | 248 | short chain dehydrogenase; Provisional | 98.27 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 98.27 | |
| PLN00015 | 308 | protochlorophyllide reductase | 98.27 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 98.25 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 98.24 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 98.23 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 98.23 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 98.23 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 98.23 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 98.22 | |
| smart00822 | 180 | PKS_KR This enzymatic domain is part of bacterial | 98.21 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 98.21 | |
| KOG1205 | 282 | consensus Predicted dehydrogenase [Secondary metab | 98.21 | |
| KOG1221 | 467 | consensus Acyl-CoA reductase [Lipid transport and | 98.2 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 98.18 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 98.17 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 98.17 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.15 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 98.14 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 98.14 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 98.13 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 98.13 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 98.12 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 98.12 | |
| KOG1372 | 376 | consensus GDP-mannose 4,6 dehydratase [Carbohydrat | 98.11 | |
| TIGR01500 | 256 | sepiapter_red sepiapterin reductase. This model de | 98.09 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 98.08 | |
| PRK05599 | 246 | hypothetical protein; Provisional | 98.07 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 98.07 | |
| PF08659 | 181 | KR: KR domain; InterPro: IPR013968 This domain is | 98.07 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 98.06 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 98.04 | |
| PRK08309 | 177 | short chain dehydrogenase; Provisional | 98.04 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 98.04 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 98.02 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 98.02 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 98.02 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 98.0 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.99 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 97.97 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.97 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.94 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.89 | |
| KOG4039 | 238 | consensus Serine/threonine kinase TIP30/CC3 [Signa | 97.87 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.87 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.85 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 97.84 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.83 | |
| KOG1209 | 289 | consensus 1-Acyl dihydroxyacetone phosphate reduct | 97.77 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.77 | |
| KOG1014 | 312 | consensus 17 beta-hydroxysteroid dehydrogenase typ | 97.74 | |
| KOG1208 | 314 | consensus Dehydrogenases with different specificit | 97.72 | |
| PRK09620 | 229 | hypothetical protein; Provisional | 97.6 | |
| PRK06732 | 229 | phosphopantothenate--cysteine ligase; Validated | 97.54 | |
| COG1028 | 251 | FabG Dehydrogenases with different specificities ( | 97.54 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 97.47 | |
| TIGR00715 | 256 | precor6x_red precorrin-6x reductase. This enzyme w | 97.46 | |
| COG3967 | 245 | DltE Short-chain dehydrogenase involved in D-alani | 97.45 | |
| KOG1207 | 245 | consensus Diacetyl reductase/L-xylulose reductase | 97.45 | |
| KOG4288 | 283 | consensus Predicted oxidoreductase [General functi | 97.45 | |
| KOG1203 | 411 | consensus Predicted dehydrogenase [Carbohydrate tr | 97.45 | |
| PRK05579 | 399 | bifunctional phosphopantothenoylcysteine decarboxy | 97.39 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 97.33 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 97.19 | |
| cd01336 | 325 | MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli | 97.11 | |
| KOG0725 | 270 | consensus Reductases with broad range of substrate | 97.1 | |
| KOG1200 | 256 | consensus Mitochondrial/plastidial beta-ketoacyl-A | 97.09 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 97.04 | |
| KOG1611 | 249 | consensus Predicted short chain-type dehydrogenase | 96.97 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 96.95 | |
| KOG1210 | 331 | consensus Predicted 3-ketosphinganine reductase [S | 96.88 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 96.77 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 96.75 | |
| PF13561 | 241 | adh_short_C2: Enoyl-(Acyl carrier protein) reducta | 96.65 | |
| TIGR02114 | 227 | coaB_strep phosphopantothenate--cysteine ligase, s | 96.53 | |
| PRK13656 | 398 | trans-2-enoyl-CoA reductase; Provisional | 96.42 | |
| TIGR00521 | 390 | coaBC_dfp phosphopantothenoylcysteine decarboxylas | 96.37 | |
| PF13950 | 62 | Epimerase_Csub: UDP-glucose 4-epimerase C-term sub | 96.23 | |
| PRK12428 | 241 | 3-alpha-hydroxysteroid dehydrogenase; Provisional | 96.23 | |
| KOG2774 | 366 | consensus NAD dependent epimerase [General functio | 95.92 | |
| PRK06300 | 299 | enoyl-(acyl carrier protein) reductase; Provisiona | 95.85 | |
| KOG1610 | 322 | consensus Corticosteroid 11-beta-dehydrogenase and | 95.82 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 95.61 | |
| KOG1199 | 260 | consensus Short-chain alcohol dehydrogenase/3-hydr | 95.55 | |
| KOG1478 | 341 | consensus 3-keto sterol reductase [Lipid transport | 95.51 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 95.33 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 95.32 | |
| KOG3019 | 315 | consensus Predicted nucleoside-diphosphate sugar e | 95.17 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 95.1 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 95.08 | |
| KOG2733 | 423 | consensus Uncharacterized membrane protein [Functi | 94.48 | |
| TIGR01296 | 339 | asd_B aspartate-semialdehyde dehydrogenase (peptid | 94.45 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 93.93 | |
| PLN00106 | 323 | malate dehydrogenase | 93.54 | |
| TIGR01758 | 324 | MDH_euk_cyt malate dehydrogenase, NAD-dependent. T | 93.51 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 93.5 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 93.5 | |
| cd00704 | 323 | MDH Malate dehydrogenase. Malate dehydrogenase (MD | 93.3 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 92.96 | |
| KOG4288 | 283 | consensus Predicted oxidoreductase [General functi | 92.78 | |
| PRK05086 | 312 | malate dehydrogenase; Provisional | 92.58 | |
| PF04127 | 185 | DFP: DNA / pantothenate metabolism flavoprotein; I | 92.57 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 92.47 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 92.02 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 91.99 | |
| TIGR01142 | 380 | purT phosphoribosylglycinamide formyltransferase 2 | 91.96 | |
| PLN02383 | 344 | aspartate semialdehyde dehydrogenase | 91.53 | |
| PRK08664 | 349 | aspartate-semialdehyde dehydrogenase; Reviewed | 91.43 | |
| COG3268 | 382 | Uncharacterized conserved protein [Function unknow | 91.17 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 90.93 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 90.86 | |
| KOG1198 | 347 | consensus Zinc-binding oxidoreductase [Energy prod | 90.69 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 90.43 | |
| PRK06019 | 372 | phosphoribosylaminoimidazole carboxylase ATPase su | 90.0 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 89.88 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.84 | |
| PRK09288 | 395 | purT phosphoribosylglycinamide formyltransferase 2 | 89.61 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 89.57 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 89.15 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 89.07 | |
| TIGR00978 | 341 | asd_EA aspartate-semialdehyde dehydrogenase (non-p | 88.42 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 88.26 | |
| TIGR01161 | 352 | purK phosphoribosylaminoimidazole carboxylase, Pur | 88.17 | |
| PRK06598 | 369 | aspartate-semialdehyde dehydrogenase; Reviewed | 88.07 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 88.0 | |
| PRK05671 | 336 | aspartate-semialdehyde dehydrogenase; Reviewed | 87.93 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 86.54 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 86.33 | |
| cd08259 | 332 | Zn_ADH5 Alcohol dehydrogenases of the MDR family. | 86.0 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 85.21 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 84.75 | |
| PRK08057 | 248 | cobalt-precorrin-6x reductase; Reviewed | 84.39 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 84.38 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 83.95 | |
| PRK11863 | 313 | N-acetyl-gamma-glutamyl-phosphate reductase; Provi | 83.86 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 83.66 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 83.57 | |
| smart00859 | 122 | Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin | 83.55 | |
| PRK06444 | 197 | prephenate dehydrogenase; Provisional | 83.51 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 83.01 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 82.85 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 82.72 | |
| PRK06849 | 389 | hypothetical protein; Provisional | 82.72 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 82.39 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 82.38 | |
| PF02670 | 129 | DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re | 82.29 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 81.69 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 81.51 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 81.28 | |
| COG0287 | 279 | TyrA Prephenate dehydrogenase [Amino acid transpor | 81.27 | |
| COG0026 | 375 | PurK Phosphoribosylaminoimidazole carboxylase (NCA | 80.79 | |
| PRK08040 | 336 | putative semialdehyde dehydrogenase; Provisional | 80.77 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 80.71 | |
| PRK13982 | 475 | bifunctional SbtC-like/phosphopantothenoylcysteine | 80.55 | |
| KOG0023 | 360 | consensus Alcohol dehydrogenase, class V [Secondar | 80.49 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 80.32 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 80.22 |
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
Probab=99.81 E-value=6.4e-19 Score=154.95 Aligned_cols=119 Identities=15% Similarity=0.027 Sum_probs=83.5
Q ss_pred CeecccChhHHHHHHHhhcCCCCCCCcEEEEEecCCCCCC--C----------CCCCceeeEeecCCCchhHHHHHhccc
Q 048469 1 MVIGIVSMADLSFTEALKSPIALGGPWEVYGSAWCPKQSW--F----------PSSAVDHYITFDATNSGNTTEKLSLLF 68 (239)
Q Consensus 1 LVtGatG~iG~~lv~~L~~~~~~~~g~~V~~l~R~~~~~~--~----------~~~~v~~~~~~Dl~d~~~~~~~l~~~~ 68 (239)
||||||||||++|+++|+ .+||+|++++|.+.... . ...+++ ++.+|++|.+.+.+++++
T Consensus 19 lVtGatGfiG~~lv~~L~-----~~g~~V~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~Di~d~~~l~~~~~~-- 90 (348)
T PRK15181 19 LITGVAGFIGSGLLEELL-----FLNQTVIGLDNFSTGYQHNLDDVRTSVSEEQWSRFI-FIQGDIRKFTDCQKACKN-- 90 (348)
T ss_pred EEECCccHHHHHHHHHHH-----HCCCEEEEEeCCCCcchhhhhhhhhccccccCCceE-EEEccCCCHHHHHHHhhC--
Confidence 699999999999999999 78999999998643210 0 013578 899999999988888875
Q ss_pred CcceEEEccc---------------------------------------------cccCCCCCCCCCCCCCCCCCCCcch
Q 048469 69 NEITHVHDPA---------------------------------------------HSAHANSHDPPLREDLSRLPCQNFY 103 (239)
Q Consensus 69 ~~v~~v~~~a---------------------------------------------~yg~~~~~~~p~~E~~~~~~~~~~y 103 (239)
+++|+|+| +||. ....|..|+++..| .+.|
T Consensus 91 --~d~ViHlAa~~~~~~~~~~~~~~~~~Nv~gt~nll~~~~~~~~~~~v~~SS~~vyg~--~~~~~~~e~~~~~p-~~~Y 165 (348)
T PRK15181 91 --VDYVLHQAALGSVPRSLKDPIATNSANIDGFLNMLTAARDAHVSSFTYAASSSTYGD--HPDLPKIEERIGRP-LSPY 165 (348)
T ss_pred --CCEEEECccccCchhhhhCHHHHHHHHHHHHHHHHHHHHHcCCCeEEEeechHhhCC--CCCCCCCCCCCCCC-CChh
Confidence 45666654 2331 12345567665432 2344
Q ss_pred H----HHHHHHHh--cCCCceEEEeccCceeccCC
Q 048469 104 C----ALEDLVAS--YMPVISYSIHRSSIIIGSSS 132 (239)
Q Consensus 104 ~----~~e~~l~~--~~~~~~~~ilRp~~i~G~~~ 132 (239)
. ..|.++.. ...+++++++||++||||+.
T Consensus 166 ~~sK~~~e~~~~~~~~~~~~~~~~lR~~~vyGp~~ 200 (348)
T PRK15181 166 AVTKYVNELYADVFARSYEFNAIGLRYFNVFGRRQ 200 (348)
T ss_pred hHHHHHHHHHHHHHHHHhCCCEEEEEecceeCcCC
Confidence 3 34555443 45689999999999999964
|
|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PRK10217 dTDP-glucose 4,6-dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase | Back alignment and domain information |
|---|
| >COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK10084 dTDP-glucose 4,6 dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor | Back alignment and domain information |
|---|
| >KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01179 galE UDP-glucose-4-epimerase | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >PRK05865 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR01746 Thioester-redct thioester reductase domain | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >PLN02996 fatty acyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK12320 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PLN02503 fatty acyl-CoA reductase 2 | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07041 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09009 C factor cell-cell signaling protein; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07023 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07069 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09730 putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02685 pter_reduc_Leis pteridine reductase | Back alignment and domain information |
|---|
| >PRK07578 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06123 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN00015 protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01500 sepiapter_red sepiapterin reductase | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05599 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08309 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06997 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK09620 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06732 phosphopantothenate--cysteine ligase; Validated | Back alignment and domain information |
|---|
| >COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR00715 precor6x_red precorrin-6x reductase | Back alignment and domain information |
|---|
| >COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG4288 consensus Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases | Back alignment and domain information |
|---|
| >KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B | Back alignment and domain information |
|---|
| >TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal | Back alignment and domain information |
|---|
| >PRK13656 trans-2-enoyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic | Back alignment and domain information |
|---|
| >PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A | Back alignment and domain information |
|---|
| >PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2774 consensus NAD dependent epimerase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06300 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >KOG2733 consensus Uncharacterized membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >cd00704 MDH Malate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >KOG4288 consensus Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05086 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 | Back alignment and domain information |
|---|
| >PLN02383 aspartate semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG3268 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein | Back alignment and domain information |
|---|
| >PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08057 cobalt-precorrin-6x reductase; Reviewed | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >PRK06444 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK06849 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08040 putative semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional | Back alignment and domain information |
|---|
| >KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 239 | ||||
| 2v6f_A | 364 | Structure Of Progesterone 5beta-Reductase From Digi | 3e-06 |
| >pdb|2V6F|A Chain A, Structure Of Progesterone 5beta-Reductase From Digitalis Lanata Length = 364 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 239 | |||
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 1e-15 |
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 | Back alignment and structure |
|---|
Score = 74.4 bits (182), Expect = 1e-15
Identities = 75/347 (21%), Positives = 118/347 (34%), Gaps = 123/347 (35%)
Query: 12 SFTEALKSPIALGGPWEVYGSAWCPKQSWFPSSAVDHYITFDATNSGNTTEKLSLLFNEI 71
S E L GGPW+VYG A + +W + +++ + D ++ ++ KLS L ++
Sbjct: 16 SLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPINY-VQCDISDPDDSQAKLSPL-TDV 73
Query: 72 THVHDPAHSAHAN----------------------------------------------- 84
THV + +
Sbjct: 74 THVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGK 133
Query: 85 --SHDPPLREDLSRLPCQNFYCALEDLVASYM---PVISYSIHRSSIIIGSSSRSVYNSL 139
SHDPP EDL RL NFY LED++ + +++S+HR I G S S+ N +
Sbjct: 134 IESHDPPYTEDLPRLKYMNFYYDLEDIMLEEVEKKEGLTWSVHRPGNIFGFSPYSMMNLV 193
Query: 140 LTLDV---ICKVFGVEFV------PFDENDDFDFVGM---------MKPKAK-------- 173
TL V ICK G +D D + + P AK
Sbjct: 194 GTLCVYAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSN 253
Query: 174 --------VWDEIAE---------------------------------QHGLYNINKLEE 192
W +AE ++GL KL++
Sbjct: 254 GDVFKWKHFWKVLAEQFGVECGEYEEGVDLKLQDLMKGKEPVWEEIVRENGLTP-TKLKD 312
Query: 193 ITCFEALINVLHFGFQHVCSMNKSREFGFFKFADTLKSLGMWVTKLR 239
+ + +L + SMNKS+E GF F ++ + W+ K +
Sbjct: 313 VGIWWFGDVILGN-ECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAK 358
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 239 | |||
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 99.93 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 99.86 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 99.85 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 99.84 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 99.84 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 99.83 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 99.83 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 99.82 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 99.82 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 99.82 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 99.82 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 99.81 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 99.8 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 99.8 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 99.79 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 99.79 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 99.79 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 99.79 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 99.78 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 99.78 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 99.78 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 99.78 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 99.77 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 99.77 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 99.77 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 99.77 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 99.76 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 99.76 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 99.76 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 99.76 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 99.75 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 99.75 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 99.75 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 99.75 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 99.75 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 99.75 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 99.73 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 99.73 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 99.73 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 99.73 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 99.72 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 99.72 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 99.72 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 99.72 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 99.72 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 99.72 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 99.71 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 99.71 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 99.71 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 99.71 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 99.7 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 99.7 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 99.7 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 99.68 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 99.68 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 99.68 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 99.64 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 99.62 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 99.61 | |
| 2ggs_A | 273 | 273AA long hypothetical DTDP-4-dehydrorhamnose red | 99.59 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 99.57 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 99.56 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 99.53 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 99.51 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 99.51 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 99.5 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 99.5 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 99.49 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 99.49 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 99.45 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 99.45 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 99.41 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 99.38 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 99.35 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 99.33 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 99.32 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 99.31 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 99.29 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 99.28 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 99.27 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 99.26 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 99.26 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 99.26 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 99.25 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 99.22 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 99.2 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 99.19 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 99.16 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 99.14 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 99.03 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 98.98 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 98.98 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 98.95 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 98.94 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 98.92 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 98.9 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 98.88 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 98.87 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 98.86 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 98.86 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 98.85 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 98.85 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 98.85 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 98.84 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 98.84 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 98.83 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 98.82 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 98.81 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 98.81 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 98.8 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 98.8 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 98.76 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 98.76 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 98.76 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 98.76 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 98.76 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 98.75 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 98.75 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 98.74 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 98.74 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 98.74 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 98.74 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 98.74 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 98.73 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 98.73 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 98.73 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 98.73 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 98.73 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 98.72 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 98.72 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 98.72 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 98.72 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 98.72 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 98.71 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 98.71 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 98.71 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 98.7 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 98.7 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 98.69 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 98.69 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 98.69 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 98.69 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 98.69 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 98.68 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 98.68 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 98.68 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 98.68 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 98.68 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 98.68 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 98.67 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 98.67 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 98.67 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 98.67 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 98.67 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 98.67 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 98.66 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 98.66 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 98.66 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 98.66 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 98.66 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 98.66 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 98.66 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 98.65 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 98.65 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 98.65 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 98.65 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 98.64 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 98.64 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 98.64 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 98.64 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 98.64 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 98.64 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 98.64 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 98.64 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 98.64 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 98.64 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 98.64 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 98.64 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 98.64 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 98.64 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 98.63 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 98.63 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 98.63 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 98.63 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 98.63 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 98.63 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 98.63 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 98.63 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 98.62 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 98.62 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 98.62 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 98.62 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 98.62 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 98.62 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 98.62 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 98.62 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 98.62 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 98.61 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 98.61 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 98.61 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 98.61 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 98.61 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 98.61 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 98.61 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 98.61 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 98.61 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 98.6 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 98.6 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 98.6 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 98.6 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 98.6 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 98.6 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 98.6 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 98.6 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 98.59 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 98.59 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 98.59 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 98.59 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 98.59 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 98.59 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 98.59 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 98.58 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 98.58 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 98.58 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 98.57 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 98.57 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 98.57 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 98.57 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 98.57 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 98.57 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 98.57 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 98.57 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 98.57 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 98.57 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 98.57 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 98.57 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 98.57 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 98.56 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 98.56 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 98.56 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 98.55 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 98.55 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 98.55 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 98.55 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 98.55 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 98.55 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 98.55 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 98.55 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 98.54 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 98.54 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 98.54 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 98.54 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 98.54 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 98.53 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 98.53 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 98.53 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 98.52 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 98.52 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 98.51 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 98.51 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 98.51 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 98.5 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 98.5 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 98.5 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 98.5 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 98.49 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 98.49 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 98.48 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 98.47 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 98.46 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 98.46 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 98.45 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 98.44 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 98.44 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 98.43 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 98.43 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 98.42 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 98.42 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 98.42 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 98.42 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 98.4 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 98.37 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 98.37 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 98.34 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 98.33 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 98.31 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 98.29 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 98.28 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 98.28 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 98.27 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 98.24 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 98.24 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 98.21 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 98.21 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 98.16 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 98.15 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 98.14 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 97.96 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 97.91 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 97.87 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 97.87 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 97.86 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 97.82 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 97.76 | |
| 2gk4_A | 232 | Conserved hypothetical protein; alpha-beta-alpha s | 97.68 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 97.67 | |
| 3lt0_A | 329 | Enoyl-ACP reductase; triclosan, triclosan variant, | 97.64 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 97.62 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 97.6 | |
| 2o2s_A | 315 | Enoyl-acyl carrier reductase; enoyl reductase, tri | 97.58 | |
| 1u7z_A | 226 | Coenzyme A biosynthesis bifunctional protein coabc | 97.56 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 97.51 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 97.5 | |
| 2ptg_A | 319 | Enoyl-acyl carrier reductase; apicomplexa, enoyl ( | 97.43 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 97.42 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 97.41 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 97.34 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 97.32 | |
| 1d7o_A | 297 | Enoyl-[acyl-carrier protein] reductase (NADH) PRE; | 97.28 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 97.27 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 97.13 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 97.08 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 97.04 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 97.03 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 96.96 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 96.94 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 96.79 | |
| 4ggo_A | 401 | Trans-2-enoyl-COA reductase; rossmann fold, oxidor | 96.72 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 96.61 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 96.34 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 96.28 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 96.27 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 96.09 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 95.93 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 95.91 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 95.83 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 95.73 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 95.54 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 95.51 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 94.63 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 94.54 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 94.5 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 94.3 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 94.01 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 93.7 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 93.35 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 93.06 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 92.88 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 92.55 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 91.96 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 91.93 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 91.62 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 91.4 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 91.26 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 91.19 | |
| 2nqt_A | 352 | N-acetyl-gamma-glutamyl-phosphate reductase; apopr | 91.13 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 91.08 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 90.94 | |
| 1p9o_A | 313 | Phosphopantothenoylcysteine synthetase; ligase; 2. | 90.85 | |
| 1ys4_A | 354 | Aspartate-semialdehyde dehydrogenase; oxidoreducta | 90.84 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 90.84 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 90.81 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 90.38 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 90.33 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 90.16 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 90.11 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 90.05 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 89.77 | |
| 1xyg_A | 359 | Putative N-acetyl-gamma-glutamyl-phosphate reduct; | 89.7 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 89.64 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 89.55 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 89.48 | |
| 2ozp_A | 345 | N-acetyl-gamma-glutamyl-phosphate reductase; amino | 89.41 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 89.25 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 89.14 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 89.05 | |
| 1t4b_A | 367 | Aspartate-semialdehyde dehydrogenase; asadh, HOSR, | 88.76 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 88.62 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 88.57 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 88.25 | |
| 1tt7_A | 330 | YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st | 88.23 | |
| 3pzr_A | 370 | Aspartate-semialdehyde dehydrogenase; NADP, oxidor | 88.19 | |
| 3dr3_A | 337 | N-acetyl-gamma-glutamyl-phosphate reductase; csgid | 88.17 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 88.1 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 87.72 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 87.63 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 86.92 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 86.91 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 86.83 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 86.79 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 86.72 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 86.45 | |
| 5mdh_A | 333 | Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH | 86.01 | |
| 3ax6_A | 380 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 85.92 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 85.73 | |
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 85.73 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 85.19 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 85.17 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 84.89 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 84.86 | |
| 2r00_A | 336 | Aspartate-semialdehyde dehydrogenase; conformation | 84.78 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 84.77 | |
| 1vm6_A | 228 | DHPR, dihydrodipicolinate reductase; TM1520, struc | 84.69 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 84.63 | |
| 2ep5_A | 350 | 350AA long hypothetical aspartate-semialdehyde deh | 84.54 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 84.49 | |
| 2hjs_A | 340 | USG-1 protein homolog; aspartate-semialdehyde dehy | 84.28 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 84.26 | |
| 2dwc_A | 433 | PH0318, 433AA long hypothetical phosphoribosylglyc | 83.83 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 83.71 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 83.71 | |
| 4dpl_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 83.49 | |
| 4dpk_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 83.49 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 83.28 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 83.27 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 83.0 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 82.88 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 82.78 | |
| 4ffl_A | 363 | PYLC; amino acid, biosynthesis of pyrrolysine, iso | 82.69 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 82.42 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 82.35 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 82.34 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 82.01 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 81.84 | |
| 1vkn_A | 351 | N-acetyl-gamma-glutamyl-phosphate reductase; TM178 | 81.57 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 81.2 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 80.9 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 80.4 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 80.3 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 80.17 | |
| 3hsk_A | 381 | Aspartate-semialdehyde dehydrogenase; candida albi | 80.17 |
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
Probab=99.93 E-value=1e-23 Score=183.74 Aligned_cols=130 Identities=32% Similarity=0.594 Sum_probs=98.2
Q ss_pred CeecccChhHHHHHHHhhcCCCCCCC-----cEEEEEecCCCCCCCCCCCceeeEeecCCCchhHHHHHhcccCcceEEE
Q 048469 1 MVIGIVSMADLSFTEALKSPIALGGP-----WEVYGSAWCPKQSWFPSSAVDHYITFDATNSGNTTEKLSLLFNEITHVH 75 (239)
Q Consensus 1 LVtGatG~iG~~lv~~L~~~~~~~~g-----~~V~~l~R~~~~~~~~~~~v~~~~~~Dl~d~~~~~~~l~~~~~~v~~v~ 75 (239)
||||||||||++|+++|+ ++| |+|++++|++........+++ ++.+|++|++++.+++++... +|+|+
T Consensus 5 lVtGatG~iG~~l~~~L~-----~~g~~~~~~~V~~~~r~~~~~~~~~~~~~-~~~~Dl~d~~~~~~~~~~~~~-~d~vi 77 (364)
T 2v6g_A 5 LIVGVTGIIGNSLAEILP-----LADTPGGPWKVYGVARRTRPAWHEDNPIN-YVQCDISDPDDSQAKLSPLTD-VTHVF 77 (364)
T ss_dssp EEETTTSHHHHHHHHHTT-----STTCTTCSEEEEEEESSCCCSCCCSSCCE-EEECCTTSHHHHHHHHTTCTT-CCEEE
T ss_pred EEECCCcHHHHHHHHHHH-----hCCCCCCceEEEEEeCCCCccccccCceE-EEEeecCCHHHHHHHHhcCCC-CCEEE
Confidence 699999999999999999 788 999999998654322345788 999999999999999987543 67788
Q ss_pred ccc--------------------------cc--c---------------C---CCC---CCCCCCCCCCCCCCCcchHHH
Q 048469 76 DPA--------------------------HS--A---------------H---ANS---HDPPLREDLSRLPCQNFYCAL 106 (239)
Q Consensus 76 ~~a--------------------------~y--g---------------~---~~~---~~~p~~E~~~~~~~~~~y~~~ 106 (239)
|+| .. + . .+. ...|++|+++..+.++.|+..
T Consensus 78 h~a~~~~~~~~~~~~~n~~~~~~l~~a~~~~~~~~~~~v~~~g~~i~~Ss~~vyg~~~~~~~~~~E~~~~~~~~~~y~~~ 157 (364)
T 2v6g_A 78 YVTWANRSTEQENCEANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMNFYYDL 157 (364)
T ss_dssp ECCCCCCSSHHHHHHHHHHHHHHHHHHHTTTCTTCCEEEEECCTHHHHCCGGGTTTSCCCCSSBCTTSCCCSSCCHHHHH
T ss_pred ECCCCCcchHHHHHHHhHHHHHHHHHHHHHhccccceEEeccCceEEEechhhccccccCCCCCCccccCCccchhhHHH
Confidence 775 01 0 0 000 124678887755445678888
Q ss_pred HHHHHh--cCCC-ceEEEeccCceeccCCCcccc
Q 048469 107 EDLVAS--YMPV-ISYSIHRSSIIIGSSSRSVYN 137 (239)
Q Consensus 107 e~~l~~--~~~~-~~~~ilRp~~i~G~~~~~~~~ 137 (239)
|+++.+ ...+ ++++++||+.|||++..+..+
T Consensus 158 E~~~~~~~~~~~~~~~~ilRp~~v~G~~~~~~~~ 191 (364)
T 2v6g_A 158 EDIMLEEVEKKEGLTWSVHRPGNIFGFSPYSMMN 191 (364)
T ss_dssp HHHHHHHHTTSTTCEEEEEEESSEECCCTTCSSC
T ss_pred HHHHHHHhhcCCCceEEEECCCceeCCCCCcccc
Confidence 998877 3455 999999999999997654333
|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* | Back alignment and structure |
|---|
| >1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 | Back alignment and structure |
|---|
| >1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* | Back alignment and structure |
|---|
| >3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A | Back alignment and structure |
|---|
| >3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* | Back alignment and structure |
|---|
| >3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* | Back alignment and structure |
|---|
| >2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A | Back alignment and structure |
|---|
| >2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* | Back alignment and structure |
|---|
| >4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A | Back alignment and structure |
|---|
| >1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 239 | |||
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 99.88 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 99.85 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 99.84 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 99.83 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 99.83 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 99.82 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 99.82 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 99.81 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 99.8 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 99.8 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 99.79 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 99.78 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 99.78 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 99.78 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 99.77 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 99.77 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 99.77 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 99.74 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 99.72 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 99.69 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 99.58 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 99.56 | |
| d1eq2a_ | 307 | ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric | 99.55 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 99.52 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 99.47 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 99.44 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 99.36 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 99.34 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 99.25 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 99.05 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 98.64 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 98.64 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 98.62 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 98.51 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 98.47 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 98.47 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 98.47 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 98.46 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 98.46 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 98.45 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 98.44 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 98.44 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 98.43 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 98.42 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 98.42 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 98.42 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 98.42 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 98.42 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 98.4 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 98.4 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 98.39 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 98.39 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 98.38 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 98.38 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 98.37 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 98.37 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 98.35 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 98.34 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 98.34 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 98.34 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 98.32 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 98.32 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 98.31 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 98.3 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 98.29 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 98.29 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 98.29 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 98.27 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 98.27 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 98.26 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 98.25 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 98.23 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 98.22 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 98.21 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 98.21 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 98.19 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 98.18 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 98.18 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 98.17 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 98.07 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 98.06 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 98.06 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 98.04 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 97.92 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 97.85 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 97.84 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 97.83 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 97.8 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 97.75 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 97.7 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 97.69 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 97.63 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 97.47 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 97.46 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 97.46 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 96.93 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 96.68 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.42 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 96.24 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 95.8 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 95.71 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 95.65 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 95.44 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 94.94 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 94.8 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 94.42 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 94.37 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 94.18 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 93.99 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 93.72 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 93.62 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 93.34 | |
| d2g17a1 | 179 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 93.14 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 93.11 | |
| d1vkna1 | 176 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 92.87 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 92.85 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 92.72 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 92.41 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 92.34 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 92.24 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 91.43 | |
| d1uh5a_ | 329 | Enoyl-ACP reductase {Malaria parasite (Plasmodium | 90.87 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 90.74 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 90.64 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 90.31 | |
| d1diha1 | 162 | Dihydrodipicolinate reductase {Escherichia coli [T | 90.25 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 90.12 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 90.12 | |
| d1u7za_ | 223 | Coenzyme A biosynthesis bifunctional protein CoaBC | 89.66 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 89.28 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 89.27 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 89.23 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 88.53 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 88.02 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 87.88 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 87.26 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 87.11 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 87.08 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 86.94 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 86.93 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 86.63 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 86.63 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 86.3 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 85.98 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 85.73 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 85.66 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 85.61 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 85.37 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 84.75 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 84.61 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 84.58 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 84.37 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 84.14 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 83.94 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 83.77 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 83.53 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 83.36 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 83.04 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 82.27 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 82.17 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 81.27 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 81.26 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 81.03 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 80.9 | |
| d1r0ka2 | 150 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z | 80.78 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 80.69 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 80.48 |
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: GDP-mannose 4,6-dehydratase species: Escherichia coli [TaxId: 562]
Probab=99.88 E-value=6e-23 Score=177.45 Aligned_cols=122 Identities=12% Similarity=-0.011 Sum_probs=89.7
Q ss_pred CeecccChhHHHHHHHhhcCCCCCCCcEEEEEecCCCCC------------CCCCCCceeeEeecCCCchhHHHHHhccc
Q 048469 1 MVIGIVSMADLSFTEALKSPIALGGPWEVYGSAWCPKQS------------WFPSSAVDHYITFDATNSGNTTEKLSLLF 68 (239)
Q Consensus 1 LVtGatG~iG~~lv~~L~~~~~~~~g~~V~~l~R~~~~~------------~~~~~~v~~~~~~Dl~d~~~~~~~l~~~~ 68 (239)
||||||||||++|+++|+ +.||+|++++|.+... ....++++ ++.+|++|.+++.+++++..
T Consensus 5 LITGatGfiGs~lv~~Ll-----~~g~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~Dl~d~~~~~~~~~~~~ 78 (357)
T d1db3a_ 5 LITGVTGQDGSYLAEFLL-----EKGYEVHGIKRRASSFNTERVDHIYQDPHTCNPKFH-LHYGDLSDTSNLTRILREVQ 78 (357)
T ss_dssp EEETTTSHHHHHHHHHHH-----HTTCEEEEECC---------------------CCEE-ECCCCSSCHHHHHHHHHHHC
T ss_pred EEeCCCcHHHHHHHHHHH-----HCcCEEEEEECCCcccchhhHHHHHhhhhhcCCCeE-EEEeecCCHHHHHHHHhccC
Confidence 699999999999999999 7899999999964310 11245788 99999999999999999875
Q ss_pred CcceEEEccc------------------------------------------------cccCCCCCCCCCCCCCCCCCCC
Q 048469 69 NEITHVHDPA------------------------------------------------HSAHANSHDPPLREDLSRLPCQ 100 (239)
Q Consensus 69 ~~v~~v~~~a------------------------------------------------~yg~~~~~~~p~~E~~~~~~~~ 100 (239)
+|+|+|+| +|| .+...|++|+++..| .
T Consensus 79 --~d~v~h~aa~~~~~~~~~~~~~~~~~Nv~gt~nllea~~~~~~~~~~r~i~~SS~~vYG--~~~~~~~~E~~~~~P-~ 153 (357)
T d1db3a_ 79 --PDEVYNLGAMSHVAVSFESPEYTADVDAMGTLRLLEAIRFLGLEKKTRFYQASTSELYG--LVQEIPQKETTPFYP-R 153 (357)
T ss_dssp --CSEEEECCCCCTTTTTTSCHHHHHHHHTHHHHHHHHHHHHTTCTTTCEEEEEEEGGGGT--TCCSSSBCTTSCCCC-C
T ss_pred --CCEEEEeecccccchhhhCHHHHHHHHHHHHHHHHHHHHHhCCCCCcEEEEEEchhhhC--CCCCCCcCCCCCCCC-C
Confidence 67777765 233 233468899987643 2
Q ss_pred cchH----HHHHHHHh--cCCCceEEEeccCceeccCCC
Q 048469 101 NFYC----ALEDLVAS--YMPVISYSIHRSSIIIGSSSR 133 (239)
Q Consensus 101 ~~y~----~~e~~l~~--~~~~~~~~ilRp~~i~G~~~~ 133 (239)
+.|. ..|+++.. +..+++++++||++||||..+
T Consensus 154 ~~Y~~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~ 192 (357)
T d1db3a_ 154 SPYAVAKLYAYWITVNYRESYGMYACNGILFNHESPRRG 192 (357)
T ss_dssp SHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCEECTTSC
T ss_pred ChHHHHHHHHHHHHHHHHHHhCCCEEEEEeccccCCCCC
Confidence 4453 34665554 345899999999999999643
|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|