Citrus Sinensis ID: 048757

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860----
LLGSSPCLWSSLDLRPYKFDTSAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINVEFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREVNGDAINALAKQCRQLVEVGFIDSGGVDEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKLTSLVGLDTSRTNINLSSVTRLLSSSRNLKVLIALNCPVFEAEADTSMMYNQKGKVVLSLISEIFKGVASLFSDTTEINNGAFQNWRKLKVRDRISDEIVSWIERVLSHSLMRISKKNPKEFDDFWLRQGATLLLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLARSPPEGLQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEEVVGGLWNLSVGEDHKGAIARAGGIKALVDLIFKWSSWNDGVLERAAGALANLAADDKCSLEVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQLTFSKHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVRSCSSSSQGLQERAAGALWGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNALCIVEGGGVQALIHLCSSSLSKMARFMAALALAYIVDGRMEDIASIGSSLEGTSESENLDVIRRMALKHIEDFCAGRIALKHIEDFVRSFSDPQAFATALASAVPKSLAQITEGARIPEAAHLRCSGAEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTAAAAIAPVEAKIFAKIVLRNLEHHQNQHVEASI
ccccccccccccccccccccHHHHHHHHHccccccEEEccccccHHHHHHHHccccccccccccccccHHHHHHHHHHcccHHHHcccccccccccHHHHHHHHHHcccccHHccccccccHHHHHHHHHHHccccHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHcccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccHHHcccccHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccc
cccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHHHHHHHcccccHHHHccHHHHHHHHHHcHHHHHHEEcccHcccHHHHHHHHHHcccHHHEEEEccccccHHHHHcccEEEEEEEccccccHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHcccccEEEEEEccccccccccccccHcccccEEEEEcHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccHcHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHcHHHHccccccHcHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccc
llgsspclwssldlrpykfdtsAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINVEFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREVNGDAINALAKQCRQLVEVGfidsggvdEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKLTSLVgldtsrtninLSSVTRLLSSSRNLKVLIALncpvfeaeadtsmmynQKGKVVLSLISEIFKGVASLFSDTTEINNGAFQNWRKLKVRDRISDEIVSWIERVLSHSLMriskknpkefddFWLRQGATLLLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDlarsppeglQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEEVVGGlwnlsvgedhkgAIARAGGIKALVDLIFKWSSWNDGVLERAAGALANlaaddkcsLEVARAGGVHALVMLARSFMFEGVQEQAARALANLVAhgdsnsnnaavGLETGALEALVQLTFSKHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVRSCSSSSQGLQERAAGALWGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWnlafnpgnalciVEGGGVQALIHLCSSSLSKMARFMAALALAYIVDGRMEDIASigsslegtsesenLDVIRRMALKHIEDFCAGRIALKHIEDFVRSFSDPQAFATALASAVPKSLAQitegaripeaahlRCSGAEIGRFVSMLRNPSSILKACAAVALLQftmpggqhsmhhtnllqnvgaprvlqSTAAAAIAPVEAKIFAKIVLRNLEHHQNQHVEASI
llgsspclwssldlRPYKFDTSAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINVEFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREVNGDAINALAKQCRQLVEVGFIDSGGVDEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKLTSLVGLDTSRTNINLSSVTRLLSSSRNLKVLIALNCPVFEAEADTSMMYNQKGKVVLSLISEIFKGVASlfsdtteinngafqnwrklkvrdRISDEIVSWIERVLshslmriskknpkefddFWLRQGATLLLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLARSPPEGLQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEEVVGGLWNLSVGEDHKGAIARAGGIKALVDLIFKWSSWNDGVLERAAGALANLAADDKCSLEVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQLTFSKHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVRSCSSSSQGLQERAAGALWGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNALCIVEGGGVQALIHLCSSSLSKMARFMAALALAYIVDGRMEDIASigsslegtseseNLDVIRRMALKHIEDFCAGRIALKHIEDFVRSFSDPQAFATALASAVPKSLAQITEGARIPEAAHLRCSGAEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTAAAAIAPVEAKIFAKIVLRNLEHhqnqhveasi
LLGSSPCLWSSLDLRPYKFDTSAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINVEFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREVNGDAINALAKQCRQLVEVGFIDSGGVDEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKLTSLVGLDTSRTNInlssvtrllsssrnlKVLIALNCPVFEAEADTSMMYNQKGKVVLSLISEIFKGVASLFSDTTEINNGAFQNWRKLKVRDRISDEIVSWIERVLSHSLMRISKKNPKEFDDFWLRQGATlllslmessqqevqeRAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLARSPPEGLQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEEVVGGLWNLSVGEDHkgaiaraggikaLVDLIFKWSSWNDGVLERaagalanlaaDDKCSLEVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQLTFSKHEGVRQEAAGALWNLSFDDRNReaiaaaggvealvalVRSCSSSSQGLQERAAGALWGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNALCIVEGGGVQALIHLCSSSLSKMARFMAALALAYIVDGRMEDIASIGSSLEGTSESENLDVIRRMALKHIEDFCAGRIALKHIEDFVRSFSDPQAFATALASAVPKSLAQITEGARIPEAAHLRCSGAEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTaaaaiapveakifaKIVLRNLEHHQNQHVEASI
******CLWSSLDLRPYKFDTSAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINVEFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREVNGDAINALAKQCRQLVEVGFIDSGGVDEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKLTSLVGLDTSRTNINLSSVTRLLSSSRNLKVLIALNCPVFEAEADTSMMYNQKGKVVLSLISEIFKGVASLFSDTTEINNGAFQNWRKLKVRDRISDEIVSWIERVLSHSLMRISKKNPKEFDDFWLRQGATLLLSLME****EVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLAR**********AKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEEVVGGLWNLSVGEDHKGAIARAGGIKALVDLIFKWSSWNDGVLERAAGALANLAADDKCSLEVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGD***NNAAVGLETGALEALVQLTFSKHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVRSCS*******ERAAGALWGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNALCIVEGGGVQALIHLCSSSLSKMARFMAALALAYIVDGRMEDIASI***********NLDVIRRMALKHIEDFCAGRIALKHIEDFVRSFSDPQAFATALASAVPKSLAQITEGARIPEAAHLRCSGAEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTAAAAIAPVEAKIFAKIVLRNL************
L*G*S*CLWSSLDLRPYKFDTSAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINVEFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREVNGDAINALAKQCRQLVEVGFIDSGGVDEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKLTSLVGLDTSRTNINLSSVTRLLSSSRNLKVLIALNCPVFEAEADTSMMYNQKGKVVLSLISEIFKGVASLFSDTTEINNGAFQNWRKLKVRDRISDEIVSWIERVLSHSLMRISKKNPKEFDDFWLRQGATLLLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLARSPPEGLQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEEVVGGLWNLSVGEDHKGAIARAGGIKALVDLIFKWSSWNDGVLERAAGALANLAADDKCSLEVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQLTFSKHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVRSCSS*SQGLQERAAGALWGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNALCIVEGGGVQALIHLCSS******RFMAALALAYIVDGRMEDIASIGSSLEGTSESENLDVIRRMALKHIEDFCAGRIALKHIEDFVRS***********ASAVPKSLAQITEGARIPEAAHLRCSGAEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVL***************FAKIVLRNLE***********
LLGSSPCLWSSLDLRPYKFDTSAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINVEFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREVNGDAINALAKQCRQLVEVGFIDSGGVDEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKLTSLVGLDTSRTNINLSSVTRLLSSSRNLKVLIALNCPVFEAEADTSMMYNQKGKVVLSLISEIFKGVASLFSDTTEINNGAFQNWRKLKVRDRISDEIVSWIERVLSHSLMRISKKNPKEFDDFWLRQGATLLLSLME********RAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLARSPPEGLQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEEVVGGLWNLSVGEDHKGAIARAGGIKALVDLIFKWSSWNDGVLERAAGALANLAADDKCSLEVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQLTFSKHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVR***********RAAGALWGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNALCIVEGGGVQALIHLCSSSLSKMARFMAALALAYIVDGRMEDIASIGSSLEGTSESENLDVIRRMALKHIEDFCAGRIALKHIEDFVRSFSDPQAFATALASAVPKSLAQITEGARIPEAAHLRCSGAEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTAAAAIAPVEAKIFAKIVLRNLEHH*********
****SPCLWSSLDLRPYKFDTSAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINVEFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREVNGDAINALAKQCRQLVEVGFIDSGGVDEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKLTSLVGLDTSRTNINLSSVTRLLSSSRNLKVLIALNCPVFEAEADTSMMYNQKGKVVLSLISEIFKGVASLFSDTTEINNGAFQNWRKLKVRDRISDEIVSWIERVLSHSLMRISKKNPKEFDDFWLRQGATLLLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLARSPPEGLQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEEVVGGLWNLSVGEDHKGAIARAGGIKALVDLIFKWSSWNDGVLERAAGALANLAADDKCSLEVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQLTFSKHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVRSCSSSSQGLQERAAGALWGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNALCIVEGGGVQALIHLCSSSLSKMARFMAALALAYIVDGRMEDIASIGSSLEGTSESENLDVIRRMALKHIEDFCAGRIALKHIEDFVRSFSDPQAFATALASAVPKSLAQITEGARIPEAAHLRCSGAEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTAAAAIAPVEAKIFAKIVLRNLEHH*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LLGSSPCLWSSLDLRPYKFDTSAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINVEFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREVNGDAINALAKQCRQLVEVGFIDSGGVDEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKLTSLVGLDTSRTNINLSSVTRLLSSSRNLKVLIALNCPVFEAEADTSMMYNQKGKVVLSLISEIFKGVASLFSDTTEINNGAFQNWRKLKVRDRISDEIVSWIERVLSHSLMRISKKNPKEFDDFWLRQGATLLLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLARSPPEGLQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEEVVGGLWNLSVGEDHKGAIARAGGIKALVDLIFKWSSWNDGVLERAAGALANLAADDKCSLEVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQLTFSKHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVRSCSSSSQGLQERAAGALWGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNALCIVEGGGVQALIHLCSSSLSKMARFMAALALAYIVDGRMEDIASIGSSLEGTSESENLDVIRRMALKHIEDFCAGRIALKHIEDFVRSFSDPQAFATALASAVPKSLAQITEGARIPEAAHLRCSGAEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTAAAAIAPVEAKIFAKIVLRNLEHHQNQHVEASI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query864 2.2.26 [Sep-21-2011]
O22161930 Protein ARABIDILLO 1 OS=A yes no 0.973 0.904 0.656 0.0
Q9M224928 Protein ARABIDILLO 2 OS=A no no 0.978 0.910 0.634 0.0
O22193826 U-box domain-containing p no no 0.210 0.220 0.359 3e-19
Q4I1B1559 Vacuolar protein 8 OS=Gib yes no 0.271 0.420 0.318 3e-16
Q54I71757 Protein aardvark OS=Dicty yes no 0.312 0.356 0.259 4e-16
Q7RXW1578 Vacuolar protein 8 OS=Neu N/A no 0.262 0.392 0.325 6e-16
P0CM60630 Vacuolar protein 8 OS=Cry yes no 0.269 0.369 0.317 1e-15
P0CM61630 Vacuolar protein 8 OS=Cry N/A no 0.269 0.369 0.317 1e-15
Q2U5T5578 Vacuolar protein 8 OS=Asp yes no 0.400 0.598 0.254 2e-14
Q4WVW4578 Vacuolar protein 8 OS=Neo yes no 0.400 0.598 0.254 6e-14
>sp|O22161|ADLO1_ARATH Protein ARABIDILLO 1 OS=Arabidopsis thaliana GN=FBX5 PE=1 SV=1 Back     alignment and function desciption
 Score = 1079 bits (2791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/860 (65%), Positives = 688/860 (80%), Gaps = 19/860 (2%)

Query: 2   LGSSPCLWSSLDLRPYKFDTSAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINV 61
           LG+S CLW+SLDLRP+KFD S A SL+SRC NL  L FRG  SAD++I L+AR L E++ 
Sbjct: 80  LGASSCLWTSLDLRPHKFDASMAASLASRCVNLHYLRFRGVESADSLIHLKARNLIEVSG 139

Query: 62  EFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREV 121
           ++C+++TDA  S IVARHE LE L  G D C+RI+SDAIK VA+CCPKL++L LSG+R+V
Sbjct: 140 DYCKKITDATLSMIVARHEALESLQLGPDFCERITSDAIKAVAFCCPKLKKLRLSGIRDV 199

Query: 122 NGDAINALAKQCRQLVEVGFIDSGGVDEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKL 181
             +AI ALAK C QL ++GF+D   +DE AL  + SVRYLS+AGT N+ WS A+  W KL
Sbjct: 200 TSEAIEALAKHCPQLNDLGFLDCLNIDEEALGKVVSVRYLSVAGTSNIKWSIASNNWDKL 259

Query: 182 TSLVGLDTSRTNINLSSVTRLLSSSRNLKVLIALNCPVFEAEADTSMMYNQ-KGKVVLSL 240
             L GLD SRT+I  ++V+R L+SS++LKVL ALNC V E E ++ + YN+ KGKV+L+L
Sbjct: 260 PKLTGLDVSRTDIGPTAVSRFLTSSQSLKVLCALNCHVLE-EDESLISYNRFKGKVLLAL 318

Query: 241 ISEIFKGVASLFSDTTEINNGAFQNWRKL--KVRDRISDEIVSWIERVLSHSLMRISKKN 298
            + +F G+AS+F+D T+     F  WR+L    +D+  ++ + WIE ++SH+L+R ++ N
Sbjct: 319 FTNVFDGLASIFADNTKKPKDIFAYWRELMKTTKDKTINDFIHWIEWIISHTLLRTAECN 378

Query: 299 PKEFDDFWLRQGATLLLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHG 358
           P+  DDFWL +GA LLL+LM+SSQ++VQER+A  +ATFVV+DD+NA +DC RAEA+++ G
Sbjct: 379 PEGLDDFWLNEGAALLLNLMQSSQEDVQERSATGLATFVVVDDENASIDCGRAEAVMKDG 438

Query: 359 GVRLLLDLARSPPEGLQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEE 418
           G+RLLL+LA+S  EGLQSE AKAIANLSV++ +AK+V+E GGI ILA LA+S NRLVAEE
Sbjct: 439 GIRLLLELAKSWREGLQSEAAKAIANLSVNANIAKSVAEEGGIKILAGLAKSMNRLVAEE 498

Query: 419 VVGGLWNLSVGEDHKGAIARAGGIKALVDLIFKWSSWNDGVLERAAGALANLAADDKCSL 478
             GGLWNLSVGE+HK AIA+AGG+KALVDLIF+W +  DGVLERAAGALANLAADDKCS+
Sbjct: 499 AAGGLWNLSVGEEHKNAIAQAGGVKALVDLIFRWPNGCDGVLERAAGALANLAADDKCSM 558

Query: 479 EVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQL 538
           EVA+AGGVHALVMLAR+  +EGVQEQAARALANL AHGDSN+NNAAVG E GALEALVQL
Sbjct: 559 EVAKAGGVHALVMLARNCKYEGVQEQAARALANLAAHGDSNNNNAAVGQEAGALEALVQL 618

Query: 539 TFSKHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVRSCSSSSQGLQERAAGAL 598
           T S HEGVRQEAAGALWNLSFDD+NRE+I+ AGGVEALVAL +SCS++S GLQERAAGAL
Sbjct: 619 TKSPHEGVRQEAAGALWNLSFDDKNRESISVAGGVEALVALAQSCSNASTGLQERAAGAL 678

Query: 599 WGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNALCIVEGGGV 658
           WGLS+SEANS+AIGREGGV PLIALARS   DVHETAAGALWNLAFNPGNAL IVE GGV
Sbjct: 679 WGLSVSEANSVAIGREGGVPPLIALARSEAEDVHETAAGALWNLAFNPGNALRIVEEGGV 738

Query: 659 QALIHLCSSSLSKMARFMAALALAYIVDGRMEDIA-SIG-SSLEGTSESENLDVIRRMAL 716
            AL+HLCSSS+SKMARFMAALALAY+ DGRM++ A  IG SS E TS++ +LD  R M  
Sbjct: 739 PALVHLCSSSVSKMARFMAALALAYMFDGRMDEYALMIGTSSSESTSKNISLDGARNM-- 796

Query: 717 KHIEDFCAGRIALKHIEDFVRSFSDPQAFATALASAVPKSLAQITEGARIPEAAHLRCSG 776
                      ALKHIE FV SF DP  F + + S+ P  LAQ+TE ARI EA HLRCSG
Sbjct: 797 -----------ALKHIEAFVLSFIDPHIFESPVVSSTPTMLAQVTERARIQEAGHLRCSG 845

Query: 777 AEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTAAAAI 836
           AEIGRFV+MLRNP S LKACAA ALLQFT+PGG+H+MHH +L+QN G  R L+S AA+A 
Sbjct: 846 AEIGRFVTMLRNPDSTLKACAAFALLQFTIPGGRHAMHHVSLMQNGGESRFLRSAAASAK 905

Query: 837 APVEAKIFAKIVLRNLEHHQ 856
            P EAKIF KI+LRNLEHHQ
Sbjct: 906 TPREAKIFTKILLRNLEHHQ 925
Promotes lateral root initiation and development, independently of auxin (IAA) and abscisis acid (ABA).
Arabidopsis thaliana (taxid: 3702)
>sp|Q9M224|ADLO2_ARATH Protein ARABIDILLO 2 OS=Arabidopsis thaliana GN=At3g60350 PE=2 SV=1 Back     alignment and function description
>sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 Back     alignment and function description
>sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 Back     alignment and function description
>sp|Q54I71|AARA_DICDI Protein aardvark OS=Dictyostelium discoideum GN=aarA PE=2 SV=1 Back     alignment and function description
>sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac-8 PE=3 SV=3 Back     alignment and function description
>sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 Back     alignment and function description
>sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 Back     alignment and function description
>sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 Back     alignment and function description
>sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query864
225465989914 PREDICTED: protein ARABIDILLO 1-like [Vi 0.980 0.926 0.712 0.0
255539887918 ubiquitin-protein ligase, putative [Rici 0.975 0.918 0.712 0.0
297745027890 unnamed protein product [Vitis vinifera] 0.952 0.924 0.697 0.0
224053677921 predicted protein [Populus trichocarpa] 0.979 0.918 0.697 0.0
255541074920 ubiquitin-protein ligase, putative [Rici 0.979 0.919 0.694 0.0
224137174918 predicted protein [Populus trichocarpa] 0.979 0.921 0.690 0.0
18406656930 protein ARABIDILLO 1 [Arabidopsis thalia 0.973 0.904 0.656 0.0
356568604921 PREDICTED: protein ARABIDILLO 1-like [Gl 0.971 0.910 0.686 0.0
297828211929 armadillo/beta-catenin repeat family pro 0.972 0.904 0.659 0.0
224063613918 predicted protein [Populus trichocarpa] 0.979 0.921 0.690 0.0
>gi|225465989|ref|XP_002264403.1| PREDICTED: protein ARABIDILLO 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1159 bits (2997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/863 (71%), Positives = 713/863 (82%), Gaps = 16/863 (1%)

Query: 2   LGSSPCLWSSLDLRPYKFDTSAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINV 61
           LGSSPCLW+SLDLR +KFD +AA+ LSS+C N+  L FRGA SA+A+I LQAR LREI+ 
Sbjct: 68  LGSSPCLWTSLDLRSHKFDDNAADYLSSQCANITKLRFRGAESANAIIRLQARGLREISG 127

Query: 62  EFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREV 121
           EFCR++ DA  S I ARHE LE L  G D CD+I+SDAIK VA+CCPKL+RL +SGV+ V
Sbjct: 128 EFCRDINDATLSVIAARHEALESLQLGPDACDKITSDAIKAVAFCCPKLKRLRISGVQVV 187

Query: 122 NGDAINALAKQCRQLVEVGFIDSGGVDEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKL 181
            GDAINAL K C QLVE+GFID   VD AAL NL SVR+LS+AGTRN+ W SA     +L
Sbjct: 188 TGDAINALGKHCGQLVELGFIDGDNVDGAALGNLKSVRFLSVAGTRNMKWGSAVQPLCRL 247

Query: 182 TSLVGLDTSRTNINLSSVTRLLSSSRNLKVLIALNCPVFEAEADTSMMYNQKGKVVLSLI 241
            SL+G+D SRT+I+LSSVTRLLS S+NLKV  ALNCP FEA+ + S  YN KGK++++L 
Sbjct: 248 NSLIGIDVSRTDISLSSVTRLLSFSQNLKVFFALNCPKFEADVNNSTSYNYKGKLLVALF 307

Query: 242 SEIFKGVASLFSDTTEINNGAFQNWRKLKVRDRISDEIVSWIERVLSHSLMRISKKNPKE 301
           S+IFKGVASLF+D  E     F +WRKLK RD   DEIV+WIE +LSHSL+RIS+ NP+E
Sbjct: 308 SDIFKGVASLFADKIENQREVFSHWRKLKNRDNNLDEIVTWIEWILSHSLLRISENNPEE 367

Query: 302 FDDFWLRQGATLLLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVR 361
           F++FWLRQGA LLLSLM+SSQ++VQERAA AVATFVVIDD NA VDC+RAEA+++ GGV 
Sbjct: 368 FNEFWLRQGAALLLSLMQSSQEDVQERAATAVATFVVIDDDNATVDCRRAEAVMQDGGVE 427

Query: 362 LLLDLARSPPEGLQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEEVVG 421
           LLLDLA S  EGLQSE AKAIANLSV+SKVAKAV+ENGGIDIL++LARS NRLVAEE  G
Sbjct: 428 LLLDLASSCQEGLQSEAAKAIANLSVNSKVAKAVAENGGIDILSNLARSMNRLVAEEAAG 487

Query: 422 GLWNLSVGEDHKGAIARAGGIKALVDLIFKWSSWNDGVLERAAGALANLAADDKCSLEVA 481
           GLWNLSVGE+HKGAIA  GGI+ALVDLIFKW S  DGVLERAAGALANLAADDKCS+EVA
Sbjct: 488 GLWNLSVGEEHKGAIAETGGIRALVDLIFKWQSAGDGVLERAAGALANLAADDKCSMEVA 547

Query: 482 RAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQLTFS 541
             GGVHALVMLARS  FEGVQEQAARALANL AHGDSN+NN+AVG E GALEALVQLT S
Sbjct: 548 MVGGVHALVMLARSCKFEGVQEQAARALANLAAHGDSNNNNSAVGQEAGALEALVQLTCS 607

Query: 542 KHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVRSCSSSSQGLQERAAGALWGL 601
           +HEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVAL ++CS++SQGLQERAAGALWGL
Sbjct: 608 QHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALAQTCSNASQGLQERAAGALWGL 667

Query: 602 SLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNALCIVEGGGVQAL 661
           S+SEANSIAIGR+GGVAPLIALARS V DVHETAAGALWNLAFNP NAL IVE GGVQAL
Sbjct: 668 SVSEANSIAIGRQGGVAPLIALARSNVEDVHETAAGALWNLAFNPHNALRIVEDGGVQAL 727

Query: 662 IHLCSSSLSKMARFMAALALAYIVDGRMEDIASIGSSLEGTSESENLDVIRRMALKHIED 721
           ++LCS SLSKMARFMAALALAY+ DGRM+++A +G S EG S+S N++  R+M       
Sbjct: 728 VNLCSYSLSKMARFMAALALAYMFDGRMDEVALVGPSSEGASKSRNINGARKM------- 780

Query: 722 FCAGRIALKHIEDFVRSFSDPQAFATALASAVPKSLAQITEGARIPEAAHLRCSGAEIGR 781
                 ALK+IE FV +F++P  F  ALAS+ P +L Q+ E A I EA HLRCSGAEIGR
Sbjct: 781 ------ALKNIEAFVLTFTNPHTFGLALASSAPTALVQVIEMACIQEAGHLRCSGAEIGR 834

Query: 782 FVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTAAAAIAPVEA 841
           FV+ML+NPS +LK+CAA ALLQFT+PG +H++HH +LLQ   A R L++ AAAA APVEA
Sbjct: 835 FVTMLKNPSPVLKSCAAFALLQFTIPGSRHAVHHASLLQKAVALRTLRAAAAAATAPVEA 894

Query: 842 KIFAKIVLRNLEHHQNQHVEASI 864
           K+FA+IVLRNLEH+Q   VEASI
Sbjct: 895 KVFARIVLRNLEHYQ---VEASI 914

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255539887|ref|XP_002511008.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550123|gb|EEF51610.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297745027|emb|CBI38619.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224053677|ref|XP_002297924.1| predicted protein [Populus trichocarpa] gi|222845182|gb|EEE82729.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255541074|ref|XP_002511601.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223548781|gb|EEF50270.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224137174|ref|XP_002327055.1| predicted protein [Populus trichocarpa] gi|222835370|gb|EEE73805.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18406656|ref|NP_566029.1| protein ARABIDILLO 1 [Arabidopsis thaliana] gi|75219086|sp|O22161.1|ADLO1_ARATH RecName: Full=Protein ARABIDILLO 1; AltName: Full=F-box only protein 5 gi|2344894|gb|AAC31834.1| F-box protein family, AtFBX5 [Arabidopsis thaliana] gi|330255388|gb|AEC10482.1| protein ARABIDILLO 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356568604|ref|XP_003552500.1| PREDICTED: protein ARABIDILLO 1-like [Glycine max] Back     alignment and taxonomy information
>gi|297828211|ref|XP_002881988.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297327827|gb|EFH58247.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224063613|ref|XP_002301228.1| predicted protein [Populus trichocarpa] gi|222842954|gb|EEE80501.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query864
TAIR|locus:2055033930 ARABIDILLO-1 "AT2G44900" [Arab 0.979 0.909 0.588 2.1e-258
TAIR|locus:2103351928 ARABIDILLO-2 "AT3G60350" [Arab 0.978 0.910 0.566 2.2e-247
TAIR|locus:2045334829 PUB4 "plant U-box 4" [Arabidop 0.209 0.218 0.324 7.1e-13
ASPGD|ASPL0000008980579 AN12408 [Emericella nidulans ( 0.355 0.530 0.256 7.1e-10
TAIR|locus:2162276660 PUB15 "Plant U-Box 15" [Arabid 0.251 0.328 0.253 1.8e-08
TAIR|locus:2075140660 PUB13 "plant U-box 13" [Arabid 0.202 0.265 0.288 3.7e-08
TAIR|locus:2158252707 AT5G67340 [Arabidopsis thalian 0.211 0.258 0.25 5.3e-08
TAIR|locus:2082682632 PUB14 "plant U-box 14" [Arabid 0.251 0.343 0.275 8.4e-08
UNIPROTKB|Q5VRH9611 PUB12 "U-box domain-containing 0.229 0.324 0.278 9e-08
TAIR|locus:2150295 710 ARIA "ARM repeat protein inter 0.274 0.333 0.277 1.2e-07
TAIR|locus:2055033 ARABIDILLO-1 "AT2G44900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2487 (880.5 bits), Expect = 2.1e-258, P = 2.1e-258
 Identities = 511/868 (58%), Positives = 620/868 (71%)

Query:     2 LGSSPCLWSSLDLRPYKFDTSAAESLSSRCTNLQALWFRGALSADAMIILQARRLREINV 61
             LG+S CLW+SLDLRP+KFD S A SL+SRC NL  L FRG  SAD++I L+AR L E++ 
Sbjct:    80 LGASSCLWTSLDLRPHKFDASMAASLASRCVNLHYLRFRGVESADSLIHLKARNLIEVSG 139

Query:    62 EFCRELTDAIFSAIVARHEMLEILHFGLDVCDRISSDAIKTVAYCCPKLRRLWLSGVREV 121
             ++C+++TDA  S IVARHE LE L  G D C+RI+SDAIK VA+CCPKL++L LSG+R+V
Sbjct:   140 DYCKKITDATLSMIVARHEALESLQLGPDFCERITSDAIKAVAFCCPKLKKLRLSGIRDV 199

Query:   122 NGDAINALAKQCRQLVEVGFIDSGGVDEAALENLSSVRYLSIAGTRNLNWSSAAIAWSKL 181
               +AI ALAK C QL ++GF+D   +DE AL  + SVRYLS+AGT N+ WS A+  W KL
Sbjct:   200 TSEAIEALAKHCPQLNDLGFLDCLNIDEEALGKVVSVRYLSVAGTSNIKWSIASNNWDKL 259

Query:   182 TSLVGLDTSRTNIXXXXXXXXXXXXXXXKVLIALNCPVFEAEADTSMMYNQ-KGKVVLSL 240
               L GLD SRT+I               KVL ALNC V E E ++ + YN+ KGKV+L+L
Sbjct:   260 PKLTGLDVSRTDIGPTAVSRFLTSSQSLKVLCALNCHVLE-EDESLISYNRFKGKVLLAL 318

Query:   241 ISEIFKGVASLFSDTTEINNGAFQNWRKLK--VRDRISDEIVSWIERVLSHSLMRISKKN 298
              + +F G+AS+F+D T+     F  WR+L    +D+  ++ + WIE ++SH+L+R ++ N
Sbjct:   319 FTNVFDGLASIFADNTKKPKDIFAYWRELMKTTKDKTINDFIHWIEWIISHTLLRTAECN 378

Query:   299 PKEFDDFWLRQGATXXXXXXXXXXXXXXXRAAYAVATFVVIDDQNAMVDCQRAEAILRHG 358
             P+  DDFWL +GA                R+A  +ATFVV+DD+NA +DC RAEA+++ G
Sbjct:   379 PEGLDDFWLNEGAALLLNLMQSSQEDVQERSATGLATFVVVDDENASIDCGRAEAVMKDG 438

Query:   359 GVRLLLDLARSPPEGLQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEE 418
             G+RLLL+LA+S  EGLQSE AKAIANLSV++ +AK+V+E GGI ILA LA+S NRLVAEE
Sbjct:   439 GIRLLLELAKSWREGLQSEAAKAIANLSVNANIAKSVAEEGGIKILAGLAKSMNRLVAEE 498

Query:   419 VVGGLWNLSVGEDHXXXXXXXXXXXXLVDLIFKWSSWNDGVLERXXXXXXXXXXDDKCSL 478
               GGLWNLSVGE+H            LVDLIF+W +  DGVLER          DDKCS+
Sbjct:   499 AAGGLWNLSVGEEHKNAIAQAGGVKALVDLIFRWPNGCDGVLERAAGALANLAADDKCSM 558

Query:   479 EVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQL 538
             EVA+AGGVHALVMLAR+  +EGVQEQAARALANL AHGDSN+NNAAVG E GALEALVQL
Sbjct:   559 EVAKAGGVHALVMLARNCKYEGVQEQAARALANLAAHGDSNNNNAAVGQEAGALEALVQL 618

Query:   539 TFSKHEGVRQEAAGALWNLSFDDRNRXXXXXXXXXXXXXXXVRSCSSSSQGLQERAAGAL 598
             T S HEGVRQEAAGALWNLSFDD+NR                +SCS++S GLQERAAGAL
Sbjct:   619 TKSPHEGVRQEAAGALWNLSFDDKNRESISVAGGVEALVALAQSCSNASTGLQERAAGAL 678

Query:   599 WGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNALCIVEGGGV 658
             WGLS+SEANS+AIGREGGV PLIALARS   DVHETAAGALWNLAFNPGNAL IVE GGV
Sbjct:   679 WGLSVSEANSVAIGREGGVPPLIALARSEAEDVHETAAGALWNLAFNPGNALRIVEEGGV 738

Query:   659 QALIHLCSSSLSKMARFMAALALAYIVDGRMEDIA-SIG-SSLEGTSESENLDVIRRMAL 716
              AL+HLCSSS+SKMARFMAALALAY+ DGRM++ A  IG SS E TS++ +LD  R MAL
Sbjct:   739 PALVHLCSSSVSKMARFMAALALAYMFDGRMDEYALMIGTSSSESTSKNISLDGARNMAL 798

Query:   717 KHIEDFCAGRIALKHIEDFVRSFSDPQAFATALASAVPKSLAQITEGARIPEAAHLRCSG 776
             KHIE F             V SF DP  F + + S+ P  LAQ+TE ARI EA HLRCSG
Sbjct:   799 KHIEAF-------------VLSFIDPHIFESPVVSSTPTMLAQVTERARIQEAGHLRCSG 845

Query:   777 AEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTXXXXX 836
             AEIGRFV+MLRNP S LKACAA ALLQFT+PGG+H+MHH +L+QN G  R L+S      
Sbjct:   846 AEIGRFVTMLRNPDSTLKACAAFALLQFTIPGGRHAMHHVSLMQNGGESRFLRSAAASAK 905

Query:   837 XXXXXXXXXKIVLRNLEHHQNQHVEASI 864
                      KI+LRNLEHHQ    E+SI
Sbjct:   906 TPREAKIFTKILLRNLEHHQ---AESSI 930
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0048527 "lateral root development" evidence=IGI;IMP
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2103351 ARABIDILLO-2 "AT3G60350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045334 PUB4 "plant U-box 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000008980 AN12408 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2162276 PUB15 "Plant U-Box 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075140 PUB13 "plant U-box 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158252 AT5G67340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082682 PUB14 "plant U-box 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRH9 PUB12 "U-box domain-containing protein 12" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2150295 ARIA "ARM repeat protein interacting with ABF2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22161ADLO1_ARATHNo assigned EC number0.65690.97330.9043yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query864
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 5e-16
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-15
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 7e-15
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 6e-13
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 4e-11
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-09
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-07
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-06
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 5e-06
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 3e-05
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 4e-04
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 6e-04
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 0.001
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.003
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.003
pfam05804708 pfam05804, KAP, Kinesin-associated protein (KAP) 0.003
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 0.003
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 0.004
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information 
 Score = 74.7 bits (184), Expect = 5e-16
 Identities = 47/116 (40%), Positives = 65/116 (56%), Gaps = 5/116 (4%)

Query: 530 GALEALVQLTFSKHEGVRQEAAGALWNLSF-DDRNREAIAAAGGVEALVALVRSCSSSSQ 588
           G L ALV L  S  E V++EAA AL NLS  ++ N +A+  AGG+ ALV L+    S  +
Sbjct: 7   GGLPALVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLL---KSEDE 63

Query: 589 GLQERAAGALWGLSLSEANSIAIGRE-GGVAPLIALARSAVVDVHETAAGALWNLA 643
            + + A  AL  L+    ++  I  E GGV  L+ L  S+  D+ + A GAL NLA
Sbjct: 64  EVVKAALWALRNLAAGPEDNKLIVLEAGGVPKLVNLLDSSNEDIQKNATGALSNLA 119

An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|147776 pfam05804, KAP, Kinesin-associated protein (KAP) Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 864
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
KOG4224550 consensus Armadillo repeat protein VAC8 required f 100.0
KOG4224550 consensus Armadillo repeat protein VAC8 required f 100.0
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.97
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.97
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.96
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.96
PF05804708 KAP: Kinesin-associated protein (KAP) 99.93
PF05804708 KAP: Kinesin-associated protein (KAP) 99.92
KOG4341483 consensus F-box protein containing LRR [General fu 99.87
KOG1048717 consensus Neural adherens junction protein Plakoph 99.87
KOG1048717 consensus Neural adherens junction protein Plakoph 99.83
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.8
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.8
KOG4341483 consensus F-box protein containing LRR [General fu 99.8
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.78
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.74
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.73
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.72
PRK09687280 putative lyase; Provisional 99.68
PRK09687280 putative lyase; Provisional 99.66
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 99.65
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.65
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.63
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.63
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.62
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.61
KOG1293678 consensus Proteins containing armadillo/beta-caten 99.61
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.55
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.53
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.5
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.46
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.45
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.41
KOG1293678 consensus Proteins containing armadillo/beta-caten 99.39
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.35
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 99.33
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.32
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.3
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.27
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.24
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.21
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.18
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.16
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.16
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.11
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.03
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 99.01
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.99
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 98.96
TIGR02270410 conserved hypothetical protein. Members are found 98.93
TIGR02270410 conserved hypothetical protein. Members are found 98.93
PTZ00429746 beta-adaptin; Provisional 98.87
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.85
PLN032101153 Resistant to P. syringae 6; Provisional 98.82
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.81
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.81
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.8
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.74
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.74
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.72
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.71
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.71
PTZ00429 746 beta-adaptin; Provisional 98.7
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.7
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.7
PLN00113968 leucine-rich repeat receptor-like protein kinase; 98.7
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.59
PLN00113968 leucine-rich repeat receptor-like protein kinase; 98.59
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.58
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.54
PF05536543 Neurochondrin: Neurochondrin 98.52
KOG2023885 consensus Nuclear transport receptor Karyopherin-b 98.51
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.48
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.46
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.46
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 98.45
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 98.45
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.43
PLN032101153 Resistant to P. syringae 6; Provisional 98.41
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.38
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.38
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.38
KOG1242569 consensus Protein containing adaptin N-terminal re 98.37
KOG4646173 consensus Uncharacterized conserved protein, conta 98.37
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 98.3
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.29
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 98.26
KOG0212675 consensus Uncharacterized conserved protein [Funct 98.26
KOG0567289 consensus HEAT repeat-containing protein [General 98.23
KOG4646173 consensus Uncharacterized conserved protein, conta 98.22
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.21
KOG1824 1233 consensus TATA-binding protein-interacting protein 98.19
KOG2734536 consensus Uncharacterized conserved protein [Funct 98.18
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.18
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.16
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.08
KOG0567289 consensus HEAT repeat-containing protein [General 98.08
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 98.06
KOG3864221 consensus Uncharacterized conserved protein [Funct 98.05
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.03
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 98.0
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.95
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.95
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.94
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.94
KOG18241233 consensus TATA-binding protein-interacting protein 97.89
KOG0212 675 consensus Uncharacterized conserved protein [Funct 97.88
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.85
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.83
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.8
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 97.79
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.78
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 97.77
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.76
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 97.75
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 97.75
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.74
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 97.73
KOG1242569 consensus Protein containing adaptin N-terminal re 97.67
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.67
PF05536543 Neurochondrin: Neurochondrin 97.66
KOG2259 823 consensus Uncharacterized conserved protein [Funct 97.63
KOG06181081 consensus Serine/threonine phosphatase 2C containi 97.62
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.62
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.62
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.61
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.6
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.6
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 97.59
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.58
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 97.56
COG5369743 Uncharacterized conserved protein [Function unknow 97.51
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 97.47
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 97.44
KOG2259 823 consensus Uncharacterized conserved protein [Funct 97.43
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.36
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 97.32
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.32
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 97.3
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.29
COG5369743 Uncharacterized conserved protein [Function unknow 97.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.29
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.26
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.19
KOG06181081 consensus Serine/threonine phosphatase 2C containi 97.18
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 97.15
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.13
PRK14707 2710 hypothetical protein; Provisional 97.13
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.08
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 97.05
PRK14707 2710 hypothetical protein; Provisional 97.05
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 97.02
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 97.01
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.91
KOG4535728 consensus HEAT and armadillo repeat-containing pro 96.9
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.89
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 96.88
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.86
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.86
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 96.83
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 96.68
PRK15386426 type III secretion protein GogB; Provisional 96.63
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.57
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.56
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 96.49
COG5096 757 Vesicle coat complex, various subunits [Intracellu 96.47
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 96.46
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.39
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.37
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.35
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 96.32
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.3
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.25
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 96.24
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 96.21
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.2
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.2
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.19
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.09
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 96.08
PF05004309 IFRD: Interferon-related developmental regulator ( 96.05
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 96.04
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 95.99
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 95.95
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 95.95
KOG1078865 consensus Vesicle coat complex COPI, gamma subunit 95.89
KOG2062929 consensus 26S proteasome regulatory complex, subun 95.89
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.78
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 95.72
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 95.69
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.66
KOG4308478 consensus LRR-containing protein [Function unknown 95.55
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 95.55
COG5096 757 Vesicle coat complex, various subunits [Intracellu 95.44
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.44
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 95.39
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 95.39
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 95.38
KOG3036293 consensus Protein involved in cell differentiation 95.3
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 95.25
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 95.23
KOG2062929 consensus 26S proteasome regulatory complex, subun 95.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.21
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 95.14
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 95.11
KOG4308478 consensus LRR-containing protein [Function unknown 95.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 94.99
KOG3036293 consensus Protein involved in cell differentiation 94.94
PF08045257 CDC14: Cell division control protein 14, SIN compo 94.88
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 94.82
PF05004309 IFRD: Interferon-related developmental regulator ( 94.81
KOG4535728 consensus HEAT and armadillo repeat-containing pro 94.31
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 94.29
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 94.25
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.25
PRK15386426 type III secretion protein GogB; Provisional 94.24
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 94.06
KOG4237498 consensus Extracellular matrix protein slit, conta 93.93
PF07814361 WAPL: Wings apart-like protein regulation of heter 93.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 93.91
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 93.91
KOG2025 892 consensus Chromosome condensation complex Condensi 93.91
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 93.81
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 93.68
PF08045257 CDC14: Cell division control protein 14, SIN compo 93.68
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 93.66
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 93.6
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.6
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 93.46
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 93.31
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 93.04
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 92.93
KOG2025 892 consensus Chromosome condensation complex Condensi 92.92
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 92.84
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 92.68
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 92.54
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 92.5
PF07814361 WAPL: Wings apart-like protein regulation of heter 92.32
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 92.15
KOG4653982 consensus Uncharacterized conserved protein [Funct 92.14
KOG2032533 consensus Uncharacterized conserved protein [Funct 92.02
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 91.98
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 91.76
PF11701157 UNC45-central: Myosin-binding striated muscle asse 91.74
PF11701157 UNC45-central: Myosin-binding striated muscle asse 91.63
PLN03150623 hypothetical protein; Provisional 91.49
PLN03150623 hypothetical protein; Provisional 91.08
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 91.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 90.98
COG5116 926 RPN2 26S proteasome regulatory complex component [ 90.85
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 90.85
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 90.59
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 90.54
smart00638574 LPD_N Lipoprotein N-terminal Domain. 90.45
smart00638574 LPD_N Lipoprotein N-terminal Domain. 90.22
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.22
COG5116926 RPN2 26S proteasome regulatory complex component [ 90.03
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 89.92
KOG22741005 consensus Predicted importin 9 [Intracellular traf 89.36
KOG4653982 consensus Uncharacterized conserved protein [Funct 89.08
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 88.35
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 87.98
KOG0617264 consensus Ras suppressor protein (contains leucine 87.53
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 87.35
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 86.7
KOG0617264 consensus Ras suppressor protein (contains leucine 86.65
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 86.45
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 85.93
KOG04141251 consensus Chromosome condensation complex Condensi 85.68
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 85.56
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 85.42
KOG12481176 consensus Uncharacterized conserved protein [Funct 85.37
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 85.25
KOG04141251 consensus Chromosome condensation complex Condensi 85.03
PF1036392 DUF2435: Protein of unknown function (DUF2435) 84.34
COG5209315 RCD1 Uncharacterized protein involved in cell diff 83.8
KOG2032533 consensus Uncharacterized conserved protein [Funct 83.72
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 83.63
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 83.35
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 82.95
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 82.89
KOG2956516 consensus CLIP-associating protein [General functi 82.48
KOG2137700 consensus Protein kinase [Signal transduction mech 82.09
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 81.77
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 81.39
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 80.37
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 80.16
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 80.05
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.5e-38  Score=382.58  Aligned_cols=518  Identities=24%  Similarity=0.241  Sum_probs=397.2

Q ss_pred             HHHHHhhcHHHHHHHHccCCHHHHHHHHHHHHHhcccC--CcccccchHhHHHHHHhCCHHHHHHHhcCCC---HHHHHH
Q 048757          303 DDFWLRQGATLLLSLMESSQQEVQERAAYAVATFVVID--DQNAMVDCQRAEAILRHGGVRLLLDLARSPP---EGLQSE  377 (864)
Q Consensus       303 ~~~~~~~gv~~L~~lL~~~~~~v~~~a~~~L~~L~~~~--~~~~~~~~~~~~~i~~~~~i~~L~~lL~~~~---~~~~~~  377 (864)
                      ..+...++||+|+.+|++.+++.|+.|+.+|.+|+...  +++      ....+...|++|+|+.++++++   ..++..
T Consensus        93 ~~Iv~~GaIppLV~LL~sGs~eaKe~AA~AL~sLS~~~~~D~~------~~~I~v~~GaVp~Lv~lL~~gsk~d~~L~~~  166 (2102)
T PLN03200         93 VKVLLGGCIPPLLSLLKSGSAEAQKAAAEAIYAVSSGGLSDHV------GSKIFSTEGVVPSLWDQLQPGNKQDKVVEGL  166 (2102)
T ss_pred             HHHHHcCChHHHHHHHHCCCHHHHHHHHHHHHHHHcCcchhhh------hhhhhhhcCChHHHHHHHhCCchhhHHHHHH
Confidence            34444444999999999999999999999999999764  221      2234567999999999999863   346777


Q ss_pred             HHHHHHHHhCCchhH-HHHHhcCcHHHHHHHHccCCHHHHHHHHHHHHHhcCC-CCcHHHHHhhCcHHHHHHHHcccCCC
Q 048757          378 VAKAIANLSVDSKVA-KAVSENGGIDILADLARSTNRLVAEEVVGGLWNLSVG-EDHKGAIARAGGIKALVDLIFKWSSW  455 (864)
Q Consensus       378 a~~~L~~L~~~~~~~-~~i~~~g~i~~Lv~lL~~~~~~v~~~a~~aL~~Ls~~-~~~~~~i~~~g~i~~L~~lL~~~~~~  455 (864)
                      ++.+|.+|+..++.+ ..+++.|+++.|+++|+++++.++..|+.+|.+++.+ ++.+..+++.|++|.|++++++  +.
T Consensus       167 Av~AL~nLs~~~en~~~~IIeaGaVp~LV~LLsS~d~~lQ~eAa~aLa~Lass~ee~~~aVIeaGaVP~LV~LL~s--g~  244 (2102)
T PLN03200        167 LTGALRNLCGSTDGFWSATLEAGGVDILVKLLSSGNSDAQANAASLLARLMMAFESSISKVLDAGAVKQLLKLLGQ--GN  244 (2102)
T ss_pred             HHHHHHHHhcCccchHHHHHHcCCHHHHHHHHcCCCHHHHHHHHHHHHHHHcCChHHHHHHHHCCCHHHHHHHHcc--CC
Confidence            899999999977655 5678999999999999999999999999999888764 6789999999999999999974  35


Q ss_pred             CHHHHHHHHHHHHHhcCCC-cchHHHHhcCcHHHHHHHHHccC--------chhHHHHHHHHHHHHhhcCCC--------
Q 048757          456 NDGVLERAAGALANLAADD-KCSLEVARAGGVHALVMLARSFM--------FEGVQEQAARALANLVAHGDS--------  518 (864)
Q Consensus       456 ~~~v~~~a~~~L~~L~~~~-~~~~~i~~~~~i~~Lv~ll~~~~--------~~~v~~~a~~aL~~L~~~~~~--------  518 (864)
                      +..+++.|+++|.+|+.++ +++..+++.|+++.|++++..+.        +..++++|+|+|.|+|.....        
T Consensus       245 ~~~VRE~AA~AL~nLAs~s~e~r~~Iv~aGgIp~LI~lL~sp~~e~~~~~~~~~Lqe~AvwALsNIcgg~~~ll~~L~~l  324 (2102)
T PLN03200        245 EVSVRAEAAGALEALSSQSKEAKQAIADAGGIPALINATVAPSKEFMQGEFAQALQENAMGALANICGGMSALILYLGEL  324 (2102)
T ss_pred             ChHHHHHHHHHHHHHhcCCHHHHHHHHHCCCHHHHHHHHhCcchhhhccccchHHHHHHHHHHHHHhCCchhhHHHHHHh
Confidence            5689999999999999975 58999999999999999998532        234689999999998863100        


Q ss_pred             ---C-----------------------------------------------------------------cccchhhhccC
Q 048757          519 ---N-----------------------------------------------------------------SNNAAVGLETG  530 (864)
Q Consensus       519 ---~-----------------------------------------------------------------~~~~~~~~~~~  530 (864)
                         .                                                                 +..+..+.+.+
T Consensus       325 l~s~rd~~~~ada~gALayll~l~d~~~~~~~~i~~~~v~~~LV~Llr~k~p~~vqe~V~eALasl~gN~~l~~~L~~~d  404 (2102)
T PLN03200        325 SESPRSPAPIADTLGALAYALMVFDSSAESTRAFDPTVIEQILVKLLKPRDTKLVQERIIEALASLYGNAYLSRKLNHAE  404 (2102)
T ss_pred             hcccchHHHHHHHHhhHHHHHHhcCCchhhhhhccccccHHHHHHHhCCCCCchhHHHHHHHHHHhcCChHHHHHHHhcc
Confidence               0                                                                 00011222345


Q ss_pred             hHHHHHHHhcCCCHHHHHHHHHHHHHhcCC-hhhHHHHHHCCChHHHHHHHHhcCCCCHHHHHHHHHHHHHhccC-chhh
Q 048757          531 ALEALVQLTFSKHEGVRQEAAGALWNLSFD-DRNREAIAAAGGVEALVALVRSCSSSSQGLQERAAGALWGLSLS-EANS  608 (864)
Q Consensus       531 ~i~~L~~lL~~~~~~v~~~a~~~L~~Ls~~-~~~~~~i~~~~~i~~Lv~lL~~~~~~~~~v~~~A~~aL~~L~~~-~~~~  608 (864)
                      +++.|+.++...+.+++..++++|++++.+ ++.++.+.+.|+++.|+++|.+   +++.+++.|+++|++++.. ++++
T Consensus       405 aik~LV~LL~~~~~evQ~~Av~aL~~L~~~~~e~~~aIi~~ggIp~LV~LL~s---~s~~iQ~~A~~~L~nLa~~ndenr  481 (2102)
T PLN03200        405 AKKVLVGLITMATADVQEELIRALSSLCCGKGGLWEALGGREGVQLLISLLGL---SSEQQQEYAVALLAILTDEVDESK  481 (2102)
T ss_pred             chhhhhhhhccCCHHHHHHHHHHHHHHhCCCHHHHHHHHHcCcHHHHHHHHcC---CCHHHHHHHHHHHHHHHcCCHHHH
Confidence            566677777777788999999999999976 6779999999999999999997   7899999999999999975 6788


Q ss_pred             HHhhhcCCHHHHHHHHccCCHHHHHHHHHHHHHhcCCcccHH-HHHhCCcHHHHHHHhcCCCcHHHHHHHHHHHHHhhcC
Q 048757          609 IAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNAL-CIVEGGGVQALIHLCSSSLSKMARFMAALALAYIVDG  687 (864)
Q Consensus       609 ~~i~~~~~i~~Lv~lL~~~~~~v~~~a~~aL~~L~~~~~~~~-~i~~~g~v~~L~~ll~~~~~~~~r~~aa~aL~~l~~~  687 (864)
                      ..+.+.|++|+|+++|.++++++++.|+|+|.|++.++++.. .+.+.|++++|+++|.+++ +..|..|+++|.++..+
T Consensus       482 ~aIieaGaIP~LV~LL~s~~~~iqeeAawAL~NLa~~~~qir~iV~~aGAIppLV~LL~sgd-~~~q~~Aa~AL~nLi~~  560 (2102)
T PLN03200        482 WAITAAGGIPPLVQLLETGSQKAKEDSATVLWNLCCHSEDIRACVESAGAVPALLWLLKNGG-PKGQEIAAKTLTKLVRT  560 (2102)
T ss_pred             HHHHHCCCHHHHHHHHcCCCHHHHHHHHHHHHHHhCCcHHHHHHHHHCCCHHHHHHHHhCCC-HHHHHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999998766555 4557899999999999885 88999999999999765


Q ss_pred             Cc-cceeeecccccCCCcccchHHHHHHHHHHHHhhccc----------ccchhhhhHHHHhccChhhHHHHhhccchhH
Q 048757          688 RM-EDIASIGSSLEGTSESENLDVIRRMALKHIEDFCAG----------RIALKHIEDFVRSFSDPQAFATALASAVPKS  756 (864)
Q Consensus       688 ~~-~~~~~~~~ll~~~~~~v~~~~~~~~al~~l~~~~~g----------~~~~~~i~~l~~~~~~~~~~~~a~~~~a~~~  756 (864)
                      .. +.+..+..++.+.+..+.....  .++.++.....+          .-.++.+..+++++++..++.++.++..+++
T Consensus       561 ~d~~~I~~Lv~LLlsdd~~~~~~aL--~vLgnIlsl~~~~d~~~~g~~~~ggL~~Lv~LL~sgs~~ikk~Aa~iLsnL~a  638 (2102)
T PLN03200        561 ADAATISQLTALLLGDLPESKVHVL--DVLGHVLSVASLEDLVREGSAANDALRTLIQLLSSSKEETQEKAASVLADIFS  638 (2102)
T ss_pred             cchhHHHHHHHHhcCCChhHHHHHH--HHHHHHHhhcchhHHHHHhhhccccHHHHHHHHcCCCHHHHHHHHHHHHHHhc
Confidence            44 3344555666666665555544  334343221111          1134455555667777777777763333332


Q ss_pred             HhccccccCcccccccccchhhHHHHHHHhcCCcHHHHHHHHHHHHhhccCCCcchhhhhhhhhhcChhhHHHHhhhhhc
Q 048757          757 LAQITEGARIPEAAHLRCSGAEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTAAAAI  836 (864)
Q Consensus       757 l~~~~~~~~~~~~~~~~~~~~~i~~lv~~l~~~~~~~~~~Aa~al~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~  836 (864)
                       ++......+...|       +|++|+.+|++++.+++..|||||.++...+..   .....+.+.|+.+.|-++....+
T Consensus       639 -~~~d~~~avv~ag-------aIpPLV~LLss~~~~v~keAA~AL~nL~~~~~~---~q~~~~v~~GaV~pL~~LL~~~d  707 (2102)
T PLN03200        639 -SRQDLCESLATDE-------IINPCIKLLTNNTEAVATQSARALAALSRSIKE---NRKVSYAAEDAIKPLIKLAKSSS  707 (2102)
T ss_pred             -CChHHHHHHHHcC-------CHHHHHHHHhcCChHHHHHHHHHHHHHHhCCCH---HHHHHHHHcCCHHHHHHHHhCCC
Confidence             2211222233444       899999999999999999999999999863332   22223456788888888776665


Q ss_pred             cchhHHHHH
Q 048757          837 APVEAKIFA  845 (864)
Q Consensus       837 ~~~~~~~~~  845 (864)
                      ..+....+.
T Consensus       708 ~~v~e~Al~  716 (2102)
T PLN03200        708 IEVAEQAVC  716 (2102)
T ss_pred             hHHHHHHHH
Confidence            555444443

>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query864
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 5e-12
1xm9_A457 Structure Of The Armadillo Repeat Domain Of Plakoph 6e-05
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 1e-04
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure 
Iteration: 1

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 103/198 (52%), Gaps = 10/198 (5%)
Query: 480 VARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQLT 539
           +  AGGV  LV L  S   E VQ++AARALAN +A G   +  A V  + G +E LV+L 
Sbjct: 40  IVDAGGVEVLVKLLTSTDSE-VQKEAARALAN-IASGPDEAIKAIV--DAGGVEVLVKLL 95
Query: 540 FSKHEGVRQEAAGALWNL-SFDDRNRXXXXXXXXXXXXXXXVRSCSSSSQGLQERAAGAL 598
            S    V++EAA AL N+ S  D                  V+  +S+   +Q+ AA AL
Sbjct: 96  TSTDSEVQKEAARALANIASGPDE---AIKAIVDAGGVEVLVKLLTSTDSEVQKEAARAL 152
Query: 599 WGLSLSEANSI-AIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNAL-CIVEGG 656
             ++     +I AI   GGV  L+ L  S   +V + AA AL N+A  P +A+  IV+ G
Sbjct: 153 ANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPTSAIKAIVDAG 212
Query: 657 GVQALIHLCSSSLSKMAR 674
           GV+ L  L +S+ S++ +
Sbjct: 213 GVEVLQKLLTSTDSEVQK 230
>pdb|1XM9|A Chain A, Structure Of The Armadillo Repeat Domain Of Plakophilin 1 Length = 457 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query864
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-68
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-58
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 9e-57
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-29
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-66
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-58
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-57
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-50
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-38
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 7e-32
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 6e-66
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 7e-57
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-56
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-54
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-48
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 5e-30
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-56
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 4e-54
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 7e-31
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-12
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-54
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-42
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-40
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-36
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-34
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-47
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-41
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 6e-33
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-23
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 6e-21
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-44
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 7e-41
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-37
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-04
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-41
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 5e-40
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-30
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-38
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-31
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 3e-30
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 3e-07
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-37
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-29
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 8e-26
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 8e-14
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-13
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 9e-13
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-36
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-31
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-22
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-36
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-34
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 8e-32
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-30
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-11
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 8e-08
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-36
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-29
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-26
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-14
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 6e-08
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 9e-27
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 1e-22
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 3e-21
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 1e-15
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 6e-13
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 3e-09
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-23
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-17
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-09
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-07
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-16
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-15
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-15
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-15
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-15
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-14
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-07
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 3e-14
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 9e-07
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 2e-06
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 2e-04
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 2e-06
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 7e-05
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 4e-04
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 6e-06
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 4e-05
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 6e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
 Score =  238 bits (609), Expect = 2e-68
 Identities = 88/409 (21%), Positives = 151/409 (36%), Gaps = 36/409 (8%)

Query: 313 LLLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLARSP-P 371
            +++L+  +  +        +      + ++          IL  GG + L+++ R+   
Sbjct: 144 KMVALLNKTNVKFLAITTDCLQILAYGNQESK-------LIILASGGPQALVNIMRTYTY 196

Query: 372 EGLQSEVAKAIANLSVDSKVAKAVSENGGIDILADLARSTNRLVAEEVVGGLWNLSVGED 431
           E L    ++ +  LSV S    A+ E GG+  L       ++ + +  +  L NLS  + 
Sbjct: 197 EKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLS--DA 254

Query: 432 HKGAIARAGGIKALVDLIFKWSSWNDGVLERAAGALANLAA-DDKCSLEVARAGGVHALV 490
                   G +  LV L+    S +  V+  AAG L+NL   + K  + V + GG+ ALV
Sbjct: 255 ATKQEGMEGLLGTLVQLL---GSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALV 311

Query: 491 -MLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQLTFSKHEGVRQE 549
             + R+   E + E A  AL +L +                 L  +V+L          +
Sbjct: 312 RTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIK 371

Query: 550 AA-GALWNLSFDDRNREAIAAAGGVEALVALVRSCSSSSQ-------------------G 589
           A  G + NL+    N   +   G +  LV L+      +Q                    
Sbjct: 372 ATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEE 431

Query: 590 LQERAAGALWGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLAFNPGNA 649
           + E   GAL  L+    N I I     +   + L  S + ++   AAG L  LA +   A
Sbjct: 432 IVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAA 491

Query: 650 LCIVEGGGVQALIHLCSSSLSKMARFMAALALAYIVDGRMEDIASIGSS 698
             I   G    L  L  S  ++     AA  L  + + + +D     S 
Sbjct: 492 EAIEAEGATAPLTELLHSR-NEGVATYAAAVLFRMSEDKPQDYKKRLSV 539
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query864
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.97
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.97
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.97
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.96
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.93
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.91
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.91
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.91
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.9
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.9
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.86
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.85
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.84
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.84
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.8
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.77
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.76
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.72
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.71
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.69
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.67
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.65
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.63
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.63
3grl_A651 General vesicular transport factor P115; vesicle t 99.63
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.59
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.56
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.56
3grl_A651 General vesicular transport factor P115; vesicle t 99.56
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.54
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.53
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.52
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.52
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.52
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.51
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.51
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.49
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.41
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.39
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.37
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.37
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.37
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.35
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.34
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.23
1qgr_A876 Protein (importin beta subunit); transport recepto 99.22
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.21
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.19
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.18
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.18
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.06
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.03
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.0
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.95
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.94
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.93
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.9
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.89
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.89
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.86
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 98.83
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.82
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 98.8
4gmo_A684 Putative uncharacterized protein; ARM, heat, solen 98.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.78
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.76
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.75
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 98.74
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.73
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.7
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.69
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.68
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.67
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.67
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.67
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.66
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.65
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.63
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.63
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.62
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.62
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.62
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.62
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.61
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 98.61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.58
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.57
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.57
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 98.57
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 98.56
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.56
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.56
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.56
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.55
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.55
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.55
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.55
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.55
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.54
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.54
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.53
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.52
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.5
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.49
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.48
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.48
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 98.46
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.44
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.43
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.4
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.39
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.39
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.38
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.35
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.35
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.34
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.32
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.32
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.32
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.27
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.26
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.25
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 98.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.22
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.21
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 98.21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.15
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.12
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.09
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.06
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.03
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.02
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.02
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.01
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.01
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 98.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.95
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.94
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.92
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.9
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.89
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.88
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.78
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.77
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 97.76
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.63
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.6
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.59
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.59
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.52
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.51
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.49
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.48
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.46
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.44
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.39
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 97.39
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.35
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.34
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.3
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.28
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 97.16
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.11
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 96.95
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.87
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.8
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 96.74
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 96.74
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.73
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.53
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.53
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.47
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.43
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 96.23
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.88
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 95.87
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 95.57
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.14
2x19_B963 Importin-13; nuclear transport, protein transport; 95.09
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 94.56
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 94.56
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 94.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 94.26
4fdw_A401 Leucine rich hypothetical protein; putative cell s 94.25
2x1g_F971 Cadmus; transport protein, developmental protein, 94.11
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 93.81
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 93.57
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 93.55
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 93.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 93.32
2x19_B963 Importin-13; nuclear transport, protein transport; 93.3
2x1g_F971 Cadmus; transport protein, developmental protein, 92.88
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 92.83
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 92.76
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 92.52
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 92.48
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 92.36
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 92.32
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 91.74
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 91.5
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 91.42
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 91.42
4gt6_A394 Cell surface protein; leucine rich repeats, putati 90.66
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 90.54
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 90.48
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 89.55
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 89.01
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 88.88
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 88.8
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 88.11
4gt6_A394 Cell surface protein; leucine rich repeats, putati 87.65
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 87.46
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 87.34
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 87.15
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 86.11
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 83.2
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 82.9
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 82.71
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 82.01
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 81.34
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
Probab=100.00  E-value=8.4e-36  Score=334.95  Aligned_cols=372  Identities=21%  Similarity=0.264  Sum_probs=315.7

Q ss_pred             HHhhcHHHHHHHHccCCHHHHHHHHHHHHHhcccCCcccccchHhHHHHHHhCCHHHHHHHhcCCCHHHHHHHHHHHHHH
Q 048757          306 WLRQGATLLLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLARSPPEGLQSEVAKAIANL  385 (864)
Q Consensus       306 ~~~~gv~~L~~lL~~~~~~v~~~a~~~L~~L~~~~~~~~~~~~~~~~~i~~~~~i~~L~~lL~~~~~~~~~~a~~~L~~L  385 (864)
                      |...+++.|+++|+++++++|..|+++|.+++..+++       .+..+.+.|+||+|+++|++++++++..|+++|++|
T Consensus        45 ~~~~~i~~LV~~L~s~~~~~q~~Aa~~L~~La~~~~~-------~k~~V~~~G~Ip~LV~LL~s~~~~vq~~Aa~AL~nL  117 (584)
T 3l6x_A           45 WRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDK-------VKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNI  117 (584)
T ss_dssp             CCCCCHHHHHHHTTCSCHHHHHHHHHHHHHHHTTCHH-------HHHHHHHTTHHHHHHHGGGCSSHHHHHHHHHHHHHH
T ss_pred             cccccHHHHHHHHCCCCHHHHHHHHHHHHHHHcCChH-------HHHHHHHcCCcHHHHHHHCCCCHHHHHHHHHHHHHH
Confidence            4556699999999999999999999999999976654       468899999999999999999999999999999999


Q ss_pred             hC--CchhHHHHHhcCcHHHHHHHHcc-CCHHHHHHHHHHHHHhcCCCCcHHHHHhhCcHHHHHHHHcc-----------
Q 048757          386 SV--DSKVAKAVSENGGIDILADLARS-TNRLVAEEVVGGLWNLSVGEDHKGAIARAGGIKALVDLIFK-----------  451 (864)
Q Consensus       386 ~~--~~~~~~~i~~~g~i~~Lv~lL~~-~~~~v~~~a~~aL~~Ls~~~~~~~~i~~~g~i~~L~~lL~~-----------  451 (864)
                      +.  +++++..|++.|+|++|+++|++ .+.++++.++.+|++|+.+++++..|++ +++++|++++..           
T Consensus       118 a~~~~~~nk~~I~~~GaIp~LV~LL~s~~~~~~~e~aa~aL~nLS~~~~~k~~I~~-~alp~Lv~LL~~p~sg~~~~~~~  196 (584)
T 3l6x_A          118 SFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVD-HALHALTDEVIIPHSGWEREPNE  196 (584)
T ss_dssp             TSSSCHHHHHHHHHTTHHHHHHHHHHHCCSHHHHHHHHHHHHHHTTSGGGHHHHHH-HTHHHHHHHTHHHHHCCC-----
T ss_pred             HccCCHHHHHHHHHcCCHHHHHHHHcCCCCHHHHHHHHHHHHHHhCCchhhHHHHh-ccHHHHHHHHhcccccccccccc
Confidence            98  48999999999999999999987 6889999999999999999999999996 579999998721           


Q ss_pred             ----cCCCCHHHHHHHHHHHHHhcCCCc-chHHHHhcCc-HHHHHHHHHcc-----CchhHHHHHHHHHHHHhhcCC---
Q 048757          452 ----WSSWNDGVLERAAGALANLAADDK-CSLEVARAGG-VHALVMLARSF-----MFEGVQEQAARALANLVAHGD---  517 (864)
Q Consensus       452 ----~~~~~~~v~~~a~~~L~~L~~~~~-~~~~i~~~~~-i~~Lv~ll~~~-----~~~~v~~~a~~aL~~L~~~~~---  517 (864)
                          .+..++++++.|+++|.||+..++ .+..+++.++ ++.|+.++++.     .+...++.|+++|+||+...+   
T Consensus       197 ~~k~~~~~d~~V~~nAa~~L~NLs~~~~~~R~~i~~~~Gli~~LV~~L~~~~~~~~~~~~~~enav~aL~NLs~~~~~e~  276 (584)
T 3l6x_A          197 DCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREI  276 (584)
T ss_dssp             -----CCCCHHHHHHHHHHHHHHTSSCHHHHHHHHHSTTHHHHHHHHHHHHHHTTCCSCHHHHHHHHHHHHHHTTHHHHS
T ss_pred             cccccccccHHHHHHHHHHHHHHhcCCHHHHHHHHHcCCcHHHHHHHHHHhhcccCccHHHHHHHHHHHHHhhccccccc
Confidence                013457999999999999999876 5888887554 68999999853     346788999999999996410   


Q ss_pred             -------------------CCcccchhhhccChHHHHHHHhc-CCCHHHHHHHHHHHHHhcCCh-----hhHHHHHHCCC
Q 048757          518 -------------------SNSNNAAVGLETGALEALVQLTF-SKHEGVRQEAAGALWNLSFDD-----RNREAIAAAGG  572 (864)
Q Consensus       518 -------------------~~~~~~~~~~~~~~i~~L~~lL~-~~~~~v~~~a~~~L~~Ls~~~-----~~~~~i~~~~~  572 (864)
                                         ..+.....+...++++.|+.+|. +.++.+++.|+++|+||+...     ..+..+.+.++
T Consensus       277 ~~~~~~~~~~~~~~~~~~~~~~~Gve~L~~~~~v~~Ll~LL~~s~~~~v~E~Aa~AL~nL~ag~~~~~~~~~~~v~~~~g  356 (584)
T 3l6x_A          277 PQAERYQEAAPNVANNTGTSPARGYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKA  356 (584)
T ss_dssp             TTCCC--------------CCCCGGGGGGSHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHSSCSHHHHHHHHHHTSHHH
T ss_pred             cchhhhhhhcccccccccccCchhHHHHhcccHHHHHHHHHccCCCHHHHHHHHHHHHHHHcCCccccHHHHHHHHHcCc
Confidence                               01112234455677888999995 568999999999999998753     23445555788


Q ss_pred             hHHHHHHHHhcCCCCHHHHHHHHHHHHHhccCchhhHHhhhcCCHHHHHHHHccC--------CHHHHHHHHHHHHHhcC
Q 048757          573 VEALVALVRSCSSSSQGLQERAAGALWGLSLSEANSIAIGREGGVAPLIALARSA--------VVDVHETAAGALWNLAF  644 (864)
Q Consensus       573 i~~Lv~lL~~~~~~~~~v~~~A~~aL~~L~~~~~~~~~i~~~~~i~~Lv~lL~~~--------~~~v~~~a~~aL~~L~~  644 (864)
                      ++.|+++|.+   +++.++..|+++|+||+.++.++..| ..|+++.|+.+|.++        .++++..|+++|.|++.
T Consensus       357 lp~Lv~LL~s---~~~~v~~~A~~aL~nLs~~~~~~~~I-~~g~ip~LV~LL~~~~~~~~~~~s~~v~~~a~~tL~NL~a  432 (584)
T 3l6x_A          357 LSAIADLLTN---EHERVVKAASGALRNLAVDARNKELI-GKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIA  432 (584)
T ss_dssp             HHHHHHGGGC---SCHHHHHHHHHHHHHHHTTCSCHHHH-HHHHHHHHHHTSSSSSCSGGGTCCHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHcC---CCHHHHHHHHHHHHHHhCChhHHHHH-HhCCHHHHHHHhcCCcccccccchHHHHHHHHHHHHHHhc
Confidence            9999999997   89999999999999999998888777 678999999999876        46889999999999965


Q ss_pred             -CcccHHHHHhCCcHHHHHHHhcCC-CcHHHHHHHHHHHHHhhcCCc
Q 048757          645 -NPGNALCIVEGGGVQALIHLCSSS-LSKMARFMAALALAYIVDGRM  689 (864)
Q Consensus       645 -~~~~~~~i~~~g~v~~L~~ll~~~-~~~~~r~~aa~aL~~l~~~~~  689 (864)
                       +++++..|.+.|+|+.|++++.++ ..+.++..|+++|.+|.....
T Consensus       433 ~~~~~~~~I~~~g~I~~Lv~LL~s~~~~~~v~k~Aa~vL~nl~~~~e  479 (584)
T 3l6x_A          433 ENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKE  479 (584)
T ss_dssp             TCHHHHHHHHHTTHHHHHHHHHTCSSSCHHHHHHHHHHHHHHHTSHH
T ss_pred             CCHHHHHHHHHCCChHHHHHHHhCCCCChHHHHHHHHHHHHHHcCHH
Confidence             788999999999999999999885 358899999999999986544
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 864
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 8e-22
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-11
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 4e-11
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-10
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 7e-18
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-16
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-12
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 7e-12
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-11
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 8e-08
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 5e-11
d1wa5b_ 503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 5e-04
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 3e-10
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 2e-05
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 5e-10
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 9e-10
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 5e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Plakophilin 1 helical region
domain: Plakophilin 1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 97.2 bits (240), Expect = 8e-22
 Identities = 76/451 (16%), Positives = 145/451 (32%), Gaps = 48/451 (10%)

Query: 314 LLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLARSPPEG 373
            +  + S  ++ Q   AY +      D+          + + + GG+  L+DL RSP + 
Sbjct: 7   AVQYLSSQDEKYQAIGAYYIQHTCFQDESAK-------QQVYQLGGICKLVDLLRSPNQN 59

Query: 374 LQSEVAKAIANLSVDSKVAK-AVSENGGIDILADLARSTNRL-VAEEVVGGLWNLSVGED 431
           +Q   A A+ NL   S   K       GI     L R T    + +++ G LWNLS  ++
Sbjct: 60  VQQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSSTDE 119

Query: 432 HKGAIARAGGIKALVDLIFKWSSWNDG------------VLERAAGALANLAADDK-CSL 478
            K  +           +I  +S W DG            V   A G L NL++ D     
Sbjct: 120 LKEELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEVFFNATGCLRNLSSADAGRQT 179

Query: 479 EVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGAL------ 532
               +G + +L+   ++ +     +  +      V H  S   +A V      L      
Sbjct: 180 MRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYNARN 239

Query: 533 -----EALVQLTFSKHEGVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVRSCSSSS 587
                 +    +    + +       L     + +    +  +  +   + L+      +
Sbjct: 240 AYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKSKKDA 299

Query: 588 QGLQERAAGAL----WGLSLSEANSIAIGREGGVAPLIALARSAVVDVHETAAGALWNLA 643
                  A        GL  S  + +   +E G+  +  L +S   DV  + A  L N++
Sbjct: 300 TLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLLSNMS 359

Query: 644 FNPGNALCIVEGGGVQALIHLCSSSLSKMA-----RFMAALALAYIVDGRMEDIASIGSS 698
            +P     +        +  L +S     +        A   +  ++  + +      SS
Sbjct: 360 RHPLLHRVMGN-QVFPEVTRLLTSHTGNTSNSEDILSSACYTVRNLMASQPQLAKQYFSS 418

Query: 699 -----LEGTSESENLDVIRRMALKHIEDFCA 724
                +     S         A   + D  +
Sbjct: 419 SMLNNIINLCRSSASPKAAEAARLLLSDMWS 449
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query864
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.97
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.96
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.95
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.95
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.91
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.87
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.71
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.7
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.6
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.52
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.33
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.3
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.29
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.25
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.24
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.2
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.16
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.99
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.87
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.84
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.76
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.74
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.64
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.59
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.56
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.51
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.51
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.5
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.49
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.49
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.47
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.45
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.4
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.34
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.24
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.19
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.12
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.05
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.05
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.97
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.97
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.96
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.94
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.92
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.72
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.7
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.4
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.29
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.26
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 97.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.69
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.66
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.43
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.05
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 95.95
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 95.79
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 95.69
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 95.45
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 95.24
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 95.03
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 94.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 93.27
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 93.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 91.93
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 91.59
d2ifga3156 High affinity nerve growth factor receptor, N-term 90.98
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 87.91
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.8e-32  Score=314.02  Aligned_cols=482  Identities=20%  Similarity=0.176  Sum_probs=366.6

Q ss_pred             hhcHHHHHHHHccCCHHHHHHHHHHHHHhcccCCcccccchHhHHHHHHhCCHHHHHHHhcC-CCHHHHHHHHHHHHHHh
Q 048757          308 RQGATLLLSLMESSQQEVQERAAYAVATFVVIDDQNAMVDCQRAEAILRHGGVRLLLDLARS-PPEGLQSEVAKAIANLS  386 (864)
Q Consensus       308 ~~gv~~L~~lL~~~~~~v~~~a~~~L~~L~~~~~~~~~~~~~~~~~i~~~~~i~~L~~lL~~-~~~~~~~~a~~~L~~L~  386 (864)
                      .+.||.|+++|+++|..++..|+.++++++..+..       +...+...++++.++.+|++ .+++++..++.+|++++
T Consensus        16 ~~aip~L~~lL~~~~~~v~~~A~~~l~~l~~~~~~-------~~~~~~~~~~v~~l~~~L~~~~~~~~~~~a~~~L~~l~   88 (529)
T d1jdha_          16 TRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEAS-------RHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLS   88 (529)
T ss_dssp             -CHHHHHHHHHTCSCHHHHHHHHHHHHHHHTSHHH-------HHHHHTCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhccHH-------HHHHHHhhhHHHHHHHHHcCCCCHHHHHHHHHHHHHHh
Confidence            35599999999999999999999999999854421       22333345789999999965 67899999999999999


Q ss_pred             CCchhHHHHHhcCcHHHHHHHHccCCHHHHHHHHHHHHHhcCC-CCcHHHHHhhCcHHHHHHHHcccCCCCHHHHHHHHH
Q 048757          387 VDSKVAKAVSENGGIDILADLARSTNRLVAEEVVGGLWNLSVG-EDHKGAIARAGGIKALVDLIFKWSSWNDGVLERAAG  465 (864)
Q Consensus       387 ~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~a~~aL~~Ls~~-~~~~~~i~~~g~i~~L~~lL~~~~~~~~~v~~~a~~  465 (864)
                      .+++.+..+++.|+++.|+++|+++++.++..|+++|++++.+ +..+..+.+.|++++|+.++.   +++++++..++.
T Consensus        89 ~~~~~~~~i~~~g~i~~Li~lL~~~~~~v~~~a~~aL~~l~~~~~~~~~~~~~~g~i~~Lv~lL~---~~~~~~~~~a~~  165 (529)
T d1jdha_          89 HHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLN---KTNVKFLAITTD  165 (529)
T ss_dssp             TSHHHHHHHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHCTTHHHHHHHHTHHHHHHHGGG---CCCHHHHHHHHH
T ss_pred             CCchhHHHHHHCCCHHHHHHHhCCCCHHHHHHHHHHHHHhhcccchhhhHHHhcCCchHHHHHHH---ccChHHHHHHHH
Confidence            9999999999999999999999999999999999999999874 556778889999999999996   478899999999


Q ss_pred             HHHHhcCCCc-chHHHHhcCcHHHHHHHHHccCchhHHHHHHHHHHHHhhcCCCCcccchhhhccChHHHHHHHhcCCCH
Q 048757          466 ALANLAADDK-CSLEVARAGGVHALVMLARSFMFEGVQEQAARALANLVAHGDSNSNNAAVGLETGALEALVQLTFSKHE  544 (864)
Q Consensus       466 ~L~~L~~~~~-~~~~i~~~~~i~~Lv~ll~~~~~~~v~~~a~~aL~~L~~~~~~~~~~~~~~~~~~~i~~L~~lL~~~~~  544 (864)
                      +|.+++..++ .+..+...|+++.|+.+++.++.+.++..+++++.+++.    +++++..+.+.|+++.|+.++.+++.
T Consensus       166 ~L~~l~~~~~~~~~~~~~~~~~~~L~~ll~~~~~~~~~~~~~~~l~~ls~----~~~~~~~~~~~g~~~~L~~ll~~~~~  241 (529)
T d1jdha_         166 CLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSV----CSSNKPAIVEAGGMQALGLHLTDPSQ  241 (529)
T ss_dssp             HHHHHHTTCHHHHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHTT----STTHHHHHHHTTHHHHHHTTTTSSCH
T ss_pred             HHHHHhhhhhHHHHHHHhcccchHHHHHHHhhhhHHHHHHHHHHHhhhhc----cccccchhhhhhhhhhHHHHhcccch
Confidence            9999998765 677888999999999999887778899999999999997    56788889999999999999999999


Q ss_pred             HHHHHHHHHHHHhcCChhhHHHHHHCCChHHHHHHHHhcCCCCHHHHHHHHHHHHHhccC-chhhHHhhhcCCHHHHHHH
Q 048757          545 GVRQEAAGALWNLSFDDRNREAIAAAGGVEALVALVRSCSSSSQGLQERAAGALWGLSLS-EANSIAIGREGGVAPLIAL  623 (864)
Q Consensus       545 ~v~~~a~~~L~~Ls~~~~~~~~i~~~~~i~~Lv~lL~~~~~~~~~v~~~A~~aL~~L~~~-~~~~~~i~~~~~i~~Lv~l  623 (864)
                      +++..+++++.+++......  ....|+++.|++++.+   +++.++..|+++|++++.+ +.++..+.+.++++.|+.+
T Consensus       242 ~~~~~a~~~l~~ls~~~~~~--~~~~~~i~~Lv~ll~~---~~~~~~~~a~~~L~~l~~~~~~~~~~i~~~~~i~~Li~~  316 (529)
T d1jdha_         242 RLVQNCLWTLRNLSDAATKQ--EGMEGLLGTLVQLLGS---DDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRT  316 (529)
T ss_dssp             HHHHHHHHHHHHHHTTCTTC--SCCHHHHHHHHHHTTC---SCHHHHHHHHHHHHHHTTTCHHHHHHHHHTTHHHHHHHH
T ss_pred             hhhhhhhhHHHhccccccch--hhhhhcchhhhhhccc---ccHHHHHHHHHHHHhhccchhHHHHHHHHhhhHHHHHHH
Confidence            99999999999997654321  1223678999999986   8999999999999999875 7788888999999999998


Q ss_pred             Hc--cCCHHHHHHHHHHHHHhcCCcc----cHHHHHhCCcHHHHHHHhcCCCcHHHHHHHHHHHHHhhcCCcccee----
Q 048757          624 AR--SAVVDVHETAAGALWNLAFNPG----NALCIVEGGGVQALIHLCSSSLSKMARFMAALALAYIVDGRMEDIA----  693 (864)
Q Consensus       624 L~--~~~~~v~~~a~~aL~~L~~~~~----~~~~i~~~g~v~~L~~ll~~~~~~~~r~~aa~aL~~l~~~~~~~~~----  693 (864)
                      +.  ++.++++..|+++|++++....    .+..+...|+++.|+.++..+....++..+.+++.++.........    
T Consensus       317 l~~~~~~~~~~~~a~~aL~~l~~~~~~~~~~~~~i~~~~~l~~L~~ll~~~~~~~~~~~~~~~l~~l~~~~~~~~~l~~~  396 (529)
T d1jdha_         317 VLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQ  396 (529)
T ss_dssp             HHHHTTCHHHHHHHHHHHHHHTSSSTTHHHHHHHHHHTTCHHHHHHTTSTTCCHHHHHHHHHHHHHHTTSGGGHHHHHHT
T ss_pred             HHhhhcchhHHHHHHHHhhcccchhhcchhhhhhHHhcccchhHHHHHhccchHHHHHHHHHHHhhcchhhhhhhhhhhc
Confidence            84  4668899999999999997543    3557788999999999998877677888888999998765431100    


Q ss_pred             ----eecccccCCCcccchHHHHHHHHHHHHhhcccccchhhhhHHHHhccChh--hHHHHhhccchhHHhcccc-ccCc
Q 048757          694 ----SIGSSLEGTSESENLDVIRRMALKHIEDFCAGRIALKHIEDFVRSFSDPQ--AFATALASAVPKSLAQITE-GARI  766 (864)
Q Consensus       694 ----~~~~ll~~~~~~v~~~~~~~~al~~l~~~~~g~~~~~~i~~l~~~~~~~~--~~~~a~~~~a~~~l~~~~~-~~~~  766 (864)
                          .+..++.+....++...+                    .........+..  ......+..++..+++... ...+
T Consensus       397 g~i~~L~~lL~~~~~~~~~~~~--------------------~~~~~~~~~~~~~~~~~~~~~~~al~~la~~~~~r~~~  456 (529)
T d1jdha_         397 GAIPRLVQLLVRAHQDTQRRTS--------------------MGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVI  456 (529)
T ss_dssp             THHHHHHHHHHHHHHHHC-------------------------------CBTTBCHHHHHHHHHHHHHHHTTSHHHHHHH
T ss_pred             ccHHHHHHHHhcCCHHHHHHHH--------------------hhhhhHHhhcccchHHHHHHHHHHHHHHccCHHHHHHH
Confidence                000011111111111100                    000000000000  0000111222333332211 2222


Q ss_pred             ccccccccchhhHHHHHHHhcCCcHHHHHHHHHHHHhhccCCCcchhhhhhhhhhcChhhHHHHhhhhhccchh
Q 048757          767 PEAAHLRCSGAEIGRFVSMLRNPSSILKACAAVALLQFTMPGGQHSMHHTNLLQNVGAPRVLQSTAAAAIAPVE  840 (864)
Q Consensus       767 ~~~~~~~~~~~~i~~lv~~l~~~~~~~~~~Aa~al~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  840 (864)
                      .+.|       ++++|+++|.++++.+|..|+++|.+++..++.     ...+.+.|+...|-++-.+..+...
T Consensus       457 ~~~~-------~i~~Lv~lL~~~~~~v~~~a~~aL~~L~~~~~~-----~~~i~~~g~~~~L~~Ll~s~n~~v~  518 (529)
T d1jdha_         457 RGLN-------TIPLFVQLLYSPIENIQRVAAGVLCELAQDKEA-----AEAIEAEGATAPLTELLHSRNEGVA  518 (529)
T ss_dssp             HHTT-------CHHHHHHGGGCSCHHHHHHHHHHHHHHTTSHHH-----HHHHHHTTCHHHHHHGGGCSSHHHH
T ss_pred             HHCC-------CHHHHHHHhCCCCHHHHHHHHHHHHHHhcChhh-----HHHHHHCCCHHHHHHHhCCCCHHHH
Confidence            3334       899999999999999999999999999753222     2346666888888887766555443
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure