Citrus Sinensis ID: 048786

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860--

MASMKDLSDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLKSLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSSIFLMKNLRSLYFSGCNEPPASASWHLHLPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKELYLNRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNLQFVRANGCSSLVTLFGALKLCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIVFPGSQIPKWFMYQNEGSSITVTRPSYLYNVNKVVGFAICCVFQVPKHSTGTYLFHSYPAHELECSMDGSGEGHYIYFRGKFGHVVSDHLWLLFLPRHGHNWQFESNLIRLSFRSISDPTWKVKRCGFHPIYMHEVEEFDETTKQSTRFTSCNLNEVHHDFVGSNMEVAQASGSGSSQWKWLKPVEVAVVMIMMRNHNLRDLDNSNEGQSLLNRGTVEDLWYNSRAYDVFDDMPTKERASHLMCCINSMVSQAKAISQQGQFVKMISVDSGCMSCYKKWGRQTVRRQSPQEPGNCSRLWEEADEFPDIVQVLSDGTDIRELSLAIELLFGLVQLTLNGCKNLERLPRTISALKYLSTLNLSGLSKFREFPEITSSRDQLLEIHLEGTAIRGLPASIELLSGNILSNLKDCKNLKSLPSTINGLRSLRMMYPSGCSKLKNVTETLGKVESLEVRLSSWNRPKMQNDFDCVEQSAVETVTKLAKAELLRDSDSWKKNVDKCMKLSTTATSAC

ccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccEEcccccccccccccccccccccccccccccHHHHHHHcHHHHHHHHHHHHHHccccccccEEEEEccccccccccccccccEEEEEccccccccccEEEEEEEEEEEcccccccccccccccccEEEEEcccccccEEEEEccccccccccEEEEEEEcccccccccccccEEEEEEEEccccEEEEEEccEEEEccccccccccccccccccccccccccccccccccHHcccccccccccccccccccEEEEEEEcccccccccccccccHHcccccccHHcccccccccccccccHHccccccccccccccccccccccccccccEEcccccccccccccHHHHcccccccccccccccccccccccHHHHHHcccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEccccccccccccccccccccHHHHHcccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccc

ccccccccEEEccccccccccccccccHcccEEEccccccHccccccccccccccEEEccccccHHcccHcccccHHHHEEEccccccccccHHHHHcccccEEEcccccccccccHHHHccccccEEEccccccHccccHHHcccHHccEEEccccccccccccHccccccEEEEccccccccccccccccccHHHHEccccccccccccccccccccEEEccccccccccccHHHcccccccEEEccccccccccHHHHHHHcccEEEccccccccccccccccccEEEccccccccEcccccccccccccccccHHHHHHHccccccHcccHHHHHHHHHcccccccccccccccccHHHHccccccEEEEEcccccccccccccEEEEEEEEcccccccccccccEEcEEEEEEccccccccccccccccccccccEEEEEEcccccccccccccEEEEEEEEcccccEEEEEccEEEEEEccccccccccccccccEEcccccccccccccccEEEcccccccccccEcccccccccccccccccccccccccHHHHcccccccHHEEEcccccccHHccccHcccHHHHHHHHccccccccccccccHHHHHEEccccccHHccccccccccccEEEccccccHHHccHHHHHHHHHHHccccccccccHHHHHHcccEEEcccccccccccHHHHcHHcccEEEcccccHHHcccHHHcccHHHcEEEccccccccccHHHHHHHcccEEEcccccccccccccccccccccEEEccccccHcccccccHHHHHHHHEEcccccccccccHHHHHHHHHHHHHcHHHHHHHccccccccccccccHHcccccccc

masmkdlsdlyldgtsitevpssiellTGLELltlkgcknlsslpvtisSLKCLrtlelsgcsklkkFPQIVASMEDLSKLyldgtsiaevpssiellpgleLLYLNecknlvrlpssinglkslktlnlsgccklenvpdtlgkvesleeldvsgtairrptsSIFLMKNLRSLYFsgcneppasaswhlhlpfnllgksscpvalmlpsltgvcsltkldlsdcglgeaaipsdidNLHSLKELYLNRNNFVTLPASisgllnleelelEDCKrlqslpqippnlqfvraNGCSSLVTLFGALKLCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQavsdpghklsivfpgsqipkwfmyqnegssitvtrpsylyNVNKVVGFAICCvfqvpkhstgtylfhsypahelecsmdgsgeghyiYFRGKFGHVVSDHLWLLflprhghnwqfesnlirlsfrsisdptwkvkrcgfhpiymheveefdettkqstrftscnlnevhhdFVGSNMEvaqasgsgssqwkwlkPVEVAVVMIMMRNhnlrdldnsnegqsllnrgtvedlwynsraydvfddmptkeRASHLMCCINSMVSQAKAISQQGQFVKMISVDsgcmscykkwgrqtvrrqspqepgncsrlweeadefpdivqvlsdgtdIRELSLAIELLFGLVQLTLNgcknlerlPRTISALKYLSTLNlsglskfrefpeitssrDQLLEIHLEGTAIRGLPASIELLSGNIlsnlkdcknlkslpstiNGLRSLrmmypsgcskLKNVTETLGKVESLEVRLsswnrpkmqndfdcVEQSAVETVTKLAKAELLRDSDSWKKNVDKCMKlsttatsac

masmkdlsDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLKSLKTLNLSGCCKLenvpdtlgkvesleeldvsgtairrptssIFLMKNLRSLYFSGCNEPPASASWHLHLPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKELYLNRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNLQFVRANGCSSLVTLFGALKLCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIVFPGSQIPKWFMYQNEGSSITVTRPSYLYNVNKVVGFAICCVFQVPKHSTGTYLFHSYPAHELECSMDGSGEGHYIYFRGKFGHVVSDHLWLLFLPRHGHNWQFESNLIRLSFRSISDPTWKVKRCGFHPIYMHEVEEFDETTKQSTRFTSCNLNEVHHDFVGSNMEVAQasgsgssqwkwlKPVEVAVVMIMMRNHNlrdldnsnegqSLLNrgtvedlwyNSRAYDVFDDMPTKERASHLMCCINSMVSQAKAISQQGQFVKMISVDSGCMSCYKKWgrqtvrrqspqepgNCSRLWEEADEFPDIVQVLSDGTDIRELSLAIELLFGLVQLTLNGCKNLERLPRTISALKYLSTLNLSGLSKFREFPEITSSRDQLLEIHLEGTAIRGLPASIELLSGNILSnlkdcknlkslpSTINGLRSLRMMYPSGCSKLKNVTETLGKVESLEVrlsswnrpkmqnDFDCVEQSAVETVTKLAKaellrdsdswkknvdkcmklsttatsac

MASMKDLSDLYLDGTSITEVPSSIelltglelltlKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIellpglellylneCKNLVRLPSSINGLKSLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSSIFLMKNLRSLYFSGCNEPPASASWHLHLPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKELYLNRNNFVTLPASISGllnleeleleDCKRLQSLPQIPPNLQFVRANGCSSLVTLFGALKLCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIVFPGSQIPKWFMYQNEGSSITVTRPSYLYNVNKVVGFAICCVFQVPKHSTGTYLFHSYPAHELECSMDGSGEGHYIYFRGKFGHVVSDHLWLLFLPRHGHNWQFESNLIRLSFRSISDPTWKVKRCGFHPIYMHEVEEFDETTKQSTRFTSCNLNEVHHDFVGSNMEVAQASGSGSSQWKWLKPVEVAVVMIMMRNHNLRDLDNSNEGQSLLNRGTVEDLWYNSRAYDVFDDMPTKERASHLMCCINSMVSQAKAISQQGQFVKMISVDSGCMSCYKKWGRQTVRRQSPQEPGNCSRLWEEADEFPDIVQVLSDGTDIRELSLAIELLFGLVQLTLNGCKNLERLPRTISALKYLSTLNLSGLSKFREFPEITSSRDQLLEIHLEGTAIRGLPASIELLSGNILSNLKDCKNLKSLPSTINGLRSLRMMYPSGCSKLKNVTETLGKVESLEVRLSSWNRPKMQNDFDCVEQSAVETVTKLAKAELLRDSDSWKKNVDKCMKLSTTATSAC

*********LYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLKSLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSSIFLMKNLRSLYFSGCNEPPASASWHLHLPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKELYLNRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNLQFVRANGCSSLVTLFGALKLCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIVFPGSQIPKWFMYQNEGSSITVTRPSYLYNVNKVVGFAICCVFQVPKHSTGTYLFHSYPAHELECSMDGSGEGHYIYFRGKFGHVVSDHLWLLFLPRHGHNWQFESNLIRLSFRSISDPTWKVKRCGFHPIYMHEVEEFDETTKQSTRFTSCNLNEVHHDFVGSNM**********SQWKWLKPVEVAVVMIMMRNHNLRDL*******SLLNRGTVEDLWYNSRAYDVFDDMPTKERASHLMCCINSMVSQAKAISQQGQFVKMISVDSGCMSCYKKWGRQT***********CSRLWEEADEFPDIVQVLSDGTDIRELSLAIELLFGLVQLTLNGCKNLERLPRTISALKYLSTLNLSGLSKFREFPEITSSRDQLLEIHLEGTAIRGLPASIELLSGNILSNLKDCKNLKSLPSTINGLRSLRMMYPSGCSKLKNVTETLGKVESLEVRLSSWNR**MQNDFDCVEQSAVETVTKLAKAEL*************************

MASMKDLSDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLKSLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSSIFLMKNLRSLYFSGCNEPPASAS*HLHLPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKELYLNRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNLQFVRANGCSSLVTLFGALKLCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIVFPGSQIPKWFMYQNEGSSITVTRPSYLYNVNKVVGFAICCVFQVPKHSTGTYLFHSYPAHELECSMDGSGEGHYIYFRGKFGHVVSDHLWLLFLPRHGHNWQFESNLIRLSFRSISDPTWKVKRCGFHPIYMHEVEEFDE*********SCNLNEVHHDFVGSNMEVAQASGSGSSQWKWLKPVEVAVVMIMMRNHNLRDLDNSNEGQSLLNRGTVEDLWYNSRAYDVFDDMPTKERASHLMCCINSMVSQAKA*SQQGQFVKMISVDSGCMSCYKKWG******QSPQEPGNCSRLWEEADEFPDIVQVLSDGTDIRELSLAIELLFGLVQLTLNGCKNLERLPRTISALKYLSTLNLSGLSKFREFPEITSSRDQLLEIHLEGTAIRGLPASIELLSGNILSNLKDCKNLKSLPSTINGLRSLRMMYPSGCSKLKNVTETLGKVESLEVRLSSWNRPKMQNDFDCVEQSAVETVTKLAKAELLRDSDSWKKNVDKCMKLSTTATSAC

********DLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLKSLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSSIFLMKNLRSLYFSGCNEPPASASWHLHLPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKELYLNRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNLQFVRANGCSSLVTLFGALKLCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIVFPGSQIPKWFMYQNEGSSITVTRPSYLYNVNKVVGFAICCVFQVPKHSTGTYLFHSYPAHELECSMDGSGEGHYIYFRGKFGHVVSDHLWLLFLPRHGHNWQFESNLIRLSFRSISDPTWKVKRCGFHPIYMHEVEE*********RFTSCNLNEVHHDFVGSNMEV*********QWKWLKPVEVAVVMIMMRNHNLRDLDNSNEGQSLLNRGTVEDLWYNSRAYDVFDDMPTKERASHLMCCINSMVSQAKAISQQGQFVKMISVDSGCMSCYKKWGR*************CSRLWEEADEFPDIVQVLSDGTDIRELSLAIELLFGLVQLTLNGCKNLERLPRTISALKYLSTLNLSGLSKFREFPEITSSRDQLLEIHLEGTAIRGLPASIELLSGNILSNLKDCKNLKSLPSTINGLRSLRMMYPSGCSKLKNVTETLGKVESLEVRLSSWNRPKMQNDFDCVEQSAVETVTKLAKAELLRDSDSWKKNVDKCMKL********

*ASMKDLSDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLKSLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSSIFLMKNLRSLYFSGCNEPPASASWHLHLPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKELYLNRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNLQFVRANGCSSLVTLFGALKLCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIVFPGSQIPKWFMYQNEGSSITVTRPSYLYNVNKVVGFAICCVFQVPKHSTGTYLFHSYPAHELECSMDGSGEGHYIYFRGKFGHVVSDHLWLLFLPRHGHNWQFESNLIRLSFRSISDPTWKVKRCGFHPIYMHEVEEFDETTKQSTRFTSCNLNEVHHDFVGSNMEVAQASGSGSSQWKWLKPVEVAVVMIMMRNHNLRDLDNSNEGQSLLNRGTVEDLWYNSRAYDVFDDMPTKERASHLMCCINSMVSQAKAISQQGQFVKMISVDSGCMSCYKKWGRQTVRRQSPQEPGNCSRLWEEADEFPDIVQVLSDGTDIRELSLAIELLFGLVQLTLNGCKNLERLPRTISALKYLSTLNLSGLSKFREFPEITSSRDQLLEIHLEGTAIRGLPASIELLSGNILSNLKDCKNLKSLPSTINGLRSLRMMYPSGCSKLKNVTETLGKVESLEVRLSSWNRPKMQNDFDCVEQSAVETVTKLAKAELLRDSDSWKKNVDKCMKLSTTA****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		862	2.2.26 [Sep-21-2011]
Q40392		1144	TMV resistance protein N	N/A	no	0.411	0.310	0.346	2e-45
Q9SZ67		1895	Probable WRKY transcripti	no	no	0.167	0.075	0.452	2e-21
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.313	0.207	0.332	7e-20
P0CB16		1201	Putative disease resistan	no	no	0.278	0.199	0.278	1e-14
Q9RBS2		1024	Protein PopC OS=Ralstonia	yes	no	0.329	0.277	0.295	2e-14
O82500		1095	Putative disease resistan	no	no	0.352	0.277	0.271	9e-14
Q8VZC7		1222	Probable disease resistan	no	no	0.317	0.224	0.283	1e-11
Q9FL92		1372	Probable WRKY transcripti	no	no	0.145	0.091	0.354	1e-11
A4D1F6		860	Leucine-rich repeat and d	yes	no	0.270	0.270	0.281	3e-11
P26337		630	Putative adenylate cyclas	N/A	no	0.341	0.466	0.256	3e-11

>sp\|Q40392\|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1	Back alignment and function desciption

 Score =  184 bits (468), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 133/384 (34%), Positives = 199/384 (51%), Gaps = 29/384 (7%)

Query: 15   TSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIVAS 74
            +++ EV  S+   + +  L L  CK+L   P    +++ L  L L  C  L+K P+I   
Sbjct: 653  SNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCV--NVESLEYLGLRSCDSLEKLPEIYGR 710

Query: 75   MEDLSKLYLDGTSIAEVPSSI-ELLPGLELLYLNECKNLVRLPSSINGLKSLKTLNLSGC 133
            M+   ++++ G+ I E+PSSI +    +  L L   KNLV LPSSI  LKSL +L++SGC
Sbjct: 711  MKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGC 770

Query: 134  CKLENVPDTLGKVESLEELDVSGTAIRRPTSSIFLMKNLRSLYFSGCNEPPASASWHLHL 193
             KLE++P+ +G +++L   D S T I RP SSI  +  L  L F G  +       H   
Sbjct: 771  SKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKD-----GVHFEF 825

Query: 194  PFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKELYLNRNNF 253
            P         PVA       G+ SL  L+LS C L +  +P +I +L SLK+L L+RNNF
Sbjct: 826  P---------PVA------EGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNF 870

Query: 254  VTLPASISGLLNLEELELEDCKRLQSLPQIPPNLQFVRANGCSSLVTLFGALKLCRSKYT 313
              LP+SI+ L  L+ L+L+DC+RL  LP++PP L  +  + C   +     L   R K  
Sbjct: 871  EHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHVD-CHMALKFIHYLVTKRKKLH 929

Query: 314  IINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSI-VFPGS----QIPKWFMYQNE 368
             +   D+      N  A +M +    ++        LS+ VF G     +IP WF +Q  
Sbjct: 930  RVKLDDAHNDTMYNLFAYTMFQNISSMRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGW 989

Query: 369  GSSITVTRPSYLYNVNKVVGFAIC 392
             SS++V  P   Y  +K +GFA+C
Sbjct: 990  DSSVSVNLPENWYIPDKFLGFAVC 1013

Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)

>sp\|Q9SZ67\|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1	Back alignment and function description

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|P0CB16\|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2	Back alignment and function description

>sp\|Q9RBS2\|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2	Back alignment and function description

>sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1	Back alignment and function description

>sp\|Q8VZC7\|DRL36_ARATH Probable disease resistance protein At5g45510 OS=Arabidopsis thaliana GN=At5g45510 PE=1 SV=2	Back alignment and function description

>sp\|Q9FL92\|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1	Back alignment and function description

>sp\|A4D1F6\|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2	Back alignment and function description

>sp\|P26337\|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		862
224127726		1203	tir-nbs-lrr resistance protein [Populus	0.598	0.428	0.419	1e-89
147802475		1244	hypothetical protein VITISV_027841 [Viti	0.501	0.347	0.430	4e-84
359493273		1233	PREDICTED: TMV resistance protein N-like	0.573	0.400	0.4	8e-84
224146780		540	predicted protein [Populus trichocarpa]	0.580	0.925	0.420	6e-83
359496026		1250	PREDICTED: TMV resistance protein N-like	0.558	0.384	0.395	3e-79
296090591		771	unnamed protein product [Vitis vinifera]	0.559	0.625	0.400	4e-79
224114331		1119	tir-nbs-lrr resistance protein [Populus	0.511	0.394	0.409	1e-77
224114311		1144	tir-nbs-lrr resistance protein [Populus	0.563	0.424	0.384	2e-77
255561514		994	leucine-rich repeat-containing protein,	0.566	0.490	0.392	2e-75
359493250		1439	PREDICTED: TMV resistance protein N-like	0.588	0.352	0.370	8e-75

>gi\|224127726\|ref\|XP_002329162.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222870943\|gb\|EEF08074.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  337 bits (865), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 228/544 (41%), Positives = 317/544 (58%), Gaps = 28/544 (5%)

Query: 1    MASMKDLSDLYLDG-TSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLEL 59
               + +L  L L G   ++EV SSI     L  + L  C++L+SLP  IS L  L  L L
Sbjct: 661  FTGIPNLERLILQGCRRLSEVHSSIGHHNKLIYVNLMDCESLTSLPSRISGLNLLEELHL 720

Query: 60   SGCSKLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSI 119
            SGCSKLK+FP+I  + + L KL LD TSI E+P SI+ L GL  L L +CK L  LPSSI
Sbjct: 721  SGCSKLKEFPEIEGNKKCLRKLCLDQTSIEELPPSIQYLVGLISLSLKDCKKLSCLPSSI 780

Query: 120  NGLKSLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSSIFLMKNLRSLYFSG 179
            NGLKSLKTL+LSGC +LEN+P+  G++E L ELDVSGTAIR P  SIF +KNL+ L F G
Sbjct: 781  NGLKSLKTLHLSGCSELENLPENFGQLECLNELDVSGTAIREPPVSIFSLKNLKILSFHG 840

Query: 180  CNEPPASAS--WHLHLPFNLL-GKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSD 236
            C E   S +  W   L F L+ GK +   +L+LPSL+G+ SLT+L LS+C LGE A+P+D
Sbjct: 841  CAESSRSTTNIWQ-RLMFPLMPGKRANSTSLVLPSLSGLSSLTRLGLSNCNLGEGAVPND 899

Query: 237  IDNLHSLKELYLNRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNLQFVRANGCS 296
            I  L SL++L L+RN FV+LP SI  L  L+ L +EDCK LQSLP++P NL+  R NGC+
Sbjct: 900  IGYLSSLRQLNLSRNKFVSLPTSIDQLSGLQFLRMEDCKMLQSLPELPSNLEEFRVNGCT 959

Query: 297  SLVTLFGALKLCR---SKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIV 353
            SL  +  + KLC+    +Y  INC    +    N +  ++LR+    Q   +     S++
Sbjct: 960  SLEKMQFSRKLCQLNYLRYLFINCWRLSESDCWNNMFPTLLRKC--FQGPPNLIESFSVI 1017

Query: 354  FPGSQIPKWFMYQNEGSSITVTRPSYLYNVNKVVGFAICCVFQVPKHSTGTYLFHSYPAH 413
             PGS+IP WF +Q+EGSS++V  P + +  ++ +G+A+C     P      +        
Sbjct: 1018 IPGSEIPTWFSHQSEGSSVSVQTPPHSHENDEWLGYAVCASLGYPDFPPNVF------RS 1071

Query: 414  ELECSMDGSG-EGHYIYFRGKFGHVVSDHLWLLFLPRHGHNWQFESNLIRLSFRSISDPT 472
             ++C  +G G E   IY R K   ++SDHLW L+ P      +F+ + +R  F      T
Sbjct: 1072 PMQCFFNGDGNESESIYVRLKPCEILSDHLWFLYFPSRFK--RFDRH-VRFRFEDNCSQT 1128

Query: 473  WKVKRCGFHPIYMHEVEEFDETTKQSTRFTSCNLNEVHHD-------FVGSNMEVAQASG 525
             KV +CG   +Y  +VEE +  T      T   ++E   +        +G   +V +ASG
Sbjct: 1129 -KVIKCGVRLVYQQDVEELNRMTNLYENSTFEGVDECFQESGGALVKRLGHTNDVGEASG 1187

Query: 526  SGSS 529
            S SS
Sbjct: 1188 SVSS 1191

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|147802475\|emb\|CAN61853.1\| hypothetical protein VITISV_027841 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359493273\|ref\|XP_002272034.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224146780\|ref\|XP_002336335.1\| predicted protein [Populus trichocarpa] gi\|222834747\|gb\|EEE73210.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359496026\|ref\|XP_002277166.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296090591\|emb\|CBI40960.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224114331\|ref\|XP_002332400.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222832723\|gb\|EEE71200.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224114311\|ref\|XP_002332395.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222832718\|gb\|EEE71195.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255561514\|ref\|XP_002521767.1\| leucine-rich repeat-containing protein, putative [Ricinus communis] gi\|223538980\|gb\|EEF40577.1\| leucine-rich repeat-containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359493250\|ref\|XP_002268462.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		862
TAIR\|locus:2175991		1294	AT5G17680 [Arabidopsis thalian	0.548	0.365	0.289	8.7e-33
TAIR\|locus:2094498		1981	AT3G25510 [Arabidopsis thalian	0.317	0.138	0.310	2.9e-29
TAIR\|locus:2827629		1355	AT2G17050 [Arabidopsis thalian	0.465	0.295	0.266	1.1e-26
TAIR\|locus:2163426		1187	TAO1 "target of AVRB operation	0.406	0.294	0.298	2.2e-24
TAIR\|locus:2205824		1384	AT1G27170 [Arabidopsis thalian	0.374	0.233	0.304	2.8e-24
TAIR\|locus:2153328		1231	AT5G45230 [Arabidopsis thalian	0.479	0.335	0.270	1.4e-20
TAIR\|locus:2205804		1556	AT1G27180 [Arabidopsis thalian	0.348	0.192	0.289	1.3e-22
TAIR\|locus:2053405		1215	AT2G14080 [Arabidopsis thalian	0.290	0.205	0.321	8.7e-22
TAIR\|locus:2118106		1219	AT4G12010 [Arabidopsis thalian	0.431	0.305	0.284	2.4e-21
UNIPROTKB\|Q40392		1144	N "TMV resistance protein N" [	0.407	0.306	0.292	2.8e-21

TAIR\|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 394 (143.8 bits), Expect = 8.7e-33, P = 8.7e-33
 Identities = 149/515 (28%), Positives = 231/515 (44%)

Query:    13 DGTSITEVPSSIXXXXXXXXXXXKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIV 72
             D   +  +PS +            GC+ L +LP T+ +L  L TLE+SGC  + +FP++ 
Sbjct:   748 DCQRLRTLPSYLGHLVSLKSLNLDGCRRLENLPDTLQNLTSLETLEVSGCLNVNEFPRVS 807

Query:    73 ASMEDLSKLYLDGTSIAEVPSSIXXXXXXXXXXXXXCKNLVRLPSSINGLKSLKTLNLSG 132
              S+E L    +  TSI E+P+ I              K L  LP SI+ L+SL+ L LSG
Sbjct:   808 TSIEVLR---ISETSIEEIPARICNLSQLRSLDISENKRLASLPVSISELRSLEKLKLSG 864

Query:   133 CCKLENVPDTLGKVES-LEELDVSGTAIRRPTSSIFLMKNLRSLYFSGC--NEPPASASW 189
             C  LE+ P  + +  S L   D+  T+I+    +I  +  L  L  S       P S + 
Sbjct:   865 CSVLESFPLEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASRTVIRRAPWSIAR 924

Query:   190 HLHLPFNLLGKSS-CPVALM---LPSLTGVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKE 245
                L    +G S   P  L+    P L+    L  L LS+  + E  IP+ I NL +L E
Sbjct:   925 LTRLQVLAIGNSFFTPEGLLHSLCPPLSRFDDLRALSLSNMNMTE--IPNSIGNLWNLLE 982

Query:   246 LYLNRNNFVTLPASISGXXXXXXXXXXDCKRLQSLP-QIPPNLQFVRANGCSSLVTLFGA 304
             L L+ NNF  +PASI            +C+RLQ+LP ++P  L ++  + C+SLV++ G 
Sbjct:   983 LDLSGNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPRGLLYIYIHSCTSLVSISGC 1042

Query:   305 L-KLCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIVFPGSQIPKWF 363
               + C  K    NC    KL   +  A  ++   L+L++   P H     FPGS IP  F
Sbjct:  1043 FNQYCLRKLVASNCY---KL---DQAAQILIHRNLKLESAK-PEHSY---FPGSDIPTCF 1092

Query:   364 MYQNEGSSITVTRPSYLYNVNKVVGFAICCVFQVP-KHSTGTYLFH-SYPAHELE-CSMD 420
              +Q  G S+ +  P    + + ++GF+ C +  V  ++       H S    + + C + 
Sbjct:  1093 NHQVMGPSLNIQLPQS-ESSSDILGFSACIMIGVDGQYPMNNLKIHCSCILKDADACELV 1151

Query:   421 GSGEGHY----IYFRGKFGHVVSDHLWLLFLPRHGHNWQFESNLIRLSFRSIS----DPT 472
                E  Y     +    FG   SDHL LLF         +   L   S  +       P 
Sbjct:  1152 VMDEVWYPDPKAFTNMYFG---SDHL-LLFSRTCTSMEAYSEALFEFSVENTEGDSFSPL 1207

Query:   473 WKVKRCGFHPIYMHEVEEFDETTKQSTRFTSCNLN 507
              +VK+C  H I + ++ +  E +  S +  S +L+
Sbjct:  1208 GEVKKCAVHLISLKDMMQ--EFSNDSDKIQSSDLD 1240

GO:0005622 "intracellular" evidence=IEA

GO:0006952 "defense response" evidence=IEA;ISS

GO:0007165 "signal transduction" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		862
PLN03210		1153	PLN03210, PLN03210, Resistant to P	4e-24
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-21
PLN03210		1153	PLN03210, PLN03210, Resistant to P	8e-21
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	2e-14
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	3e-11
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-10
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-08
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	2e-08
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	5e-07
PLN03210		1153	PLN03210, PLN03210, Resistant to P	8e-07
PLN03210		1153	PLN03210, PLN03210, Resistant to P	4e-06
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-05
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	4e-05
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	6e-05
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	0.001
cd00116		319	cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo	0.002

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score =  108 bits (272), Expect = 4e-24
 Identities = 99/285 (34%), Positives = 140/285 (49%), Gaps = 49/285 (17%)

Query: 5   KDLSDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCSK 64
           ++L  L + G+ + ++   +  LTGL  + L+G KNL  +P  +S    L TL+LS CS 
Sbjct: 611 ENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIP-DLSMATNLETLKLSDCS- 668

Query: 65  LKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLKS 124
                                 S+ E+PSSI+ L  LE L ++ C+NL  LP+ IN LKS
Sbjct: 669 ----------------------SLVELPSSIQYLNKLEDLDMSRCENLEILPTGIN-LKS 705

Query: 125 LKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSSIFLMKNLRSLYFSGCNEPP 184
           L  LNLSGC +L++ PD      ++  LD+  TAI    S++     L +L      E  
Sbjct: 706 LYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFPSNL----RLENLDELILCEMK 758

Query: 185 ASASWHLHLPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDC-GLGEAAIPSDIDNLHSL 243
           +   W    P         P+  ML       SLT+L LSD   L E  +PS I NLH L
Sbjct: 759 SEKLWERVQPLT-------PLMTMLSP-----SLTRLFLSDIPSLVE--LPSSIQNLHKL 804

Query: 244 KELYL-NRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNL 287
           + L + N  N  TLP  I+ L +LE L+L  C RL++ P I  N+
Sbjct: 805 EHLEIENCINLETLPTGIN-LESLESLDLSGCSRLRTFPDISTNI 848

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		862
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.94
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.93
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.91
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.88
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.86
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.79
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.75
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.72
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.68
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.59
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.57
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.54
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.53
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.43
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.4
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.4
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.35
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.34
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.22
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.22
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.16
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.89
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.82
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.8
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.79
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.79
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.73
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.72
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.65
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.47
PRK15386		426	type III secretion protein GogB; Provisional	98.45
PRK15386		426	type III secretion protein GogB; Provisional	98.43
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.4
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.33
PLN03150		623	hypothetical protein; Provisional	98.25
PLN03150		623	hypothetical protein; Provisional	98.16
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.0
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.99
KOG4341		483	consensus F-box protein containing LRR [General fu	97.99
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	97.93
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.87
KOG4341		483	consensus F-box protein containing LRR [General fu	97.82
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.81
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.8
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.77
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	97.74
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.56
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.26
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.25
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.18
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.15
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.14
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.09
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.05
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.48
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.28
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.19
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	95.96
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.93
KOG1947		482	consensus Leucine rich repeat proteins, some prote	95.48
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	94.34
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.27
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	94.18
KOG2123		388	consensus Uncharacterized conserved protein [Funct	93.73
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	93.64
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	93.57
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	93.46
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	90.52
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	90.51
KOG2123		388	consensus Uncharacterized conserved protein [Funct	90.47
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	88.84
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	83.01
smart00370		26	LRR Leucine-rich repeats, outliers.	83.01

>PLN03210 Resistant to P	Back alignment and domain information

Probab=100.00  E-value=9.6e-33  Score=348.00  Aligned_cols=449  Identities=25%  Similarity=0.317  Sum_probs=278.9

Q ss_pred             CcEEEeecCCCcccCccccCCCCCcEEEEeCCCCCCccccccCCCCCCCEEEeeCCCCCCccchhhcCCCCCcEEEccCc
Q 048786            7 LSDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIVASMEDLSKLYLDGT   86 (862)
Q Consensus         7 Lr~L~L~~~~i~~lp~~i~~L~~L~~L~Ls~c~~l~~lp~~l~~l~~L~~L~L~~c~~l~~lp~~i~~l~~L~~L~L~~~   86 (862)
                      ||.|++.++.++.+|..+ ...+|+.|++.+| .++.+|..+..+++|+.|+|++|..++.+|. ++.+++|++|++++|
T Consensus       591 Lr~L~~~~~~l~~lP~~f-~~~~L~~L~L~~s-~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~-ls~l~~Le~L~L~~c  667 (1153)
T PLN03210        591 LRLLRWDKYPLRCMPSNF-RPENLVKLQMQGS-KLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDC  667 (1153)
T ss_pred             cEEEEecCCCCCCCCCcC-CccCCcEEECcCc-cccccccccccCCCCCEEECCCCCCcCcCCc-cccCCcccEEEecCC
Confidence            455555555555555544 3456666666663 3556666666677777777777666666664 566677777777665


Q ss_pred             -cCcccCccCCCCCCCCEEEccCCCCcccccccccCCCCCCEEEecCCCCCCCCCcccCCCCcccEEEccCCcCcCCCch
Q 048786           87 -SIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLKSLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSS  165 (862)
Q Consensus        87 -~i~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~l~~l~~L~~L~L~~c~~l~~lp~~l~~l~~L~~L~l~~~~~~~~~~~  165 (862)
                       .+..+|.+++++++|+.|++++|..++.+|..+ ++++|+.|++++|..+..+|..   .++|+.|++++|.+..+|..
T Consensus       668 ~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~  743 (1153)
T PLN03210        668 SSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFPSN  743 (1153)
T ss_pred             CCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCcccccccc
Confidence             455667777777777777777777777776655 5677777777777666665542   34666777777776666654


Q ss_pred             hhccCCccEEEc-------------------------------cCCCCCCCcc-ccccccccccccCCCCCccccccCcC
Q 048786          166 IFLMKNLRSLYF-------------------------------SGCNEPPASA-SWHLHLPFNLLGKSSCPVALMLPSLT  213 (862)
Q Consensus       166 l~~l~~L~~L~L-------------------------------~~~~~~~~~~-~~~~~~~l~~l~~~~~~~~~~lp~l~  213 (862)
                      + .+++|+.|.+                               ++|......+ .......+..+.+.+|.....+|...
T Consensus       744 ~-~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~  822 (1153)
T PLN03210        744 L-RLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI  822 (1153)
T ss_pred             c-cccccccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC
Confidence            3 2344444444                               3333221111 11111223334444444444444433


Q ss_pred             CCCCccEEEccCCCCCCCCCCcccCCCCcccEEECcCCCCccccccccCCCCCCEEeeecCCCCCcCCCCC---CCCcEE
Q 048786          214 GVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKELYLNRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIP---PNLQFV  290 (862)
Q Consensus       214 ~l~~L~~L~Ls~~~l~~~~lp~~l~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~c~~L~~lp~lp---~sL~~L  290 (862)
                      .+++|+.|++++|... ..+|.   ..++|+.|+|++|.++.+|.++..+++|+.|++++|++++.+|..+   ++|+.+
T Consensus       823 ~L~sL~~L~Ls~c~~L-~~~p~---~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L  898 (1153)
T PLN03210        823 NLESLESLDLSGCSRL-RTFPD---ISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETV  898 (1153)
T ss_pred             CccccCEEECCCCCcc-ccccc---cccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCee
Confidence            4555666666655432 12232   2357888999999999999999999999999999999999998644   677888


Q ss_pred             eccCCCCceeecCccc---------------cccceeeeeccchhHHHHHhcchhHHHHHHHHHHhcccCCCCceEEecc
Q 048786          291 RANGCSSLVTLFGALK---------------LCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIVFP  355 (862)
Q Consensus       291 ~i~~C~~L~~l~~~~~---------------~~~~~l~i~~C~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~p  355 (862)
                      ++.+|++|+.++....               +....+.+.+|.++.+...            ++  .   ......+++|
T Consensus       899 ~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L~~~a~------------l~--~---~~~~~~~~l~  961 (1153)
T PLN03210        899 DFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEAL------------LQ--Q---QSIFKQLILS  961 (1153)
T ss_pred             ecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCCCchhh------------hc--c---cccceEEECC
Confidence            9999999987652111               0112234458888743221            11  1   1112356899


Q ss_pred             CCCCCCccccCCCCcEEE-EEcCCCCCCCCceEEEEEEEEEeccCCCCccccccCCCCceeEEEEecCCCceEEEEc---
Q 048786          356 GSQIPKWFMYQNEGSSIT-VTRPSYLYNVNKVVGFAICCVFQVPKHSTGTYLFHSYPAHELECSMDGSGEGHYIYFR---  431 (862)
Q Consensus       356 g~~iP~wf~~~~~g~s~~-~~lp~~~~~~~~~lgfa~c~v~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~---  431 (862)
                      |.++|.||.|+..|++++ +++|+.|+... |.||++|+|+.+.......    ......+.|.+.+..+..+....   
T Consensus       962 g~evp~~f~hr~~g~sl~~i~l~~~~~~~~-~~~f~~c~v~~~~~~~~~~----~~~~~~~~c~~~~~~~~~~~~~~~~~ 1036 (1153)
T PLN03210        962 GEEVPSYFTHRTTGASLTNIPLLHISPCQP-FFRFRACAVVDSESFFIIS----VSFDIQVCCRFIDRLGNHFDSPYQPH 1036 (1153)
T ss_pred             CccCchhccCCcccceeeeeccCCcccCCC-ccceEEEEEEecCccccCC----CceeEEEEEEEECCCCCccccCCCce
Confidence            999999999999999998 99999998877 9999999999855431110    11245677887776655443211   


Q ss_pred             cccccccCCeEEEEEecCC--CC---CCCCCceEEEEEEEecc-CCCceEEEeeeEEeeccccc
Q 048786          432 GKFGHVVSDHLWLLFLPRH--GH---NWQFESNLIRLSFRSIS-DPTWKVKRCGFHPIYMHEVE  489 (862)
Q Consensus       432 ~~~~~~~s~hl~~~~~~~~--~~---~~~~~~~~~~~~f~~~~-~~~~~vk~cGv~liy~~~~~  489 (862)
                      .+......+|++++.....  ..   .....+.|+.+.|.+.. ....+||+|||+++|.++..
T Consensus      1037 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~cg~~~~~~~~~~ 1100 (1153)
T PLN03210       1037 VFSVTKKGSHLVIFDCCFPLNEDNAPLAELNYDHVDIQFRLTNKNSQLKLKGCGIRLSEDDSSL 1100 (1153)
T ss_pred             eEeeeccccceEEecccccccccccchhccCCceeeEEEEEecCCCCeEEEeeeEEEeccCCCc
Confidence            1122345667776643211  10   12235778888887622 22359999999999966644

syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		862
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		3e-06

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

Iteration: 1

Score = 50.8 bits (120), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 38/143 (26%), Positives = 58/143 (40%), Gaps = 24/143 (16%) Query: 6 DLSDLYLDGTSITEVPSSIXXXXXXXXXXXKGCKNLSSLPVTISSLKCLRTLELSGCSKL 65 +L L L+ T I +P+SI + LS+L I L L L+L GC+ L Sbjct: 184 NLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTAL 242 Query: 66 KKFPQIVASMEDLSKLYLDGTSIAEVPSSIXXXXXXXXXXXXXCKNLVRLPSSINGLKSL 125 + +P I L +L L C NL+ LP I+ L L Sbjct: 243 RNYPPIFGGRAPLKRLILKD-----------------------CSNLLTLPLDIHRLTQL 279 Query: 126 KTLNLSGCCKLENVPDTLGKVES 148 + L+L GC L +P + ++ + Sbjct: 280 EKLDLRGCVNLSRLPSLIAQLPA 302

PyMOL of 4fcg

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		862
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-52
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-44
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-38
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	7e-34
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-13
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-12
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-12
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-11
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-10
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	9e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-30
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-30
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-28
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-28
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-25
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-22
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-21
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-29
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-29
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-24
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-20
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-04
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-28
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-26
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-23
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-07
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-07
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-28
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-26
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-24
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-19
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-27
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-26
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-26
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	8e-25
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-18
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-13
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-25
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-24
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-23
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-22
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	9e-21
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-18
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-25
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-23
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-22
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-19
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-07
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-25
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-17
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	5e-15
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-24
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-24
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-18
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-12
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-24
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-23
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-21
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-19
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-16
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-24
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-22
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-19
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	7e-18
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-17
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	7e-24
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-18
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-12
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-23
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-23
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-11
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-22
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-22
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-13
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-10
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-21
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-18
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-16
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-11
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-21
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-17
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-16
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-14
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-13
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-21
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	8e-20
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-19
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-08
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-21
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	7e-19
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-18
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-20
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	9e-18
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-14
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-09
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-09
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-20
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-20
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-19
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-16
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-15
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-12
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-19
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-16
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-13
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	6e-13
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-19
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-19
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-18
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-18
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-17
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-13
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-19
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-17
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	3e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-04
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-19
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-15
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-19
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	3e-19
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	9e-16
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	4e-19
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-18
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-08
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-18
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-13
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	7e-18
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-16
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-16
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-14
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	4e-16
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-12
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	6e-16
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-08
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-15
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-11
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-10
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	3e-10
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	8e-08
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-15
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	9e-15
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-13
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-08
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-14
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	9e-14
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-07
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-14
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-13
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-13
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-10
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-14
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-13
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-09
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	6e-14
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	8e-13
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	5e-13
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	3e-08
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	6e-13
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-08
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-12
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-08
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-07
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	9e-12
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-11
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	6e-11
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-11
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	5e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-10
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-11
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-09
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-07
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-11
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-09
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-08
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	8e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	7e-06
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-09
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-08
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-09
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-07
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	7e-06
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	1e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-08
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	5e-08
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	4e-08
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	3e-07
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	3e-06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	5e-08
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	2e-07
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-07
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	6e-07
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	2e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	3e-06
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	4e-05
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	3e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	4e-06
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	5e-05
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	9e-06
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	3e-05
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	1e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	6e-04
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	4e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	3e-04
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	4e-04
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	1e-04
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	3e-04
3m19_A		251	Variable lymphocyte receptor A diversity region; a	6e-04
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	9e-04

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

 Score =  183 bits (468), Expect = 5e-52
 Identities = 69/299 (23%), Positives = 110/299 (36%), Gaps = 41/299 (13%)

Query: 3   SMKDLSDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLK--CLRTLELS 60
            +      Y    +              ++ T    + L +    +          LEL 
Sbjct: 31  VLSQWQRHYNADRNRWHSAWRQANSNNPQIETRT-GRALKATADLLEDATQPGRVALELR 89

Query: 61  GCSKLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSIN 120
               L +FP     +  L  + +D   + E+P +++   GLE L L     L  LP+SI 
Sbjct: 90  SV-PLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNP-LRALPASIA 147

Query: 121 GLKSLKTLNLSGCCKLENVPDTLGKVE---------SLEELDVSGTAIRRPTSSIFLMKN 171
            L  L+ L++  C +L  +P+ L   +         +L+ L +  T IR   +SI  ++N
Sbjct: 148 SLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQN 207

Query: 172 LRSLYFSGCNEPPASASWHLH-LPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGE 230
           L+SL               L  L                P++  +  L +LDL  C    
Sbjct: 208 LKSLKIRNS---------PLSALG---------------PAIHHLPKLEELDLRGCTALR 243

Query: 231 AAIPSDIDNLHSLKELYL-NRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNLQ 288
              P        LK L L + +N +TLP  I  L  LE+L+L  C  L  LP +   L 
Sbjct: 244 N-YPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLP 301

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		862
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.98
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.97
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.97
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.97
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.97
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.97
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.97
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.96
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.96
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.96
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.96
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.96
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.95
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.95
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.94
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.93
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.93
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.93
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.93
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.92
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.92
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.91
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.91
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.91
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.9
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.9
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.9
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.9
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.89
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.89
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.89
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.89
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.89
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.89
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.89
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.89
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.88
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.88
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.87
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.87
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.86
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.86
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.86
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.85
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.85
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.85
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.83
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.83
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.83
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.83
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.83
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.82
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.82
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.82
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.8
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.79
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.79
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.78
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.78
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.78
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.77
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.76
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.76
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.76
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.74
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.74
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.73
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.73
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.72
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.72
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.72
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.7
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.7
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.7
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.7
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.69
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.69
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.68
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.68
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.68
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.68
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.66
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.65
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.62
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.61
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.59
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.59
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.59
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.57
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.55
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.55
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.54
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.54
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.53
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.52
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.52
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.52
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.5
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.47
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.47
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.46
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.45
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.45
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.44
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.43
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.4
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.4
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.4
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.39
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.38
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.38
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.37
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.34
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.29
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.29
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.25
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.25
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.23
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.2
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.18
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.18
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.17
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.12
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.1
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.07
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.97
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.96
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.92
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.9
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.9
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.74
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.74
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.73
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.73
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.71
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.56
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.45
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.38
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.38
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.31
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.3
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.27
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.15
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.05
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.9
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.66
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.55
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.37
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.34
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.28
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.09
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	96.94
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	96.86
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	92.42
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	91.72
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	91.43
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	88.29

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=7.3e-36  Score=364.88  Aligned_cols=297  Identities=21%  Similarity=0.211  Sum_probs=240.2

Q ss_pred             CCCCCCCcEEEeecCCCcccCccccCCCCCcEEEEeCCCCCCcccc--ccCCCCCCCEEEeeCCCCCCccchhh-cCCCC
Q 048786            1 MASMKDLSDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPV--TISSLKCLRTLELSGCSKLKKFPQIV-ASMED   77 (862)
Q Consensus         1 ~~~l~~Lr~L~L~~~~i~~lp~~i~~L~~L~~L~Ls~c~~l~~lp~--~l~~l~~L~~L~L~~c~~l~~lp~~i-~~l~~   77 (862)
                      |.++++|+.++++.+++..+|+.++.+++|++|+|++|.....+|.  .++++++|++|++++|......|..+ .++++
T Consensus        73 l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~  152 (768)
T 3rgz_A           73 LLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNS  152 (768)
T ss_dssp             TTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTT
T ss_pred             HhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCC
Confidence            4567888999998888888888999999999999999877667777  78999999999999987666666665 78999


Q ss_pred             CcEEEccCccCcccCc-c---CCCCCCCCEEEccCCCCcccccccccCCCCCCEEEecCCCCCCCCCcccCCCCcccEEE
Q 048786           78 LSKLYLDGTSIAEVPS-S---IELLPGLELLYLNECKNLVRLPSSINGLKSLKTLNLSGCCKLENVPDTLGKVESLEELD  153 (862)
Q Consensus        78 L~~L~L~~~~i~~lp~-~---i~~L~~L~~L~L~~~~~l~~lp~~l~~l~~L~~L~L~~c~~l~~lp~~l~~l~~L~~L~  153 (862)
                      |++|++++|.+...+. .   ++.+++|++|++++|......|  +..+++|++|++++|.....+|. ++.+++|++|+
T Consensus       153 L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~  229 (768)
T 3rgz_A          153 LEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLD  229 (768)
T ss_dssp             CSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEE
T ss_pred             CCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEE
Confidence            9999999999886543 3   7889999999999987655444  37889999999999887776776 89999999999


Q ss_pred             ccCCcCc-CCCchhhccCCccEEEccCCCCCCCccccccccccccccCCCCCccccccC-cCC-CCCccEEEccCCCCCC
Q 048786          154 VSGTAIR-RPTSSIFLMKNLRSLYFSGCNEPPASASWHLHLPFNLLGKSSCPVALMLPS-LTG-VCSLTKLDLSDCGLGE  230 (862)
Q Consensus       154 l~~~~~~-~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~lp~-l~~-l~~L~~L~Ls~~~l~~  230 (862)
                      +++|.+. ..|..+..+++|++|++++|......+.. ....++.+....+.....+|. +.. +++|++|++++|.+. 
T Consensus       230 Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~-  307 (768)
T 3rgz_A          230 ISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFY-  307 (768)
T ss_dssp             CCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEE-
T ss_pred             CcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCC-
Confidence            9999888 45778888999999999998765333222 334566677777776666666 444 499999999999886 


Q ss_pred             CCCCcccCCCCcccEEECcCCCCc-ccccc-ccCCCCCCEEeeecCCCCCcCCC----CCCCCcEEeccCCCCceeec
Q 048786          231 AAIPSDIDNLHSLKELYLNRNNFV-TLPAS-ISGLLNLEELELEDCKRLQSLPQ----IPPNLQFVRANGCSSLVTLF  302 (862)
Q Consensus       231 ~~lp~~l~~l~~L~~L~L~~n~l~-~lp~~-l~~l~~L~~L~L~~c~~L~~lp~----lp~sL~~L~i~~C~~L~~l~  302 (862)
                      +.+|..+..+++|++|++++|.+. .+|.. +..+++|++|++++|.....+|.    ++++|+.|++.++.--..++
T Consensus       308 ~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~  385 (768)
T 3rgz_A          308 GAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPIL  385 (768)
T ss_dssp             ECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECC
T ss_pred             CccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcC
Confidence            457889999999999999999998 88876 89999999999999975556775    34599999999885443333

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		862
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	5e-14
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	6e-14
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	7e-10
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	4e-08
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-07
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-05
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	4e-09
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	2e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	6e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	9e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	3e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	5e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	6e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.003
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	2e-07
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	6e-06
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	1e-05
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	1e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.004
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	5e-04
d2omxa2		199	c.10.2.1 (A:37-235) Internalin B {Listeria monocyt	0.001
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	0.003
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	0.004

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 71.6 bits (174), Expect = 5e-14
 Identities = 47/278 (16%), Positives = 92/278 (33%), Gaps = 14/278 (5%)

Query: 5   KDLSDLYLDGTSITEV-PSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCS 63
            D + L L    ITE+     + L  L  L L   K     P   + L  L  L LS   
Sbjct: 31  PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQ 90

Query: 64  KLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLK 123
             +   ++  ++++L     + T + +   +      +  L  N  K+      +  G+K
Sbjct: 91  LKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMK 150

Query: 124 SLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIR-RPTSSIFLMKNLRSLYFSGCNE 182
            L  + ++    +  +P  L    SL EL + G  I     +S+  + NL  L  S  + 
Sbjct: 151 KLSYIRIAD-TNITTIPQGLPP--SLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSI 207

Query: 183 PPASASWHLHLPFNLLGK-SSCPVALMLPSLTGVCSLTKLDLSDCGL-----GEAAIPSD 236
                    + P       ++  +  +   L     +  + L +  +      +   P  
Sbjct: 208 SAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGY 267

Query: 237 IDNLHSLKELYLNRNNFVTL---PASISGLLNLEELEL 271
                S   + L  N        P++   +     ++L
Sbjct: 268 NTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQL 305

PyMOL of d1xkua_

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		862
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.86
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.81
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.8
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.8
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.78
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.74
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.72
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.71
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.71
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.66
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.62
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.56
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.55
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.5
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.46
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.46
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.45
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.45
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.43
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.42
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.39
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.32
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.2
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.15
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.14
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.11
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.09
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.07
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.03
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.91
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.91
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.81
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.79
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.78
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.72
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.51
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.67
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.4
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.26
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.18
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.1
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	94.93

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.86  E-value=6.9e-22  Score=212.22  Aligned_cols=249  Identities=20%  Similarity=0.289  Sum_probs=156.6

Q ss_pred             CCcEEEeecCCCc---ccCccccCCCCCcEEEEeCCCC-CCccccccCCCCCCCEEEeeCCCCCCccchhhcCCCCCcEE
Q 048786            6 DLSDLYLDGTSIT---EVPSSIELLTGLELLTLKGCKN-LSSLPVTISSLKCLRTLELSGCSKLKKFPQIVASMEDLSKL   81 (862)
Q Consensus         6 ~Lr~L~L~~~~i~---~lp~~i~~L~~L~~L~Ls~c~~-l~~lp~~l~~l~~L~~L~L~~c~~l~~lp~~i~~l~~L~~L   81 (862)
                      +++.|+|+++++.   .+|..++++++|++|+|++|+. ...+|..++++++|++|+|++|......|..+..+.+|+++
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l  130 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL  130 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence            5667777776665   4667777777777777776333 33677777777777777777766555566666777777777


Q ss_pred             EccCccCc-ccCccCCCCCCCCEEEccCCCCcccccccccCCCCC-CEEEecCCCCCCCCCcccCCCCcccEEEccCCcC
Q 048786           82 YLDGTSIA-EVPSSIELLPGLELLYLNECKNLVRLPSSINGLKSL-KTLNLSGCCKLENVPDTLGKVESLEELDVSGTAI  159 (862)
Q Consensus        82 ~L~~~~i~-~lp~~i~~L~~L~~L~L~~~~~l~~lp~~l~~l~~L-~~L~L~~c~~l~~lp~~l~~l~~L~~L~l~~~~~  159 (862)
                      ++++|.+. .+|..++.++.|+.+++++|.....+|..+..+.++ +.+++++|......|..++.+..+ .+++.++..
T Consensus       131 ~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~  209 (313)
T d1ogqa_         131 DFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNML  209 (313)
T ss_dssp             ECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEE
T ss_pred             ccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccc
Confidence            77766554 456667777777777777766666666666666654 666666655555555555555433 466665544


Q ss_pred             c-CCCchhhccCCccEEEccCCCCCCCccccccccccccccCCCCCccccccCcCCCCCccEEEccCCCCCCCCCCcccC
Q 048786          160 R-RPTSSIFLMKNLRSLYFSGCNEPPASASWHLHLPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSDID  238 (862)
Q Consensus       160 ~-~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~lp~l~~l~~L~~L~Ls~~~l~~~~lp~~l~  238 (862)
                      . ..|..+..+++++.+++.++...                       ..+|.+..+++|+.|++++|+++ +.+|.+++
T Consensus       210 ~~~~~~~~~~~~~l~~l~~~~~~l~-----------------------~~~~~~~~~~~L~~L~Ls~N~l~-g~iP~~l~  265 (313)
T d1ogqa_         210 EGDASVLFGSDKNTQKIHLAKNSLA-----------------------FDLGKVGLSKNLNGLDLRNNRIY-GTLPQGLT  265 (313)
T ss_dssp             EECCGGGCCTTSCCSEEECCSSEEC-----------------------CBGGGCCCCTTCCEEECCSSCCE-ECCCGGGG
T ss_pred             ccccccccccccccccccccccccc-----------------------ccccccccccccccccCccCeec-ccCChHHh
Confidence            4 34455555666666666655432                       12333555666777777777665 34666777


Q ss_pred             CCCcccEEECcCCCCc-cccccccCCCCCCEEeeecCCCCCcC
Q 048786          239 NLHSLKELYLNRNNFV-TLPASISGLLNLEELELEDCKRLQSL  280 (862)
Q Consensus       239 ~l~~L~~L~L~~n~l~-~lp~~l~~l~~L~~L~L~~c~~L~~l  280 (862)
                      .+++|++|+|++|+++ .+|. ++++++|+.+++.+|+.+...
T Consensus       266 ~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         266 QLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             GCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEEST
T ss_pred             CCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCC
Confidence            7777777777777766 5553 456666777777666655443

PyMOL of d1ogqa_

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure