Citrus Sinensis ID: 048786
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 862 | ||||||
| 224127726 | 1203 | tir-nbs-lrr resistance protein [Populus | 0.598 | 0.428 | 0.419 | 1e-89 | |
| 147802475 | 1244 | hypothetical protein VITISV_027841 [Viti | 0.501 | 0.347 | 0.430 | 4e-84 | |
| 359493273 | 1233 | PREDICTED: TMV resistance protein N-like | 0.573 | 0.400 | 0.4 | 8e-84 | |
| 224146780 | 540 | predicted protein [Populus trichocarpa] | 0.580 | 0.925 | 0.420 | 6e-83 | |
| 359496026 | 1250 | PREDICTED: TMV resistance protein N-like | 0.558 | 0.384 | 0.395 | 3e-79 | |
| 296090591 | 771 | unnamed protein product [Vitis vinifera] | 0.559 | 0.625 | 0.400 | 4e-79 | |
| 224114331 | 1119 | tir-nbs-lrr resistance protein [Populus | 0.511 | 0.394 | 0.409 | 1e-77 | |
| 224114311 | 1144 | tir-nbs-lrr resistance protein [Populus | 0.563 | 0.424 | 0.384 | 2e-77 | |
| 255561514 | 994 | leucine-rich repeat-containing protein, | 0.566 | 0.490 | 0.392 | 2e-75 | |
| 359493250 | 1439 | PREDICTED: TMV resistance protein N-like | 0.588 | 0.352 | 0.370 | 8e-75 |
| >gi|224127726|ref|XP_002329162.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870943|gb|EEF08074.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 337 bits (865), Expect = 1e-89, Method: Compositional matrix adjust.
Identities = 228/544 (41%), Positives = 317/544 (58%), Gaps = 28/544 (5%)
Query: 1 MASMKDLSDLYLDG-TSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLEL 59
+ +L L L G ++EV SSI L + L C++L+SLP IS L L L L
Sbjct: 661 FTGIPNLERLILQGCRRLSEVHSSIGHHNKLIYVNLMDCESLTSLPSRISGLNLLEELHL 720
Query: 60 SGCSKLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSI 119
SGCSKLK+FP+I + + L KL LD TSI E+P SI+ L GL L L +CK L LPSSI
Sbjct: 721 SGCSKLKEFPEIEGNKKCLRKLCLDQTSIEELPPSIQYLVGLISLSLKDCKKLSCLPSSI 780
Query: 120 NGLKSLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSSIFLMKNLRSLYFSG 179
NGLKSLKTL+LSGC +LEN+P+ G++E L ELDVSGTAIR P SIF +KNL+ L F G
Sbjct: 781 NGLKSLKTLHLSGCSELENLPENFGQLECLNELDVSGTAIREPPVSIFSLKNLKILSFHG 840
Query: 180 CNEPPASAS--WHLHLPFNLL-GKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSD 236
C E S + W L F L+ GK + +L+LPSL+G+ SLT+L LS+C LGE A+P+D
Sbjct: 841 CAESSRSTTNIWQ-RLMFPLMPGKRANSTSLVLPSLSGLSSLTRLGLSNCNLGEGAVPND 899
Query: 237 IDNLHSLKELYLNRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNLQFVRANGCS 296
I L SL++L L+RN FV+LP SI L L+ L +EDCK LQSLP++P NL+ R NGC+
Sbjct: 900 IGYLSSLRQLNLSRNKFVSLPTSIDQLSGLQFLRMEDCKMLQSLPELPSNLEEFRVNGCT 959
Query: 297 SLVTLFGALKLCR---SKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIV 353
SL + + KLC+ +Y INC + N + ++LR+ Q + S++
Sbjct: 960 SLEKMQFSRKLCQLNYLRYLFINCWRLSESDCWNNMFPTLLRKC--FQGPPNLIESFSVI 1017
Query: 354 FPGSQIPKWFMYQNEGSSITVTRPSYLYNVNKVVGFAICCVFQVPKHSTGTYLFHSYPAH 413
PGS+IP WF +Q+EGSS++V P + + ++ +G+A+C P +
Sbjct: 1018 IPGSEIPTWFSHQSEGSSVSVQTPPHSHENDEWLGYAVCASLGYPDFPPNVF------RS 1071
Query: 414 ELECSMDGSG-EGHYIYFRGKFGHVVSDHLWLLFLPRHGHNWQFESNLIRLSFRSISDPT 472
++C +G G E IY R K ++SDHLW L+ P +F+ + +R F T
Sbjct: 1072 PMQCFFNGDGNESESIYVRLKPCEILSDHLWFLYFPSRFK--RFDRH-VRFRFEDNCSQT 1128
Query: 473 WKVKRCGFHPIYMHEVEEFDETTKQSTRFTSCNLNEVHHD-------FVGSNMEVAQASG 525
KV +CG +Y +VEE + T T ++E + +G +V +ASG
Sbjct: 1129 -KVIKCGVRLVYQQDVEELNRMTNLYENSTFEGVDECFQESGGALVKRLGHTNDVGEASG 1187
Query: 526 SGSS 529
S SS
Sbjct: 1188 SVSS 1191
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147802475|emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493273|ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224146780|ref|XP_002336335.1| predicted protein [Populus trichocarpa] gi|222834747|gb|EEE73210.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296090591|emb|CBI40960.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224114331|ref|XP_002332400.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832723|gb|EEE71200.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224114311|ref|XP_002332395.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832718|gb|EEE71195.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255561514|ref|XP_002521767.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223538980|gb|EEF40577.1| leucine-rich repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359493250|ref|XP_002268462.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 862 | ||||||
| TAIR|locus:2175991 | 1294 | AT5G17680 [Arabidopsis thalian | 0.548 | 0.365 | 0.289 | 8.7e-33 | |
| TAIR|locus:2094498 | 1981 | AT3G25510 [Arabidopsis thalian | 0.317 | 0.138 | 0.310 | 2.9e-29 | |
| TAIR|locus:2827629 | 1355 | AT2G17050 [Arabidopsis thalian | 0.465 | 0.295 | 0.266 | 1.1e-26 | |
| TAIR|locus:2163426 | 1187 | TAO1 "target of AVRB operation | 0.406 | 0.294 | 0.298 | 2.2e-24 | |
| TAIR|locus:2205824 | 1384 | AT1G27170 [Arabidopsis thalian | 0.374 | 0.233 | 0.304 | 2.8e-24 | |
| TAIR|locus:2153328 | 1231 | AT5G45230 [Arabidopsis thalian | 0.479 | 0.335 | 0.270 | 1.4e-20 | |
| TAIR|locus:2205804 | 1556 | AT1G27180 [Arabidopsis thalian | 0.348 | 0.192 | 0.289 | 1.3e-22 | |
| TAIR|locus:2053405 | 1215 | AT2G14080 [Arabidopsis thalian | 0.290 | 0.205 | 0.321 | 8.7e-22 | |
| TAIR|locus:2118106 | 1219 | AT4G12010 [Arabidopsis thalian | 0.431 | 0.305 | 0.284 | 2.4e-21 | |
| UNIPROTKB|Q40392 | 1144 | N "TMV resistance protein N" [ | 0.407 | 0.306 | 0.292 | 2.8e-21 |
| TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 394 (143.8 bits), Expect = 8.7e-33, P = 8.7e-33
Identities = 149/515 (28%), Positives = 231/515 (44%)
Query: 13 DGTSITEVPSSIXXXXXXXXXXXKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIV 72
D + +PS + GC+ L +LP T+ +L L TLE+SGC + +FP++
Sbjct: 748 DCQRLRTLPSYLGHLVSLKSLNLDGCRRLENLPDTLQNLTSLETLEVSGCLNVNEFPRVS 807
Query: 73 ASMEDLSKLYLDGTSIAEVPSSIXXXXXXXXXXXXXCKNLVRLPSSINGLKSLKTLNLSG 132
S+E L + TSI E+P+ I K L LP SI+ L+SL+ L LSG
Sbjct: 808 TSIEVLR---ISETSIEEIPARICNLSQLRSLDISENKRLASLPVSISELRSLEKLKLSG 864
Query: 133 CCKLENVPDTLGKVES-LEELDVSGTAIRRPTSSIFLMKNLRSLYFSGC--NEPPASASW 189
C LE+ P + + S L D+ T+I+ +I + L L S P S +
Sbjct: 865 CSVLESFPLEICQTMSCLRWFDLDRTSIKELPENIGNLVALEVLQASRTVIRRAPWSIAR 924
Query: 190 HLHLPFNLLGKSS-CPVALM---LPSLTGVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKE 245
L +G S P L+ P L+ L L LS+ + E IP+ I NL +L E
Sbjct: 925 LTRLQVLAIGNSFFTPEGLLHSLCPPLSRFDDLRALSLSNMNMTE--IPNSIGNLWNLLE 982
Query: 246 LYLNRNNFVTLPASISGXXXXXXXXXXDCKRLQSLP-QIPPNLQFVRANGCSSLVTLFGA 304
L L+ NNF +PASI +C+RLQ+LP ++P L ++ + C+SLV++ G
Sbjct: 983 LDLSGNNFEFIPASIKRLTRLNRLNLNNCQRLQALPDELPRGLLYIYIHSCTSLVSISGC 1042
Query: 305 L-KLCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIVFPGSQIPKWF 363
+ C K NC KL + A ++ L+L++ P H FPGS IP F
Sbjct: 1043 FNQYCLRKLVASNCY---KL---DQAAQILIHRNLKLESAK-PEHSY---FPGSDIPTCF 1092
Query: 364 MYQNEGSSITVTRPSYLYNVNKVVGFAICCVFQVP-KHSTGTYLFH-SYPAHELE-CSMD 420
+Q G S+ + P + + ++GF+ C + V ++ H S + + C +
Sbjct: 1093 NHQVMGPSLNIQLPQS-ESSSDILGFSACIMIGVDGQYPMNNLKIHCSCILKDADACELV 1151
Query: 421 GSGEGHY----IYFRGKFGHVVSDHLWLLFLPRHGHNWQFESNLIRLSFRSIS----DPT 472
E Y + FG SDHL LLF + L S + P
Sbjct: 1152 VMDEVWYPDPKAFTNMYFG---SDHL-LLFSRTCTSMEAYSEALFEFSVENTEGDSFSPL 1207
Query: 473 WKVKRCGFHPIYMHEVEEFDETTKQSTRFTSCNLN 507
+VK+C H I + ++ + E + S + S +L+
Sbjct: 1208 GEVKKCAVHLISLKDMMQ--EFSNDSDKIQSSDLD 1240
|
|
| TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 862 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 4e-24 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 3e-21 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 8e-21 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-14 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 3e-11 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-10 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-08 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-08 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 5e-07 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 8e-07 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 4e-06 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-05 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 4e-05 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 6e-05 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 2e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.001 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 0.002 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 108 bits (272), Expect = 4e-24
Identities = 99/285 (34%), Positives = 140/285 (49%), Gaps = 49/285 (17%)
Query: 5 KDLSDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCSK 64
++L L + G+ + ++ + LTGL + L+G KNL +P +S L TL+LS CS
Sbjct: 611 ENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIP-DLSMATNLETLKLSDCS- 668
Query: 65 LKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLKS 124
S+ E+PSSI+ L LE L ++ C+NL LP+ IN LKS
Sbjct: 669 ----------------------SLVELPSSIQYLNKLEDLDMSRCENLEILPTGIN-LKS 705
Query: 125 LKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSSIFLMKNLRSLYFSGCNEPP 184
L LNLSGC +L++ PD ++ LD+ TAI S++ L +L E
Sbjct: 706 LYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFPSNL----RLENLDELILCEMK 758
Query: 185 ASASWHLHLPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDC-GLGEAAIPSDIDNLHSL 243
+ W P P+ ML SLT+L LSD L E +PS I NLH L
Sbjct: 759 SEKLWERVQPLT-------PLMTMLSP-----SLTRLFLSDIPSLVE--LPSSIQNLHKL 804
Query: 244 KELYL-NRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNL 287
+ L + N N TLP I+ L +LE L+L C RL++ P I N+
Sbjct: 805 EHLEIENCINLETLPTGIN-LESLESLDLSGCSRLRTFPDISTNI 848
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 862 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.94 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.93 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.91 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.88 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.86 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.79 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.75 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.72 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.68 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.59 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.57 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.54 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.53 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.43 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.4 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.4 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.35 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.34 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.22 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.22 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.16 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.89 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.82 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.8 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.79 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.79 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.73 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.72 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.65 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.47 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.45 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.43 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.4 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.33 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.25 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.16 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.0 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.99 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.99 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.93 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.87 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.82 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.81 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.8 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.77 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.74 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.56 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.26 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.25 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.18 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.15 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.14 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.09 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.05 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.48 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.28 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.19 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 95.96 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.93 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.48 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 94.34 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.27 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 94.18 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 93.73 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 93.64 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 93.57 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 93.46 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 90.52 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 90.51 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 90.47 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 88.84 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 83.01 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 83.01 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-33 Score=348.00 Aligned_cols=449 Identities=25% Similarity=0.317 Sum_probs=278.9
Q ss_pred CcEEEeecCCCcccCccccCCCCCcEEEEeCCCCCCccccccCCCCCCCEEEeeCCCCCCccchhhcCCCCCcEEEccCc
Q 048786 7 LSDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCSKLKKFPQIVASMEDLSKLYLDGT 86 (862)
Q Consensus 7 Lr~L~L~~~~i~~lp~~i~~L~~L~~L~Ls~c~~l~~lp~~l~~l~~L~~L~L~~c~~l~~lp~~i~~l~~L~~L~L~~~ 86 (862)
||.|++.++.++.+|..+ ...+|+.|++.+| .++.+|..+..+++|+.|+|++|..++.+|. ++.+++|++|++++|
T Consensus 591 Lr~L~~~~~~l~~lP~~f-~~~~L~~L~L~~s-~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~-ls~l~~Le~L~L~~c 667 (1153)
T PLN03210 591 LRLLRWDKYPLRCMPSNF-RPENLVKLQMQGS-KLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDC 667 (1153)
T ss_pred cEEEEecCCCCCCCCCcC-CccCCcEEECcCc-cccccccccccCCCCCEEECCCCCCcCcCCc-cccCCcccEEEecCC
Confidence 455555555555555544 3456666666663 3556666666677777777777666666664 566677777777665
Q ss_pred -cCcccCccCCCCCCCCEEEccCCCCcccccccccCCCCCCEEEecCCCCCCCCCcccCCCCcccEEEccCCcCcCCCch
Q 048786 87 -SIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLKSLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIRRPTSS 165 (862)
Q Consensus 87 -~i~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~l~~l~~L~~L~L~~c~~l~~lp~~l~~l~~L~~L~l~~~~~~~~~~~ 165 (862)
.+..+|.+++++++|+.|++++|..++.+|..+ ++++|+.|++++|..+..+|.. .++|+.|++++|.+..+|..
T Consensus 668 ~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~ 743 (1153)
T PLN03210 668 SSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFPSN 743 (1153)
T ss_pred CCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCcccccccc
Confidence 455667777777777777777777777776655 5677777777777666665542 34666777777776666654
Q ss_pred hhccCCccEEEc-------------------------------cCCCCCCCcc-ccccccccccccCCCCCccccccCcC
Q 048786 166 IFLMKNLRSLYF-------------------------------SGCNEPPASA-SWHLHLPFNLLGKSSCPVALMLPSLT 213 (862)
Q Consensus 166 l~~l~~L~~L~L-------------------------------~~~~~~~~~~-~~~~~~~l~~l~~~~~~~~~~lp~l~ 213 (862)
+ .+++|+.|.+ ++|......+ .......+..+.+.+|.....+|...
T Consensus 744 ~-~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~ 822 (1153)
T PLN03210 744 L-RLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI 822 (1153)
T ss_pred c-cccccccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC
Confidence 3 2344444444 3333221111 11111223334444444444444433
Q ss_pred CCCCccEEEccCCCCCCCCCCcccCCCCcccEEECcCCCCccccccccCCCCCCEEeeecCCCCCcCCCCC---CCCcEE
Q 048786 214 GVCSLTKLDLSDCGLGEAAIPSDIDNLHSLKELYLNRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIP---PNLQFV 290 (862)
Q Consensus 214 ~l~~L~~L~Ls~~~l~~~~lp~~l~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~c~~L~~lp~lp---~sL~~L 290 (862)
.+++|+.|++++|... ..+|. ..++|+.|+|++|.++.+|.++..+++|+.|++++|++++.+|..+ ++|+.+
T Consensus 823 ~L~sL~~L~Ls~c~~L-~~~p~---~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L 898 (1153)
T PLN03210 823 NLESLESLDLSGCSRL-RTFPD---ISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETV 898 (1153)
T ss_pred CccccCEEECCCCCcc-ccccc---cccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCee
Confidence 4555666666655432 12232 2357888999999999999999999999999999999999998644 677888
Q ss_pred eccCCCCceeecCccc---------------cccceeeeeccchhHHHHHhcchhHHHHHHHHHHhcccCCCCceEEecc
Q 048786 291 RANGCSSLVTLFGALK---------------LCRSKYTIINCIDSLKLLRKNGLAISMLREYLELQAVSDPGHKLSIVFP 355 (862)
Q Consensus 291 ~i~~C~~L~~l~~~~~---------------~~~~~l~i~~C~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~p 355 (862)
++.+|++|+.++.... +....+.+.+|.++.+... ++ . ......+++|
T Consensus 899 ~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L~~~a~------------l~--~---~~~~~~~~l~ 961 (1153)
T PLN03210 899 DFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEAL------------LQ--Q---QSIFKQLILS 961 (1153)
T ss_pred ecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCCCchhh------------hc--c---cccceEEECC
Confidence 9999999987652111 0112234458888743221 11 1 1112356899
Q ss_pred CCCCCCccccCCCCcEEE-EEcCCCCCCCCceEEEEEEEEEeccCCCCccccccCCCCceeEEEEecCCCceEEEEc---
Q 048786 356 GSQIPKWFMYQNEGSSIT-VTRPSYLYNVNKVVGFAICCVFQVPKHSTGTYLFHSYPAHELECSMDGSGEGHYIYFR--- 431 (862)
Q Consensus 356 g~~iP~wf~~~~~g~s~~-~~lp~~~~~~~~~lgfa~c~v~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~--- 431 (862)
|.++|.||.|+..|++++ +++|+.|+... |.||++|+|+.+....... ......+.|.+.+..+..+....
T Consensus 962 g~evp~~f~hr~~g~sl~~i~l~~~~~~~~-~~~f~~c~v~~~~~~~~~~----~~~~~~~~c~~~~~~~~~~~~~~~~~ 1036 (1153)
T PLN03210 962 GEEVPSYFTHRTTGASLTNIPLLHISPCQP-FFRFRACAVVDSESFFIIS----VSFDIQVCCRFIDRLGNHFDSPYQPH 1036 (1153)
T ss_pred CccCchhccCCcccceeeeeccCCcccCCC-ccceEEEEEEecCccccCC----CceeEEEEEEEECCCCCccccCCCce
Confidence 999999999999999998 99999998877 9999999999855431110 11245677887776655443211
Q ss_pred cccccccCCeEEEEEecCC--CC---CCCCCceEEEEEEEecc-CCCceEEEeeeEEeeccccc
Q 048786 432 GKFGHVVSDHLWLLFLPRH--GH---NWQFESNLIRLSFRSIS-DPTWKVKRCGFHPIYMHEVE 489 (862)
Q Consensus 432 ~~~~~~~s~hl~~~~~~~~--~~---~~~~~~~~~~~~f~~~~-~~~~~vk~cGv~liy~~~~~ 489 (862)
.+......+|++++..... .. .....+.|+.+.|.+.. ....+||+|||+++|.++..
T Consensus 1037 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~cg~~~~~~~~~~ 1100 (1153)
T PLN03210 1037 VFSVTKKGSHLVIFDCCFPLNEDNAPLAELNYDHVDIQFRLTNKNSQLKLKGCGIRLSEDDSSL 1100 (1153)
T ss_pred eEeeeccccceEEecccccccccccchhccCCceeeEEEEEecCCCCeEEEeeeEEEeccCCCc
Confidence 1122345667776643211 10 12235778888887622 22359999999999966644
|
syringae 6; Provisional |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 862 | ||||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 3e-06 |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 862 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 5e-52 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-44 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-38 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 7e-34 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-13 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-12 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-12 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-11 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-10 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 9e-08 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-30 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-30 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-28 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-28 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-25 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-22 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 7e-21 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-10 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-29 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-29 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 9e-24 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-20 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-04 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 5e-28 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-26 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-23 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 4e-13 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-07 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 8e-07 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-28 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-26 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-24 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-19 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 5e-04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 3e-27 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-07 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-26 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-26 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 8e-25 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-18 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-13 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-25 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-24 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-23 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-22 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 9e-21 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-18 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-10 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 6e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-25 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-23 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-22 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-19 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 7e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-25 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-17 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-15 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-24 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-24 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-18 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-12 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-24 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 7e-23 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-21 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-19 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-16 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 6e-24 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-22 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-19 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 7e-18 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-17 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 7e-24 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-18 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-12 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 5e-23 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 7e-23 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-11 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-22 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-22 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-13 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-10 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-21 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-18 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-16 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-11 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-21 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-17 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 6e-16 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-14 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-13 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-21 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 8e-20 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 4e-19 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 6e-21 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 7e-19 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-18 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-20 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 9e-18 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-14 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-09 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 5e-09 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 3e-20 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 3e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-20 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-19 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-16 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-15 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-12 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 6e-09 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-08 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 1e-19 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-16 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 3e-13 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 6e-13 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-19 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-19 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-18 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-18 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-17 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-13 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-19 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 1e-17 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-05 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 5e-04 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 3e-19 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-15 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-19 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-19 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 9e-16 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 4e-19 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 2e-18 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-08 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-18 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-13 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-06 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 7e-18 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-16 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 3e-16 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-14 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 4e-16 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-12 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 6e-16 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 5e-10 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-08 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-15 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-11 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-10 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 3e-10 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 8e-08 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-15 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 9e-15 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 4e-13 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-08 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-14 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 9e-14 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-07 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 4e-07 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-14 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-10 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-14 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-13 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-09 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 7e-06 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 6e-14 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 8e-13 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-05 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-13 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-08 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-13 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-08 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 1e-12 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-08 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-07 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 9e-12 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 1e-11 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 6e-11 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 1e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-11 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-10 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 2e-11 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-09 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 2e-07 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-06 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 3e-11 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 2e-09 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 2e-08 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 8e-07 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 7e-06 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-09 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-08 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 3e-09 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 3e-07 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 7e-06 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-04 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 1e-08 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 5e-08 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 4e-08 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 3e-07 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 3e-06 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 5e-08 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-07 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-05 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-07 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 6e-07 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-04 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 3e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 4e-05 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 3e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 4e-06 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 5e-05 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 9e-06 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 3e-05 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 1e-05 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 6e-04 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 4e-05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 3e-04 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 4e-04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 1e-04 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 3e-04 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 6e-04 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 9e-04 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
Score = 183 bits (468), Expect = 5e-52
Identities = 69/299 (23%), Positives = 110/299 (36%), Gaps = 41/299 (13%)
Query: 3 SMKDLSDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPVTISSLK--CLRTLELS 60
+ Y + ++ T + L + + LEL
Sbjct: 31 VLSQWQRHYNADRNRWHSAWRQANSNNPQIETRT-GRALKATADLLEDATQPGRVALELR 89
Query: 61 GCSKLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSIN 120
L +FP + L + +D + E+P +++ GLE L L L LP+SI
Sbjct: 90 SV-PLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNP-LRALPASIA 147
Query: 121 GLKSLKTLNLSGCCKLENVPDTLGKVE---------SLEELDVSGTAIRRPTSSIFLMKN 171
L L+ L++ C +L +P+ L + +L+ L + T IR +SI ++N
Sbjct: 148 SLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQN 207
Query: 172 LRSLYFSGCNEPPASASWHLH-LPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGE 230
L+SL L L P++ + L +LDL C
Sbjct: 208 LKSLKIRNS---------PLSALG---------------PAIHHLPKLEELDLRGCTALR 243
Query: 231 AAIPSDIDNLHSLKELYL-NRNNFVTLPASISGLLNLEELELEDCKRLQSLPQIPPNLQ 288
P LK L L + +N +TLP I L LE+L+L C L LP + L
Sbjct: 244 N-YPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLP 301
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 862 | |||
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 100.0 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 100.0 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 100.0 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 100.0 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.98 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.97 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.97 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.97 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.97 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.97 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.97 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.97 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.97 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.96 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.96 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.96 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.96 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.96 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.95 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.95 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.94 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.93 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.93 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.93 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.93 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.92 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.92 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.91 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.91 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.91 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.9 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.9 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.9 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.9 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.89 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.89 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.89 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.89 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.89 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.89 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.89 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.89 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.88 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.88 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.87 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.87 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.86 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.86 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.86 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.85 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.85 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.85 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.83 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.83 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.83 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.83 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.83 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.82 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.82 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.82 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.8 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.79 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.79 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.78 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.78 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.78 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.77 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.76 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.76 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.76 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.74 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.74 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.73 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.73 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.72 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.72 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.72 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.7 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.7 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.7 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.7 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.69 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.69 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.68 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.68 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.68 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.68 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.66 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.65 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.62 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.61 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.59 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.59 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.59 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.57 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.55 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.55 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.54 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.54 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.53 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.52 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.52 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.52 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.5 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.47 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.47 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.46 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.45 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.45 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.44 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.43 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.4 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.4 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.4 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.39 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.38 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.38 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.37 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.34 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.29 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.29 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.25 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.25 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.23 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.2 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.18 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.18 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.17 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.12 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.1 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.07 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.04 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.97 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.96 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.92 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.9 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.9 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.74 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.74 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.73 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.73 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.71 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.56 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.45 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.38 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.38 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.31 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.3 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.27 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.15 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 98.05 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.9 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.66 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.55 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.37 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.34 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.28 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.09 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.94 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.86 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 92.42 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 91.72 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 91.43 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 88.29 |
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=7.3e-36 Score=364.88 Aligned_cols=297 Identities=21% Similarity=0.211 Sum_probs=240.2
Q ss_pred CCCCCCCcEEEeecCCCcccCccccCCCCCcEEEEeCCCCCCcccc--ccCCCCCCCEEEeeCCCCCCccchhh-cCCCC
Q 048786 1 MASMKDLSDLYLDGTSITEVPSSIELLTGLELLTLKGCKNLSSLPV--TISSLKCLRTLELSGCSKLKKFPQIV-ASMED 77 (862)
Q Consensus 1 ~~~l~~Lr~L~L~~~~i~~lp~~i~~L~~L~~L~Ls~c~~l~~lp~--~l~~l~~L~~L~L~~c~~l~~lp~~i-~~l~~ 77 (862)
|.++++|+.++++.+++..+|+.++.+++|++|+|++|.....+|. .++++++|++|++++|......|..+ .++++
T Consensus 73 l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~ 152 (768)
T 3rgz_A 73 LLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNS 152 (768)
T ss_dssp TTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTT
T ss_pred HhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCC
Confidence 4567888999998888888888999999999999999877667777 78999999999999987666666665 78999
Q ss_pred CcEEEccCccCcccCc-c---CCCCCCCCEEEccCCCCcccccccccCCCCCCEEEecCCCCCCCCCcccCCCCcccEEE
Q 048786 78 LSKLYLDGTSIAEVPS-S---IELLPGLELLYLNECKNLVRLPSSINGLKSLKTLNLSGCCKLENVPDTLGKVESLEELD 153 (862)
Q Consensus 78 L~~L~L~~~~i~~lp~-~---i~~L~~L~~L~L~~~~~l~~lp~~l~~l~~L~~L~L~~c~~l~~lp~~l~~l~~L~~L~ 153 (862)
|++|++++|.+...+. . ++.+++|++|++++|......| +..+++|++|++++|.....+|. ++.+++|++|+
T Consensus 153 L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~ 229 (768)
T 3rgz_A 153 LEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLD 229 (768)
T ss_dssp CSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEE
T ss_pred CCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEE
Confidence 9999999999886543 3 7889999999999987655444 37889999999999887776776 89999999999
Q ss_pred ccCCcCc-CCCchhhccCCccEEEccCCCCCCCccccccccccccccCCCCCccccccC-cCC-CCCccEEEccCCCCCC
Q 048786 154 VSGTAIR-RPTSSIFLMKNLRSLYFSGCNEPPASASWHLHLPFNLLGKSSCPVALMLPS-LTG-VCSLTKLDLSDCGLGE 230 (862)
Q Consensus 154 l~~~~~~-~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~lp~-l~~-l~~L~~L~Ls~~~l~~ 230 (862)
+++|.+. ..|..+..+++|++|++++|......+.. ....++.+....+.....+|. +.. +++|++|++++|.+.
T Consensus 230 Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~- 307 (768)
T 3rgz_A 230 ISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFY- 307 (768)
T ss_dssp CCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEE-
T ss_pred CcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCC-
Confidence 9999888 45778888999999999998765333222 334566677777776666666 444 499999999999886
Q ss_pred CCCCcccCCCCcccEEECcCCCCc-ccccc-ccCCCCCCEEeeecCCCCCcCCC----CCCCCcEEeccCCCCceeec
Q 048786 231 AAIPSDIDNLHSLKELYLNRNNFV-TLPAS-ISGLLNLEELELEDCKRLQSLPQ----IPPNLQFVRANGCSSLVTLF 302 (862)
Q Consensus 231 ~~lp~~l~~l~~L~~L~L~~n~l~-~lp~~-l~~l~~L~~L~L~~c~~L~~lp~----lp~sL~~L~i~~C~~L~~l~ 302 (862)
+.+|..+..+++|++|++++|.+. .+|.. +..+++|++|++++|.....+|. ++++|+.|++.++.--..++
T Consensus 308 ~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~ 385 (768)
T 3rgz_A 308 GAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPIL 385 (768)
T ss_dssp ECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECC
T ss_pred CccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcC
Confidence 457889999999999999999998 88876 89999999999999975556775 34599999999885443333
|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 862 | ||||
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 5e-14 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 6e-14 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 7e-10 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-08 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-07 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-05 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 4e-09 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-07 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 6e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 9e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 5e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 6e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.003 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 2e-07 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 6e-06 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 1e-05 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 1e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.004 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 5e-04 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 0.001 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.003 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 0.004 |
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Ngr ectodomain-like domain: Decorin species: Cow (Bos taurus) [TaxId: 9913]
Score = 71.6 bits (174), Expect = 5e-14
Identities = 47/278 (16%), Positives = 92/278 (33%), Gaps = 14/278 (5%)
Query: 5 KDLSDLYLDGTSITEV-PSSIELLTGLELLTLKGCKNLSSLPVTISSLKCLRTLELSGCS 63
D + L L ITE+ + L L L L K P + L L L LS
Sbjct: 31 PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQ 90
Query: 64 KLKKFPQIVASMEDLSKLYLDGTSIAEVPSSIELLPGLELLYLNECKNLVRLPSSINGLK 123
+ ++ ++++L + T + + + + L N K+ + G+K
Sbjct: 91 LKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMK 150
Query: 124 SLKTLNLSGCCKLENVPDTLGKVESLEELDVSGTAIR-RPTSSIFLMKNLRSLYFSGCNE 182
L + ++ + +P L SL EL + G I +S+ + NL L S +
Sbjct: 151 KLSYIRIAD-TNITTIPQGLPP--SLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSI 207
Query: 183 PPASASWHLHLPFNLLGK-SSCPVALMLPSLTGVCSLTKLDLSDCGL-----GEAAIPSD 236
+ P ++ + + L + + L + + + P
Sbjct: 208 SAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGY 267
Query: 237 IDNLHSLKELYLNRNNFVTL---PASISGLLNLEELEL 271
S + L N P++ + ++L
Sbjct: 268 NTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQL 305
|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 862 | |||
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.86 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.81 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.8 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.8 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.78 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.74 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.72 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.71 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.71 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.66 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.62 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.56 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.55 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.5 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.46 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.46 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.45 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.45 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.43 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.42 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.39 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.32 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.2 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.15 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.14 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.11 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.09 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.07 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.03 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.91 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.91 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.81 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.79 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.78 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.72 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.51 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.67 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.4 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.26 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.18 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.1 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 94.93 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.86 E-value=6.9e-22 Score=212.22 Aligned_cols=249 Identities=20% Similarity=0.289 Sum_probs=156.6
Q ss_pred CCcEEEeecCCCc---ccCccccCCCCCcEEEEeCCCC-CCccccccCCCCCCCEEEeeCCCCCCccchhhcCCCCCcEE
Q 048786 6 DLSDLYLDGTSIT---EVPSSIELLTGLELLTLKGCKN-LSSLPVTISSLKCLRTLELSGCSKLKKFPQIVASMEDLSKL 81 (862)
Q Consensus 6 ~Lr~L~L~~~~i~---~lp~~i~~L~~L~~L~Ls~c~~-l~~lp~~l~~l~~L~~L~L~~c~~l~~lp~~i~~l~~L~~L 81 (862)
+++.|+|+++++. .+|..++++++|++|+|++|+. ...+|..++++++|++|+|++|......|..+..+.+|+++
T Consensus 51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l 130 (313)
T d1ogqa_ 51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL 130 (313)
T ss_dssp CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence 5667777776665 4667777777777777776333 33677777777777777777766555566666777777777
Q ss_pred EccCccCc-ccCccCCCCCCCCEEEccCCCCcccccccccCCCCC-CEEEecCCCCCCCCCcccCCCCcccEEEccCCcC
Q 048786 82 YLDGTSIA-EVPSSIELLPGLELLYLNECKNLVRLPSSINGLKSL-KTLNLSGCCKLENVPDTLGKVESLEELDVSGTAI 159 (862)
Q Consensus 82 ~L~~~~i~-~lp~~i~~L~~L~~L~L~~~~~l~~lp~~l~~l~~L-~~L~L~~c~~l~~lp~~l~~l~~L~~L~l~~~~~ 159 (862)
++++|.+. .+|..++.++.|+.+++++|.....+|..+..+.++ +.+++++|......|..++.+..+ .+++.++..
T Consensus 131 ~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~ 209 (313)
T d1ogqa_ 131 DFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNML 209 (313)
T ss_dssp ECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEE
T ss_pred ccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccc
Confidence 77766554 456667777777777777766666666666666654 666666655555555555555433 466665544
Q ss_pred c-CCCchhhccCCccEEEccCCCCCCCccccccccccccccCCCCCccccccCcCCCCCccEEEccCCCCCCCCCCcccC
Q 048786 160 R-RPTSSIFLMKNLRSLYFSGCNEPPASASWHLHLPFNLLGKSSCPVALMLPSLTGVCSLTKLDLSDCGLGEAAIPSDID 238 (862)
Q Consensus 160 ~-~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~lp~l~~l~~L~~L~Ls~~~l~~~~lp~~l~ 238 (862)
. ..|..+..+++++.+++.++... ..+|.+..+++|+.|++++|+++ +.+|.+++
T Consensus 210 ~~~~~~~~~~~~~l~~l~~~~~~l~-----------------------~~~~~~~~~~~L~~L~Ls~N~l~-g~iP~~l~ 265 (313)
T d1ogqa_ 210 EGDASVLFGSDKNTQKIHLAKNSLA-----------------------FDLGKVGLSKNLNGLDLRNNRIY-GTLPQGLT 265 (313)
T ss_dssp EECCGGGCCTTSCCSEEECCSSEEC-----------------------CBGGGCCCCTTCCEEECCSSCCE-ECCCGGGG
T ss_pred ccccccccccccccccccccccccc-----------------------ccccccccccccccccCccCeec-ccCChHHh
Confidence 4 34455555666666666655432 12333555666777777777665 34666777
Q ss_pred CCCcccEEECcCCCCc-cccccccCCCCCCEEeeecCCCCCcC
Q 048786 239 NLHSLKELYLNRNNFV-TLPASISGLLNLEELELEDCKRLQSL 280 (862)
Q Consensus 239 ~l~~L~~L~L~~n~l~-~lp~~l~~l~~L~~L~L~~c~~L~~l 280 (862)
.+++|++|+|++|+++ .+|. ++++++|+.+++.+|+.+...
T Consensus 266 ~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~ 307 (313)
T d1ogqa_ 266 QLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGS 307 (313)
T ss_dssp GCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEEST
T ss_pred CCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCC
Confidence 7777777777777766 5553 456666777777666655443
|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|