Citrus Sinensis ID: 048803

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MDLIPDLPNEIALECLSRVSYKQFATISSVCKGWKSEISRPEFRRNRKDTRSSEQLLFMTQARVDQSRKSGVPKRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDLTTWEASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEEDFMETATCPRSCAGVDSNDLYMCREGDVMALRCNTWQA
ccccccccHHHHHHHHHcccccccHHHHHccHHHHHHHccHHHHHHHHHccccccEEEEEEEEccccccccccccccccccEEEEEEcccccEEEccccccccccccccEEEEEEccEEEEEEcccccccccccEEEEEEcccccEEEcccccccccEEEEEEEccccEEEEEEccccccccccEEEEEEcccccEEEccccccccccccEEEEccEEEEEEccccccccccccEEEEEEcccccEEEccccccccccccccEEEEEccEEEEEEccEEEEcccccEEc
ccccccccHHHHHHHHHHccHHccHHHHHHHHHHHHHHccHHHHHHHHHcccccEEEEEEEccccccccccccccccccccEEEEEccccccEEEcccccccccccccccEEEEEccEEEEEccccccccccccEEEEEEcccccccccccccccccccccEEEEcccEEEEEEccccccccccEEEEEccccccEEEcccccHccccccEEEEccEEEEEEcccccccccEccEEEEEccccccEEEcccccccccccccccEEEEccEEEEEccccEEccccccccc
mdlipdlpnEIALECLSRVSYKQFATISSVCKgwkseisrpefrrnrkdtrsSEQLLFMTQARVdqsrksgvpkrfatpVYRITVLelgsgewselppipgfpdglplfcqlsavgpelVVIGGLDLTTWEASSSVFVFNIISAtwrrgadmpggrrmlfgcasdgdrtvyvagghdedkNALKSAMAYDVARdewaslpdmsrerdeckavfhcgkllviggystnaqgRFERHAEAFDAAaqqwgpveedfmetatcprscagvdsndlymcregDVMALRCNTWQA
MDLIPDLPNEIALECLSRVSYKQFATISsvckgwkseisrpefrrnrkdtrsseqllfmtqarvdqsrksgvpkrfatpvYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDLTTWEASSSVFVFNIISATwrrgadmpggrRMLFGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEEDFMETATCPRSCAGVDSNDLYMCREGDVMALRCNTWQA
MDLIPDLPNEIALECLSRVSYKQFATISSVCKGWKSEISRPEFRRNRKDTRSSEQLLFMTQARVDQSRKSGVPKRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDLTTWEASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEEDFMETATCPRSCAGVDSNDLYMCREGDVMALRCNTWQA
********NEIALECLSRVSYKQFATISSVCKGWK**************************************KRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDLTTWEASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGH******LKSAMAYDVARDEWASL*******DECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEEDFMETATCPRSCAGVDSNDLYMCREGDVMALRCNTW**
MDLIPDLPNEIALECLSRVSYKQFATISSVCKGWKSEISRPEFRRNRKDTRSSEQLLFMTQARVDQSRKSGVPKRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDLTTWEASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEEDFMETATCPRSCAGVDSNDLYMCREGDVMALRCNTWQ*
MDLIPDLPNEIALECLSRVSYKQFATISSVCKGWKSEISR***********SSEQLLFMTQ**********VPKRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDLTTWEASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEEDFMETATCPRSCAGVDSNDLYMCREGDVMALRCNTWQA
*DLIPDLPNEIALECLSRVSYKQFATISSVCKGWKSEISRPEFRRNRKDTRSSEQLLFMTQARVDQSRKSGVPKRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDLTTWEASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEEDFMETATCPRSCAGVDSNDLYMCREGDVMALR******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLIPDLPNEIALECLSRVSYKQFATISSVCKGWKSEISRPEFRRNRKDTRSSEQLLFMTQARVDQSRKSGVPKRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDLTTWEASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEEDFMETATCPRSCAGVDSNDLYMCREGDVMALRCNTWQA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
Q9M8L2354 F-box/kelch-repeat protei yes no 0.975 0.796 0.561 7e-92
Q9LMR5359 F-box/kelch-repeat protei no no 0.989 0.796 0.556 4e-89
O80582409 F-box/kelch-repeat protei no no 0.882 0.623 0.356 7e-40
Q9M1Y1418 F-box/kelch-repeat protei no no 0.847 0.586 0.322 7e-35
Q9CAG8376 F-box/kelch-repeat protei no no 0.782 0.601 0.288 9e-17
Q84M94421 F-box/kelch-repeat protei no no 0.782 0.536 0.282 1e-15
Q8L736467 F-box/kelch-repeat protei no no 0.871 0.539 0.246 5e-15
Q93W93434 F-box/kelch-repeat protei no no 0.865 0.576 0.265 2e-13
Q9M1W7352 F-box/kelch-repeat protei no no 0.882 0.724 0.233 1e-11
Q9CA63451 F-box/kelch-repeat protei no no 0.754 0.483 0.251 2e-11
>sp|Q9M8L2|FBK30_ARATH F-box/kelch-repeat protein At1g80440 OS=Arabidopsis thaliana GN=At1g80440 PE=2 SV=1 Back     alignment and function desciption
 Score =  337 bits (863), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 164/292 (56%), Positives = 209/292 (71%), Gaps = 10/292 (3%)

Query: 1   MDLIPDLPNEIALECLSRVSYKQFATISSVCKGWKSEISRPEFRRNRKDTRSSEQLLFMT 60
           M+LIP+LP+++A ECL R SY+QF  I+SVC+ W  E+S  +F   RK +R S++LL ++
Sbjct: 1   MELIPNLPDDVARECLLRSSYQQFPVIASVCRAWNREVSLSQFLHQRKASRHSQELLILS 60

Query: 61  QARVDQSRKSGVPKRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELV 120
           QARVD    +G  K  ATP YRI+VLE GSG W+ELPPIPG   GLPLFC+L +VG +L+
Sbjct: 61  QARVD---PAGSGKIIATPEYRISVLESGSGLWTELPPIPGQTKGLPLFCRLVSVGSDLI 117

Query: 121 VIGGLDLTTWEASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGHDEDK 180
           V+GGLD  TW+A  SVFVF+ +++ WR GA MPG RR  FGCASD DRTV VAGGH+E+K
Sbjct: 118 VLGGLDPITWQAHDSVFVFSFLTSKWRVGATMPGVRRSFFGCASDSDRTVLVAGGHNEEK 177

Query: 181 NALKSAMAYDVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFD 240
            AL SAM YDV+ D+W  LPDM+RERDECKAVFH G+  VIGGY+T  QG+F + AE+FD
Sbjct: 178 CALTSAMVYDVSEDKWTFLPDMARERDECKAVFHAGRFHVIGGYATEEQGQFSKTAESFD 237

Query: 241 AAAQQWGPVEEDFM----ETATCPRSCAGVDSNDLYMCREGDVMALRCNTWQ 288
            +  +WGP+ EDF+    +T + P   AG    DLY C  GDVM    + WQ
Sbjct: 238 VSTWEWGPLTEDFLDDTGDTVSPPTCVAG---GDLYACWGGDVMMFLNDKWQ 286

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LMR5|FK126_ARATH F-box/kelch-repeat protein At1g15670 OS=Arabidopsis thaliana GN=At1g15670 PE=2 SV=1 Back     alignment and function description
>sp|O80582|FBK46_ARATH F-box/kelch-repeat protein At2g44130 OS=Arabidopsis thaliana GN=At2g44130 PE=2 SV=2 Back     alignment and function description
>sp|Q9M1Y1|SKI20_ARATH F-box/kelch-repeat protein SKIP20 OS=Arabidopsis thaliana GN=SKIP20 PE=1 SV=1 Back     alignment and function description
>sp|Q9CAG8|FBK28_ARATH F-box/kelch-repeat protein At1g67480 OS=Arabidopsis thaliana GN=At1g67480 PE=2 SV=1 Back     alignment and function description
>sp|Q84M94|FBK15_ARATH F-box/kelch-repeat protein At1g26930 OS=Arabidopsis thaliana GN=At1g26930 PE=2 SV=1 Back     alignment and function description
>sp|Q8L736|SKI11_ARATH F-box/kelch-repeat protein SKIP11 OS=Arabidopsis thaliana GN=SKIP11 PE=1 SV=2 Back     alignment and function description
>sp|Q93W93|FBK22_ARATH F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1 Back     alignment and function description
>sp|Q9M1W7|SKI30_ARATH F-box/kelch-repeat protein SKIP30 OS=Arabidopsis thaliana GN=SKIP30 PE=1 SV=2 Back     alignment and function description
>sp|Q9CA63|FBK29_ARATH F-box/kelch-repeat protein At1g74510 OS=Arabidopsis thaliana GN=At1g74510 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
255552951355 conserved hypothetical protein [Ricinus 0.996 0.811 0.606 1e-102
224058800355 predicted protein [Populus trichocarpa] 0.996 0.811 0.611 1e-101
225442709355 PREDICTED: F-box/kelch-repeat protein At 0.993 0.808 0.602 3e-97
147817704360 hypothetical protein VITISV_039605 [Viti 0.993 0.797 0.595 1e-95
297842823355 hypothetical protein ARALYDRAFT_477208 [ 0.989 0.805 0.569 4e-94
356519433354 PREDICTED: F-box/kelch-repeat protein At 0.989 0.807 0.574 4e-94
21592820354 unknown [Arabidopsis thaliana] 0.979 0.799 0.560 3e-90
356550563358 PREDICTED: F-box/kelch-repeat protein At 0.996 0.804 0.546 4e-90
18412854354 F-box/kelch-repeat protein [Arabidopsis 0.975 0.796 0.561 4e-90
356526161353 PREDICTED: F-box/kelch-repeat protein At 0.986 0.807 0.550 1e-89
>gi|255552951|ref|XP_002517518.1| conserved hypothetical protein [Ricinus communis] gi|223543150|gb|EEF44682.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/290 (60%), Positives = 223/290 (76%), Gaps = 2/290 (0%)

Query: 1   MDLIPDLPNEIALECLSRVSYKQFATISSVCKGWKSEISRPEFRRNRKDTRSSEQLLFMT 60
           M+LIP LP+++A +CL RV YKQF+T+ +VCKGW++E+  PEF + RKD+ +S++L+ M 
Sbjct: 1   MELIPGLPDDVARDCLVRVMYKQFSTVIAVCKGWRTELELPEFYQRRKDSCNSQKLIVMA 60

Query: 61  QARVDQSRKSGVPKRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELV 120
           QARV Q + S + K  A PVY +TVLE  +G+W +LPPIPGF  GLP+FCQ+ +VG +L+
Sbjct: 61  QARVHQKQGSNLIKYRANPVYSLTVLEPDTGDWCDLPPIPGFSHGLPMFCQVVSVGSDLI 120

Query: 121 VIGGLDLTTWEASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGHDEDK 180
           V+GGLD TTWEAS SVF+FN +SATWRRGADMPG RR  FGCAS+  RTV+V GGHD +K
Sbjct: 121 VLGGLDPTTWEASDSVFIFNFVSATWRRGADMPGVRRSFFGCASNFSRTVFVVGGHDGEK 180

Query: 181 NALKSAMAYDVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFD 240
           NAL+S  AYDVA DEW  LPDM+RERDECKAVFH GKL VIGGY T  QGRFE+ AE FD
Sbjct: 181 NALRSGFAYDVANDEWIPLPDMARERDECKAVFHGGKLHVIGGYCTEMQGRFEKSAEVFD 240

Query: 241 AAAQQWGPVEEDFMETATCPRSCAGVDSNDLYMCREGDVMALRCN-TWQA 289
           AA  +W  V++DF+  A CPR+C  +  + LY+C  GDV+AL+   TWQA
Sbjct: 241 AATWKWNDVQDDFLLAAICPRTCV-IGDDGLYICHGGDVLALKGGATWQA 289

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224058800|ref|XP_002299632.1| predicted protein [Populus trichocarpa] gi|222846890|gb|EEE84437.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225442709|ref|XP_002284872.1| PREDICTED: F-box/kelch-repeat protein At1g80440 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147817704|emb|CAN68948.1| hypothetical protein VITISV_039605 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297842823|ref|XP_002889293.1| hypothetical protein ARALYDRAFT_477208 [Arabidopsis lyrata subsp. lyrata] gi|297335134|gb|EFH65552.1| hypothetical protein ARALYDRAFT_477208 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356519433|ref|XP_003528377.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Glycine max] Back     alignment and taxonomy information
>gi|21592820|gb|AAM64770.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356550563|ref|XP_003543655.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Glycine max] Back     alignment and taxonomy information
>gi|18412854|ref|NP_565238.1| F-box/kelch-repeat protein [Arabidopsis thaliana] gi|75186440|sp|Q9M8L2.1|FBK30_ARATH RecName: Full=F-box/kelch-repeat protein At1g80440 gi|6730740|gb|AAF27130.1|AC018849_18 unknown protein; 76867-75803 [Arabidopsis thaliana] gi|17528986|gb|AAL38703.1| unknown protein [Arabidopsis thaliana] gi|21436099|gb|AAM51296.1| unknown protein [Arabidopsis thaliana] gi|332198284|gb|AEE36405.1| F-box/kelch-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356526161|ref|XP_003531688.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
TAIR|locus:2198958354 AT1G80440 "AT1G80440" [Arabido 0.979 0.799 0.560 2.4e-85
TAIR|locus:2036119359 AT1G15670 "AT1G15670" [Arabido 0.989 0.796 0.556 3.4e-84
TAIR|locus:2051879409 AT2G44130 "AT2G44130" [Arabido 0.961 0.679 0.349 4.2e-40
TAIR|locus:2080432418 AT3G59940 "AT3G59940" [Arabido 0.598 0.413 0.363 3.2e-39
TAIR|locus:2008773376 AT1G67480 "AT1G67480" [Arabido 0.782 0.601 0.292 6.4e-18
TAIR|locus:2012547441 AT1G14330 "AT1G14330" [Arabido 0.608 0.399 0.299 6.3e-16
TAIR|locus:2202765421 AT1G26930 "AT1G26930" [Arabido 0.525 0.361 0.317 8.3e-14
TAIR|locus:2056705467 AT2G02870 "AT2G02870" [Arabido 0.525 0.325 0.295 1.1e-13
TAIR|locus:2035696434 AT1G55270 "AT1G55270" [Arabido 0.636 0.423 0.280 5e-12
TAIR|locus:2133985400 AT4G19870 "AT4G19870" [Arabido 0.681 0.492 0.295 1.3e-11
TAIR|locus:2198958 AT1G80440 "AT1G80440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 854 (305.7 bits), Expect = 2.4e-85, P = 2.4e-85
 Identities = 163/291 (56%), Positives = 208/291 (71%)

Query:     1 MDLIPDLPNEIALECLSRVSYKQFATISSVCKGWKSEISRPEFRRNRKDTRSSEQLLFMT 60
             M+LIP+LP+++A ECL R SY+QF  I+SVC+ W  E+S  +F   RK +R S++LL ++
Sbjct:     1 MELIPNLPDDVARECLLRSSYQQFPVIASVCRAWNREVSLSQFLHQRKASRHSQELLILS 60

Query:    61 QARVDQSRKSGVPKRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELV 120
             QARVD +   G  K  ATP YRI+VLE GSG W+ELPPIPG   GLPLFC+L +VG +L+
Sbjct:    61 QARVDPA---GSGKIIATPEYRISVLESGSGLWTELPPIPGQTKGLPLFCRLVSVGSDLI 117

Query:   121 VIGGLDLTTWEASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGHDEDK 180
             V+GGLD  TW+A  SVFVF+ +++ WR GA MPG RR  FGCASD DRTV VAGGH+E+K
Sbjct:   118 VLGGLDPITWQAHDSVFVFSFLTSKWRVGATMPGVRRSFFGCASDSDRTVLVAGGHNEEK 177

Query:   181 NALKSAMAYDVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFD 240
              AL SAM YDV+ D+W  LPDM+RERDECKAVFH G+  VIGGY+T  QG+F + AE+FD
Sbjct:   178 CALTSAMVYDVSEDKWTFLPDMARERDECKAVFHAGRFHVIGGYATEEQGQFSKTAESFD 237

Query:   241 AAAQQWGPVEEDFMETA---TCPRSCAGVDSNDLYMCREGDVMALRCNTWQ 288
              +  +WGP+ EDF++       P +C  V   DLY C  GDVM    + WQ
Sbjct:   238 VSTWEWGPLTEDFLDDTGDTVSPPTC--VAGGDLYACWGGDVMMFLNDKWQ 286
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2036119 AT1G15670 "AT1G15670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051879 AT2G44130 "AT2G44130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080432 AT3G59940 "AT3G59940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008773 AT1G67480 "AT1G67480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012547 AT1G14330 "AT1G14330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202765 AT1G26930 "AT1G26930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056705 AT2G02870 "AT2G02870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035696 AT1G55270 "AT1G55270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133985 AT4G19870 "AT4G19870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M8L2FBK30_ARATHNo assigned EC number0.56160.97570.7966yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
pfam0064648 pfam00646, F-box, F-box domain 5e-08
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 4e-06
pfam0134446 pfam01344, Kelch_1, Kelch motif 6e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 1e-05
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 2e-05
PLN02153341 PLN02153, PLN02153, epithiospecifier protein 2e-05
pfam0134446 pfam01344, Kelch_1, Kelch motif 3e-05
smart0061247 smart00612, Kelch, Kelch domain 3e-05
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-05
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 6e-05
smart0061247 smart00612, Kelch, Kelch domain 7e-05
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 9e-05
pfam1293747 pfam12937, F-box-like, F-box-like 5e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 6e-04
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 0.001
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 0.001
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 0.004
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information 
 Score = 48.0 bits (115), Expect = 5e-08
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 2  DLIPDLPNEIALECLSRVSYKQFATISSVCKGWKSEISRPEFRRNR 47
            + DLP+++ LE LSR+  K    +S V K W+S +   +  + R
Sbjct: 1  FSLLDLPDDLLLEILSRLDPKDLLRLSLVSKRWRSLVDSLKLWKKR 46

This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. Length = 48
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PLN02193470 nitrile-specifier protein 99.98
PLN02153341 epithiospecifier protein 99.97
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.97
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.97
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.97
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.97
KOG4693392 consensus Uncharacterized conserved protein, conta 99.97
PLN02193 470 nitrile-specifier protein 99.96
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.96
PHA02790480 Kelch-like protein; Provisional 99.96
PHA03098534 kelch-like protein; Provisional 99.96
KOG4693 392 consensus Uncharacterized conserved protein, conta 99.94
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.92
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 99.88
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.87
KOG1230 521 consensus Protein containing repeated kelch motifs 99.87
KOG1230 521 consensus Protein containing repeated kelch motifs 99.86
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 99.69
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 99.59
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.56
PF1396450 Kelch_6: Kelch motif 99.29
PF1396450 Kelch_6: Kelch motif 99.2
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 99.19
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 99.08
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.02
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 99.02
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.01
PF1341549 Kelch_3: Galactose oxidase, central domain 99.0
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.92
PF1341549 Kelch_3: Galactose oxidase, central domain 98.9
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.89
smart0061247 Kelch Kelch domain. 98.86
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.85
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.8
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.78
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.78
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 98.77
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.71
smart0061247 Kelch Kelch domain. 98.6
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 98.49
PLN02772 398 guanylate kinase 98.49
PF1385442 Kelch_5: Kelch motif 98.48
PLN02772 398 guanylate kinase 98.44
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.39
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.29
PF1385442 Kelch_5: Kelch motif 98.27
KOG0281 499 consensus Beta-TrCP (transducin repeats containing 97.95
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.84
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.84
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.64
PF12768 281 Rax2: Cortical protein marker for cell polarity 97.51
PF03089337 RAG2: Recombination activating protein 2; InterPro 97.5
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.47
KOG2997366 consensus F-box protein FBX9 [General function pre 97.38
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 97.38
PF03089 337 RAG2: Recombination activating protein 2; InterPro 97.35
KOG2055514 consensus WD40 repeat protein [General function pr 97.0
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.95
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.81
PF12768 281 Rax2: Cortical protein marker for cell polarity 96.43
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.38
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 96.33
KOG0274 537 consensus Cdc4 and related F-box and WD-40 protein 95.79
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 95.76
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.59
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.2
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.11
PRK13684334 Ycf48-like protein; Provisional 95.09
PF09910 339 DUF2139: Uncharacterized protein conserved in arch 95.07
PF05096 264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.79
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.39
KOG0310 487 consensus Conserved WD40 repeat-containing protein 94.35
PRK13684334 Ycf48-like protein; Provisional 94.11
PRK00178430 tolB translocation protein TolB; Provisional 93.92
PRK04792448 tolB translocation protein TolB; Provisional 93.72
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.53
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 93.08
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 92.69
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 92.66
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 92.6
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 92.56
PRK03629429 tolB translocation protein TolB; Provisional 92.33
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 92.25
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 91.74
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.71
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 91.45
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 90.88
KOG0278334 consensus Serine/threonine kinase receptor-associa 90.81
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 90.46
PRK04043419 tolB translocation protein TolB; Provisional 90.16
KOG2321 703 consensus WD40 repeat protein [General function pr 90.04
PRK04922433 tolB translocation protein TolB; Provisional 89.98
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 89.61
KOG2055514 consensus WD40 repeat protein [General function pr 89.43
KOG0316307 consensus Conserved WD40 repeat-containing protein 89.19
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 88.91
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 88.87
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 88.75
KOG0278334 consensus Serine/threonine kinase receptor-associa 88.29
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 88.08
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 88.07
PRK05137435 tolB translocation protein TolB; Provisional 87.77
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 87.69
PRK11028 330 6-phosphogluconolactonase; Provisional 87.66
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 87.2
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 86.84
smart00284255 OLF Olfactomedin-like domains. 86.56
PF13013109 F-box-like_2: F-box-like domain 85.78
PRK04792448 tolB translocation protein TolB; Provisional 85.67
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 84.71
KOG2321 703 consensus WD40 repeat protein [General function pr 84.26
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 83.6
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 83.53
COG1520370 FOG: WD40-like repeat [Function unknown] 83.36
PLN00181793 protein SPA1-RELATED; Provisional 83.14
PRK05137435 tolB translocation protein TolB; Provisional 83.09
KOG4341 483 consensus F-box protein containing LRR [General fu 83.01
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 82.92
PRK02889427 tolB translocation protein TolB; Provisional 82.77
PLN00033398 photosystem II stability/assembly factor; Provisio 82.57
PTZ00421 493 coronin; Provisional 82.4
PRK11028 330 6-phosphogluconolactonase; Provisional 82.04
KOG0639705 consensus Transducin-like enhancer of split protei 81.34
PTZ00420 568 coronin; Provisional 81.18
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 81.13
PRK00178430 tolB translocation protein TolB; Provisional 80.84
KOG0289506 consensus mRNA splicing factor [General function p 80.67
KOG0294 362 consensus WD40 repeat-containing protein [Function 80.51
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-37  Score=274.52  Aligned_cols=234  Identities=21%  Similarity=0.343  Sum_probs=192.8

Q ss_pred             HhhhHHhhhcChhHHHHhhhcCCCCCeEEEEeeeeccccCCCCCCCCCCCceeEEEEECCCCCeEeCCCCCCCCCCCCce
Q 048803           30 VCKGWKSEISRPEFRRNRKDTRSSEQLLFMTQARVDQSRKSGVPKRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLF  109 (289)
Q Consensus        30 v~k~W~~l~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~~~~~  109 (289)
                      ..+.|..+...|.-.. +..+...+..+|+.||.....          ....++++|||.+++|..+++|+.+|..+   
T Consensus       309 ~~~~w~~~a~m~~~r~-~~~~~~~~~~lYv~GG~~~~~----------~~l~~ve~YD~~~~~W~~~a~M~~~R~~~---  374 (571)
T KOG4441|consen  309 KTNEWSSLAPMPSPRC-RVGVAVLNGKLYVVGGYDSGS----------DRLSSVERYDPRTNQWTPVAPMNTKRSDF---  374 (571)
T ss_pred             CcCcEeecCCCCcccc-cccEEEECCEEEEEccccCCC----------cccceEEEecCCCCceeccCCccCccccc---
Confidence            3456888888774322 444445666778887775311          12278999999999999999999999987   


Q ss_pred             eEEEEeCCEEEEEeCcCCCCcccccceEEEEccCCeEEeCCCCCCCCccceeEEEecCCEEEEEcCCCCCCcccCceEEE
Q 048803          110 CQLSAVGPELVVIGGLDLTTWEASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGHDEDKNALKSAMAY  189 (289)
Q Consensus       110 ~~~~~~~~~lyv~GG~~~~~~~~~~~~~~yd~~t~~W~~~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~y  189 (289)
                       +++++++.||++||.++..  ..+.+++|||.+++|+.+++|+. +|..+++++ ++|+||++||.+.....++.+++|
T Consensus       375 -~v~~l~g~iYavGG~dg~~--~l~svE~YDp~~~~W~~va~m~~-~r~~~gv~~-~~g~iYi~GG~~~~~~~l~sve~Y  449 (571)
T KOG4441|consen  375 -GVAVLDGKLYAVGGFDGEK--SLNSVECYDPVTNKWTPVAPMLT-RRSGHGVAV-LGGKLYIIGGGDGSSNCLNSVECY  449 (571)
T ss_pred             -eeEEECCEEEEEecccccc--ccccEEEecCCCCcccccCCCCc-ceeeeEEEE-ECCEEEEEcCcCCCccccceEEEE
Confidence             9999999999999998664  78899999999999999999995 787887777 599999999998776588999999


Q ss_pred             EcCCCceEeCCCCCccccccceEEECCEEEEEeeecCCCCCcccceEEEEECCCCceeecccccccCCCCCCceeeeeCC
Q 048803          190 DVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEEDFMETATCPRSCAGVDSN  269 (289)
Q Consensus       190 d~~~~~W~~~~~~~~~~~~~~~~~~~~~l~~~gG~~~~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~~~  269 (289)
                      ||.+++|+.+++|+.+|.++++++++++||++||.++..   ....+++|||.+++|..++.+.  . .+...++++.++
T Consensus       450 DP~t~~W~~~~~M~~~R~~~g~a~~~~~iYvvGG~~~~~---~~~~VE~ydp~~~~W~~v~~m~--~-~rs~~g~~~~~~  523 (571)
T KOG4441|consen  450 DPETNTWTLIAPMNTRRSGFGVAVLNGKIYVVGGFDGTS---ALSSVERYDPETNQWTMVAPMT--S-PRSAVGVVVLGG  523 (571)
T ss_pred             cCCCCceeecCCcccccccceEEEECCEEEEECCccCCC---ccceEEEEcCCCCceeEcccCc--c-ccccccEEEECC
Confidence            999999999999999999999999999999999998732   4567999999999999997643  2 233345777899


Q ss_pred             eEEEEeCceeeccc---------CCccc
Q 048803          270 DLYMCREGDVMALR---------CNTWQ  288 (289)
Q Consensus       270 ~ly~~GG~~~~~~~---------~~~w~  288 (289)
                      +||++||+++..+.         +|+|+
T Consensus       524 ~ly~vGG~~~~~~l~~ve~ydp~~d~W~  551 (571)
T KOG4441|consen  524 KLYAVGGFDGNNNLNTVECYDPETDTWT  551 (571)
T ss_pred             EEEEEecccCccccceeEEcCCCCCcee
Confidence            99999998765542         28886

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 5e-10
2eib_A 639 Crystal Structure Of Galactose Oxidase, W290h Mutan 2e-07
2eid_A 639 Galactose Oxidase W290g Mutant Length = 639 3e-07
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 5e-07
2eic_A 639 Crystal Structure Of Galactose Oxidase Mutant W290f 7e-07
2wq8_A 661 Glycan Labelling Using Engineered Variants Of Galac 8e-07
1t2x_A 639 Glactose Oxidase C383s Mutant Identified By Directe 1e-06
2eie_A 639 Crystal Structure Of Galactose Oxidase Complexed Wi 1e-06
1k3i_A 656 Crystal Structure Of The Precursor Of Galactose Oxi 1e-06
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 2e-06
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 6e-05
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 6e-05
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 1e-04
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 1e-04
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure 
Iteration: 1

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 68/162 (41%), Gaps = 9/162 (5%)
Query: 90  SGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDLTTWEASSSVFVFNIISATWRRG 149
           S EW  LPP+P       LF  L  V  ++ V+ G DL T  +  SV  ++ ++A W   
Sbjct: 87  SSEWVGLPPLPS---ARCLF-GLGEVDDKIYVVAGKDLQTEASLDSVLCYDPVAAKWSEV 142
Query: 150 ADMPGGRRMLFGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWASLPDMSRERDEC 209
            ++P   ++        +  +Y  GG  +DK        Y+  + +W  L  M   R   
Sbjct: 143 KNLP--IKVYGHNVISHNGMIYCLGGKTDDKKCTNRVFIYNPKKGDWKDLAPMKTPRSMF 200
Query: 210 KAVFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEE 251
               H GK+++ GG + +         EAFD    +W  + E
Sbjct: 201 GVAIHKGKIVIAGGVTEDG---LSASVEAFDLKTNKWEVMTE 239
>pdb|2EIB|A Chain A, Crystal Structure Of Galactose Oxidase, W290h Mutant Length = 639 Back     alignment and structure
>pdb|2EID|A Chain A, Galactose Oxidase W290g Mutant Length = 639 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2EIC|A Chain A, Crystal Structure Of Galactose Oxidase Mutant W290f Length = 639 Back     alignment and structure
>pdb|2WQ8|A Chain A, Glycan Labelling Using Engineered Variants Of Galactose Oxidase Obtained By Directed Evolution Length = 661 Back     alignment and structure
>pdb|1T2X|A Chain A, Glactose Oxidase C383s Mutant Identified By Directed Evolution Length = 639 Back     alignment and structure
>pdb|2EIE|A Chain A, Crystal Structure Of Galactose Oxidase Complexed With Azide Length = 639 Back     alignment and structure
>pdb|1K3I|A Chain A, Crystal Structure Of The Precursor Of Galactose Oxidase Length = 656 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 5e-28
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 5e-23
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-22
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-05
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-27
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-22
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 3e-19
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-25
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-23
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 3e-19
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 3e-25
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-23
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 2e-23
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-14
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 4e-13
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 6e-25
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 9e-23
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 4e-22
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 8e-14
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 8e-12
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 6e-25
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 8e-25
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 8e-25
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 5e-12
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 2e-18
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 3e-15
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-11
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 8e-11
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-05
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-11
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-10
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 6e-09
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 4e-11
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 2e-06
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 2e-05
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 3e-04
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
 Score =  108 bits (272), Expect = 5e-28
 Identities = 37/179 (20%), Positives = 62/179 (34%), Gaps = 17/179 (9%)

Query: 90  SGEWSELPPIPGFPDGLP-LFCQLSAVGPELVVIGGLDLTTWEASSSVFVFNIISATWRR 148
              W+++                       + ++GG           +  +N++  +W  
Sbjct: 33  DYSWTDIRCPFE-----KRRDAACVFWDNVVYILGGSQ---LFPIKRMDCYNVVKDSWYS 84

Query: 149 GADMPGGRRMLFGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWASLPDMSRERDE 208
               P  R  L  CA++G   +Y +GG +   +AL     YD   + W + P M  +R  
Sbjct: 85  KLGPPTPRDSLAACAAEGK--IYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQRCS 142

Query: 209 CKAVFHCGKLLVIGGY-STNAQGRFERHAEAFDAAAQQWGPVEEDFMETATCPRSCAGV 266
              V   G + V GG    N  GR     E +D A + W  +    M      R   G+
Sbjct: 143 HGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCP--MIE---ARKNHGL 196
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.98
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.98
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.97
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.96
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.93
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.93
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.07
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.03
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.02
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.0
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.86
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.96
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 97.66
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.58
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.56
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.4
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.32
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.1
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.09
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.06
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.01
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.99
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.96
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.93
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.74
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.72
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 96.72
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.7
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.67
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 96.65
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.64
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 96.59
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.59
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.48
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.48
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.47
3jrp_A379 Fusion protein of protein transport protein SEC13 96.43
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.33
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.32
3jro_A 753 Fusion protein of protein transport protein SEC13 96.29
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.28
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.27
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 96.24
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.23
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.15
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.13
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.06
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 96.05
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 96.01
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.01
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.96
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.96
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.95
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.92
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.8
3ow8_A321 WD repeat-containing protein 61; structural genomi 95.79
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.75
3jro_A 753 Fusion protein of protein transport protein SEC13 95.72
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 95.72
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 95.69
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.6
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 95.56
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.54
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.5
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.49
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.48
2pm7_B297 Protein transport protein SEC13, protein transport 95.46
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.3
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.24
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 95.23
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.2
3v9f_A 781 Two-component system sensor histidine kinase/RESP 95.16
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 95.15
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 95.11
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 95.05
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.04
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.93
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.91
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.9
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.89
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 94.86
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 94.82
2fp8_A322 Strictosidine synthase; six bladed beta propeller 94.8
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.79
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.76
4a2l_A 795 BT_4663, two-component system sensor histidine kin 94.7
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 94.67
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 94.65
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.64
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.61
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 94.54
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 94.54
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 94.53
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 94.5
2pm7_B297 Protein transport protein SEC13, protein transport 94.43
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.41
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.37
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 94.35
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.18
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 94.06
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 94.01
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 93.95
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 93.94
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 93.84
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 93.82
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 93.8
4g56_B357 MGC81050 protein; protein arginine methyltransfera 93.77
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 93.7
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.69
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 93.52
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 93.51
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 93.51
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 93.51
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.43
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 93.36
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 93.34
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 93.2
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 93.17
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 93.06
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 92.99
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 92.95
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 92.94
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.86
3ott_A 758 Two-component system sensor histidine kinase; beta 92.85
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 92.85
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 92.81
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 92.63
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 92.51
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 92.31
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 92.3
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 92.22
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 92.2
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 92.16
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 91.94
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.91
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 91.88
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 91.76
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 91.65
2p4o_A306 Hypothetical protein; putative lactonase, structur 91.61
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 91.48
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 91.44
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.37
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.25
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 91.12
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 91.0
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 90.98
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 90.91
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 90.89
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 90.84
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 90.82
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 90.78
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 90.74
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 90.67
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 90.62
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 90.6
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 90.45
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 90.31
3ott_A 758 Two-component system sensor histidine kinase; beta 90.29
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 90.21
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 90.18
2fp8_A322 Strictosidine synthase; six bladed beta propeller 90.15
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 90.14
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 90.13
3v65_B 386 Low-density lipoprotein receptor-related protein; 90.13
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 90.1
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 90.08
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 89.95
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 89.85
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 89.81
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 89.75
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 89.6
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 89.34
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 89.34
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 89.29
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 89.29
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 89.24
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 89.04
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 89.01
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 88.8
3v65_B386 Low-density lipoprotein receptor-related protein; 88.44
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 88.43
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 88.23
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 88.07
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 88.03
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 87.97
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 87.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 87.79
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 87.68
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 87.66
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 87.39
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 86.91
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 86.76
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 86.67
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 86.61
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 86.52
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 86.46
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 86.42
2ymu_A577 WD-40 repeat protein; unknown function, two domain 86.26
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 86.01
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 85.81
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 84.96
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 84.94
2p4o_A306 Hypothetical protein; putative lactonase, structur 84.56
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 84.4
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 84.33
2xyi_A430 Probable histone-binding protein CAF1; transcripti 83.9
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 83.78
3p5b_L400 Low density lipoprotein receptor variant; B-propel 83.66
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 83.54
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 83.32
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 83.23
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 82.28
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 82.07
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 81.69
2ymu_A577 WD-40 repeat protein; unknown function, two domain 81.57
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 81.19
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 80.9
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1e-34  Score=242.27  Aligned_cols=187  Identities=22%  Similarity=0.347  Sum_probs=159.3

Q ss_pred             eeEEEEECCCCCeEeCCCCCCCCCCCCceeEEEEeCCEEEEEeCcCC-CCcccccceEEEEccCCeEEeCCCCCCCCccc
Q 048803           81 YRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDL-TTWEASSSVFVFNIISATWRRGADMPGGRRML  159 (289)
Q Consensus        81 ~~~~~~d~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~lyv~GG~~~-~~~~~~~~~~~yd~~t~~W~~~~~~~~~~~~~  159 (289)
                      ..+++||+.+++|+.++++|.++..+    ++++++++||++||.+. .+....+++++||+.+++|+.++++| .+|..
T Consensus        67 ~~~~~~d~~~~~W~~~~~~p~~r~~~----~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p-~~r~~  141 (315)
T 4asc_A           67 AYFLQFDHLDSEWLGMPPLPSPRCLF----GLGEALNSIYVVGGREIKDGERCLDSVMCYDRLSFKWGESDPLP-YVVYG  141 (315)
T ss_dssp             EEEEEEETTTTEEEECCCBSSCEESC----EEEEETTEEEEECCEESSTTCCBCCCEEEEETTTTEEEECCCCS-SCCBS
T ss_pred             cceEEecCCCCeEEECCCCCcchhce----eEEEECCEEEEEeCCcCCCCCcccceEEEECCCCCcEeECCCCC-Ccccc
Confidence            56999999999999999999988876    88899999999999753 22247889999999999999999999 56667


Q ss_pred             eeEEEecCCEEEEEcCCCCCCcccCceEEEEcCCCceEeCCCCCccccccceEEECCEEEEEeeecCCCCCcccceEEEE
Q 048803          160 FGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWASLPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAF  239 (289)
Q Consensus       160 ~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~l~~~gG~~~~~~~~~~~~v~~y  239 (289)
                      +++++ .+++||++||........+++++||+.+++|+.++++|.+|..+++++++++||++||.....   ..+.+++|
T Consensus       142 ~~~~~-~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~---~~~~~~~y  217 (315)
T 4asc_A          142 HTVLS-HMDLVYVIGGKGSDRKCLNKMCVYDPKKFEWKELAPMQTARSLFGATVHDGRIIVAAGVTDTG---LTSSAEVY  217 (315)
T ss_dssp             CEEEE-ETTEEEEECCBCTTSCBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEEEEECSSS---EEEEEEEE
T ss_pred             eeEEE-ECCEEEEEeCCCCCCcccceEEEEeCCCCeEEECCCCCCchhceEEEEECCEEEEEeccCCCC---ccceEEEE
Confidence            76666 599999999986555677899999999999999999999999999999999999999987542   56789999


Q ss_pred             ECCCCceeecccccccCCCCCCceeeeeCCeEEEEeCcee
Q 048803          240 DAAAQQWGPVEEDFMETATCPRSCAGVDSNDLYMCREGDV  279 (289)
Q Consensus       240 d~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~ly~~GG~~~  279 (289)
                      |+++++|+.++.+  +.. +..++++..+++||++||.+.
T Consensus       218 d~~~~~W~~~~~~--p~~-r~~~~~~~~~~~l~v~GG~~~  254 (315)
T 4asc_A          218 SITDNKWAPFEAF--PQE-RSSLSLVSLVGTLYAIGGFAT  254 (315)
T ss_dssp             ETTTTEEEEECCC--SSC-CBSCEEEEETTEEEEEEEEEE
T ss_pred             ECCCCeEEECCCC--CCc-ccceeEEEECCEEEEECCccc
Confidence            9999999999874  333 334467778999999999753
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 289
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-11
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 6e-09
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-10
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-06
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-05
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-05
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 5e-05
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 2e-04
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 3e-04
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 0.003
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: Galactose oxidase, central domain
family: Galactose oxidase, central domain
domain: Galactose oxidase, central domain
species: Fungi (Fusarium sp.) [TaxId: 29916]

 Score = 61.4 bits (147), Expect = 2e-11
 Identities = 34/205 (16%), Positives = 66/205 (32%), Gaps = 18/205 (8%)

Query: 84  TVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDLTTWEAS----SSVFVF 139
           T  + G G W     +P  P        +      +++        +  S    +    +
Sbjct: 2   TAPQPGLGRWGPTIDLPIVP----AAAAIEPTSGRVLMWSSYRNDAFGGSPGGITLTSSW 57

Query: 140 NIISATWRRGADMPGGRRML-FGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWAS 198
           +  +              M   G + DG+  + V GG+D      K    YD + D W  
Sbjct: 58  DPSTGIVSDRTVTVTKHDMFCPGISMDGNGQIVVTGGNDA-----KKTSLYDSSSDSWIP 112

Query: 199 LPDMSRERDECKAVFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEEDFMETAT 258
            PDM   R    +        V     + + G FE++ E +  +++ W  +    +    
Sbjct: 113 GPDMQVARGYQSSATMSDG-RVFTIGGSWSGGVFEKNGEVYSPSSKTWTSLPNAKVNPML 171

Query: 259 CPRSCAGVDSND---LYMCREGDVM 280
                    S++   L+  ++G V 
Sbjct: 172 TADKQGLYRSDNHAWLFGWKKGSVF 196
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.96
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.96
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 99.92
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 99.85
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.76
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.66
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.47
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.51
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.47
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.35
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.28
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.59
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 95.18
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.15
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.87
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 94.73
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 94.62
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.6
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 94.11
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 93.93
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 93.61
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 93.58
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 93.3
d1tbga_340 beta1-subunit of the signal-transducing G protein 93.16
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.33
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 91.68
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 91.62
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 91.56
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 91.54
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 91.43
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.27
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 91.05
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 91.01
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 90.68
d1tbga_340 beta1-subunit of the signal-transducing G protein 90.59
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 90.35
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.33
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 89.81
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 89.31
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 89.31
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 89.14
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 88.48
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 88.17
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 86.87
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 86.49
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 86.24
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 85.93
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 85.91
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 85.17
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 84.12
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 83.19
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 82.59
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 81.64
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 80.95
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=1e-27  Score=195.08  Aligned_cols=202  Identities=20%  Similarity=0.276  Sum_probs=164.8

Q ss_pred             CCeEEEEeeeeccccCCCCCCCCCCCceeEEEEECCCCCeEeCCCCCCCCCCCCceeEEEEeCCEEEEEeCcCCC--Ccc
Q 048803           54 EQLLFMTQARVDQSRKSGVPKRFATPVYRITVLELGSGEWSELPPIPGFPDGLPLFCQLSAVGPELVVIGGLDLT--TWE  131 (289)
Q Consensus        54 ~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~lyv~GG~~~~--~~~  131 (289)
                      +..+|++|+...            ++...+++||+.+++|++++++|.+|..+    ++++++++|||+||....  +..
T Consensus         4 g~~iyv~GG~~~------------~~~~~~~~yd~~t~~W~~~~~~p~~R~~~----~~~~~~~~iyv~GG~~~~~~~~~   67 (288)
T d1zgka1           4 GRLIYTAGGYFR------------QSLSYLEAYNPSNGTWLRLADLQVPRSGL----AGCVVGGLLYAVGGRNNSPDGNT   67 (288)
T ss_dssp             CCCEEEECCBSS------------SBCCCEEEEETTTTEEEECCCCSSCCBSC----EEEEETTEEEEECCEEEETTEEE
T ss_pred             CCEEEEECCcCC------------CCCceEEEEECCCCeEEECCCCCCcccee----EEEEECCEEEEEeCcccCCCCcc
Confidence            456777776532            12367899999999999999999998876    888999999999997422  224


Q ss_pred             cccceEEEEccCCeEEeCCCCCCCCccceeEEEecCCEEEEEcCCCCCCcccCceEEEEcCCCceEeCCCCCccccccce
Q 048803          132 ASSSVFVFNIISATWRRGADMPGGRRMLFGCASDGDRTVYVAGGHDEDKNALKSAMAYDVARDEWASLPDMSRERDECKA  211 (289)
Q Consensus       132 ~~~~~~~yd~~t~~W~~~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~~~~~~~~~~  211 (289)
                      .++++++||+.+++|+.+++++ .+|..+++++ .+++||++||.... ...+.++.||+.++.|...+.++.+|..+++
T Consensus        68 ~~~~~~~yd~~~~~w~~~~~~p-~~r~~~~~~~-~~~~i~~~gg~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~  144 (288)
T d1zgka1          68 DSSALDCYNPMTNQWSPCAPMS-VPRNRIGVGV-IDGHIYAVGGSHGC-IHHNSVERYEPERDEWHLVAPMLTRRIGVGV  144 (288)
T ss_dssp             ECCCEEEEETTTTEEEECCCCS-SCCBTCEEEE-ETTEEEEECCEETT-EECCCEEEEETTTTEEEECCCCSSCCBSCEE
T ss_pred             ccchhhhccccccccccccccc-ceecceeccc-cceeeEEecceecc-cccceeeeeccccCcccccccccccccccee
Confidence            5789999999999999999999 5677777776 49999999998654 4567899999999999999999999999999


Q ss_pred             EEECCEEEEEeeecCCCCCcccceEEEEECCCCceeecccccccCCCCCCceeeeeCCeEEEEeCceee
Q 048803          212 VFHCGKLLVIGGYSTNAQGRFERHAEAFDAAAQQWGPVEEDFMETATCPRSCAGVDSNDLYMCREGDVM  280 (289)
Q Consensus       212 ~~~~~~l~~~gG~~~~~~~~~~~~v~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~ly~~GG~~~~  280 (289)
                      ++.+++++++||.....   ....++.||+.+++|........   ....++++..+++|+++||.+..
T Consensus       145 ~~~~~~~~~~GG~~~~~---~~~~~~~~d~~~~~~~~~~~~~~---~~~~~~~~~~~~~i~i~GG~~~~  207 (288)
T d1zgka1         145 AVLNRLLYAVGGFDGTN---RLNSAECYYPERNEWRMITAMNT---IRSGAGVCVLHNCIYAAGGYDGQ  207 (288)
T ss_dssp             EEETTEEEEECCBCSSC---BCCCEEEEETTTTEEEECCCCSS---CCBSCEEEEETTEEEEECCBCSS
T ss_pred             eeeeecceEecCccccc---ccceEEEeecccccccccccccc---ccccccccceeeeEEEecCcccc
Confidence            99999999999986533   45679999999999999887432   23344677789999999996643
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure