Citrus Sinensis ID: 048823

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------70
MATHNLNINISGRLTRHFFTPLLFIWAAPTRAGTRTRTRVLPIRCYLRRASNFSRRFSVVPSAASASGSPEWNIDERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGLTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMCCYLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDKGFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLMTKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLIDDLVTKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEKRRLKTVRISGGDLAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDKHGFGNGLLSRAEKQCVEIDIKYEGFIVRQQSQLQQMVHQQHRPLPPDLDYYAMTTLSLESREKLSKVRPQTIGQASRVGGVSPADITALLIILEANRRKAQEQMRHQVLASVRADSNQQSEGPLTETISS
cccccEEEEEEccccccccccEEEccccccccccccccccccccccEEcccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccHHcccccHHHHHHHHHHHHHHHHcccccHHcccHHHHHHHHHHHHHHHHHHHcccccEEEEcccEEEEEccccEEEEEEEccccEEEccEEEEccccccccEEEEEcccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccEEcccccccccccccccccccccHHHHHHHHHccccccccccccccEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEccccccEEEEEEccccccccccccccccHHHHHHHHcccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccHHHHHccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccccccccccc
ccccccEEEEcccccHccccHHEEEcccccHcccccccEEEEEEEEEEEccccccEEccccccHHHcccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEcHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHEEEccccEEEEEEEEccEEEEccEEEEEEccccccEEEEEcccccccccccHHHHHHHHHHHHccccccEEcccccccccccEEEccccEcccccccccEEEEcccHccccccccEEEEEccHHHHHHHHccccccccccEEEEccccccccccccccccccccHHHHHHHHHccccccccEEEccccEEEEEccccccccccHcHccccccEEEccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEHHHHccccccccEEcccHHHHHHHHHHccccccccHHHcEcccccHHHHHHHHHHHHHHHHHHHHHHccEccccHHHHHHHHHHcccccccccHHHHHccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEccc
mathnlninisgrltrhfftpllfiwaaptragtrtrtrvlpiRCYLRrasnfsrrfsvvpsaasasgspewniderFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDkiawqpcnpavggpaksQLVHEVDALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVTDIllgkndnvegvctffgmnfyapsvvlttgtfmsgkiwvgrtsmpagragesashgLTENLQRLgfetdrlktgtpsrvdlrtvdfsglepqhgdeevswfsfdpdfhiEREQMCCYLTRTTKRTHQLIKdnlhetptyggwveakgprycpaiedkgfstglperlqlpllrtlpglencsmlrpayaveydylpahqCYRSLMTKKVEGLffsgqingttgYEEAAAQGIISGInaarhsdgksLIVLERESSYVGTLIDDLVTKDLREPYRMLTSRSEHRlllrsdnadsrltplgrelglidDRRWKVYQDKLARVSEEKRRLKTVRIsggdlaadvtrlsgqpvkdsstlesllkkphiQYEILdkhgfgngllsRAEKQCVEIDIKYEGFIVRQQSQLQQMVHQqhrplppdldyyaMTTLSLESREKlskvrpqtigqasrvggvspaDITALLIILEANRRKAQEQMRHQVLASVradsnqqsegpltetiss
mathnlninisgrltrHFFTPLLFIwaaptragtrtrtrvlpiRCYLrrasnfsrrfsvvpsaasasgspewniDERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADMCYLQKRvlntsrgpavwALRAQTDKREYAMRMKNIVESTANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGLTENLQRLgfetdrlktgtpsrvdlrtvdfsglepqhgdeevSWFSFDPDFHIEREQMCCYLTRTTKRTHQLikdnlhetptyggwveAKGPRYCPAIEDKGFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLMTKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLeressyvgtliddlvtkdlrePYRMltsrsehrlllrsdnadsrltplgrelgliddrrwKVYQDklarvseekrrlktvrisggdlaadvtrlsgqpvkdsstlesLLKKPHIQYEILDKHGFGNGLLSRAEKQCVEIDIKYEGFIVRQQSQLQQMVHQQHRPLPPDLDYYAMTTLSLESreklskvrpqtigqasrvggvspaDITALLIILEANRRKAQEQMRHQVLAsvradsnqqsegpltetiss
MATHNLNINISGRLTRHFFTPLLFIWaaptragtrtrtrVLPIRCYLRRASNFSRRFsvvpsaasasgspEWNIDERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGLTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMCCYLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDKGFStglperlqlpllrtlpgleNCSMLRPAYAVEYDYLPAHQCYRSLMTKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLIDDLVTKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEKRRLKTVRISGGDLAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDKHGFGNGLLSRAEKQCVEIDIKYEGFIVRqqsqlqqmvhqqHRPLPPDLDYYAMTTLSLESREKLSKVRPQTIGQASRVGGVSPADITALLIILEANRRKAQEQMRHQVLASVRADSNQQSEGPLTETISS
*****LNINISGRLTRHFFTPLLFIWAAPTRAGTRTRTRVLPIRCYLRRASNFSRRFSVV**********EWNIDERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGR******************************************V*F*********EEVSWFSFDPDFHIEREQMCCYLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDKGFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLMTKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLIDDLVTKDLREPYRML*******************TPLGRELGLIDDRRWKVYQDKLARV********TVRI*************************LLKKPHIQYEILDKHGFGNGLLSRAEKQCVEIDIKYEGFIVRQQS****************LDYYAMTTL*********************VGGVSPADITALLIILEA***********************************
***HNLNINISGRLTRHFFTPLLFIWAA****************CYLRRASNFSRR***************WNIDERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGLTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMCCYLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDKGFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLMTKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLIDDLVTKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEKRRLKTVRISGGDLAADV********KDSSTLESLLKKPHIQYEILDKHGFGNGLLSRAEKQCVEIDIKYEGFIVRQQSQLQQMVHQQHRPLPPDLDYYAMTTLSLESREKLSKVRPQTIGQASRVGGVSPADITALLI***************************************
MATHNLNINISGRLTRHFFTPLLFIWAAPTRAGTRTRTRVLPIRCYLRRASNFSRRFS***********PEWNIDERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGLTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMCCYLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDKGFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLMTKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLIDDLVTKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEKRRLKTVRISGGDLAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDKHGFGNGLLSRAEKQCVEIDIKYEGFIVRQQ**********HRPLPPDLDYYAMTTLSLESREKLSKVRPQTIGQASRVGGVSPADITALLIILEANR*********QVLAS*******************
****NLNINISGRLTRHFFTPLLFIWAAPTRAGTRTRTRVLPIRCYLRRASNFSRRFSVVPSAASASGSPEWNIDERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGLTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMCCYLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDKGFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLMTKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLIDDLVTKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEKRRLKTVRISGGDLAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDKHGFGNGLLSRAEKQCVEIDIKYEGFIVRQQSQLQQMVHQQHRPLPPDLDYYAMTTLSLESREKLSKVRPQTIGQASRVGGVSPADITALLIILEANRRKAQE****************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATHNLNINISGRLTRHFFTPLLFIWAAPTRAGTRTRTRVLPIRCYLRRASNFSRRFSVVPSAASASGSPEWNIDERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGLTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMCCYLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDKGFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLMTKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLIDDLVTKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEKRRLKTVRISGGDLAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDKHGFGNGLLSRAEKQCVEIDIKYEGFIVRQQSQLQQMVHQQHRPLPPDLDYYAMTTLSLESREKLSKVRPQTIGQASRVGGVSPADITALLIILEANRRKAQEQMRHQVLASVRADSNQQSEGPLTETISS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query699 2.2.26 [Sep-21-2011]
Q55694635 tRNA uridine 5-carboxymet N/A no 0.849 0.935 0.657 0.0
Q3M790640 tRNA uridine 5-carboxymet yes no 0.848 0.926 0.657 0.0
Q8YR87640 tRNA uridine 5-carboxymet yes no 0.852 0.931 0.653 0.0
B0JGQ4635 tRNA uridine 5-carboxymet yes no 0.854 0.940 0.649 0.0
Q110Q9637 tRNA uridine 5-carboxymet yes no 0.856 0.940 0.634 0.0
B1XJY4639 tRNA uridine 5-carboxymet yes no 0.852 0.932 0.640 0.0
Q31KG6635 tRNA uridine 5-carboxymet yes no 0.854 0.940 0.647 0.0
Q5N1E7635 tRNA uridine 5-carboxymet yes no 0.854 0.940 0.646 0.0
Q2JXG8643 tRNA uridine 5-carboxymet yes no 0.852 0.926 0.645 0.0
Q8DLF8637 tRNA uridine 5-carboxymet yes no 0.851 0.934 0.635 0.0
>sp|Q55694|MNMG_SYNY3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mnmG PE=3 SV=1 Back     alignment and function desciption
 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/622 (65%), Positives = 484/622 (77%), Gaps = 28/622 (4%)

Query: 76  ERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVD 135
           ++FDVIVVG GHAGCEAALA+ARLG +TLLLTLN+D+IAWQPCNPAVGGPAKSQL HEVD
Sbjct: 11  DQFDVIVVGAGHAGCEAALATARLGCRTLLLTLNLDRIAWQPCNPAVGGPAKSQLTHEVD 70

Query: 136 ALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAM 195
           ALGGEIGK+AD  YLQKRVLN SRGPAVWALRAQTDKREYA  MKNIVE+  NL IRE M
Sbjct: 71  ALGGEIGKMADRTYLQKRVLNISRGPAVWALRAQTDKREYAAVMKNIVENQPNLSIREGM 130

Query: 196 VTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGL 255
           VTD++LG ND ++GV T+FG  F A SVV+TTGTF+ GKIW+G  SMPAGRAGE A+ GL
Sbjct: 131 VTDLVLGDNDEIQGVQTYFGACFGAQSVVITTGTFLGGKIWIGNKSMPAGRAGEFAAVGL 190

Query: 256 TENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMCCY 315
           TE L  LGFET RLKTGTP+RVD R+VD+  LEPQ  DE+VSWFSFDP+  +EREQM CY
Sbjct: 191 TETLNELGFETGRLKTGTPARVDRRSVDYDKLEPQPPDEQVSWFSFDPEVWVEREQMNCY 250

Query: 316 LTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDK-------------------- 355
           LTRTT +THQLIKDNLH +P YGG++++KGPRYCP+IEDK                    
Sbjct: 251 LTRTTAKTHQLIKDNLHLSPIYGGFIDSKGPRYCPSIEDKIVRFADKESHQIFIEPEGRD 310

Query: 356 -------GFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLMTKKVE 408
                  GFSTGLPE +QL +L+TLPGLENC MLRPAYAVEYD+LPA QCY SLMTKKV 
Sbjct: 311 IPELYIQGFSTGLPENVQLAMLQTLPGLENCVMLRPAYAVEYDFLPATQCYPSLMTKKVA 370

Query: 409 GLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLIDDLVTKDLR 468
           GLF +GQINGTTGYEEAAAQG+++GINAARH  GKSLI+  RE SY+GTLIDDL TKDLR
Sbjct: 371 GLFCAGQINGTTGYEEAAAQGLVAGINAARHCQGKSLIIFSREGSYLGTLIDDLCTKDLR 430

Query: 469 EPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEKRRLKTV 528
           EPYRMLTSRSE+RL+LRSDNAD RLTPLGRE+GLIDDRRW ++Q K A ++ EK RL + 
Sbjct: 431 EPYRMLTSRSEYRLILRSDNADQRLTPLGREIGLIDDRRWDLFQTKQANITAEKERLYST 490

Query: 529 RISGGD-LAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDKHGFGNGLLSRAEKQCVEI 587
           RI   D +  ++   + Q +K S  L  LL++P   Y  L+K   GN  L   EK  VEI
Sbjct: 491 RIKEQDAVGKEIVDYTQQKIKGSIVLAELLRRPGFHYPDLEKFQLGNEELKPEEKTSVEI 550

Query: 588 DIKYEGFIVRQQSQLQQMVHQQHRPLPPDLDYYAMTTLSLESREKLSKVRPQTIGQASRV 647
           +IKY G+I RQQ+Q++Q+     + LPP L+Y A+ TLS+E+REKL++ +P TIGQA R+
Sbjct: 551 EIKYSGYIKRQQTQIEQVSRHSQKRLPPGLNYMAIETLSMEAREKLTQFQPLTIGQAGRI 610

Query: 648 GGVSPADITALLIILEANRRKA 669
           GGV+PADI ALL+ LE   R++
Sbjct: 611 GGVNPADINALLVYLETQLRRS 632
NAD-binding protein involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain tRNAs, forming tRNA-cmnm(5)s(2)U34.
Synechocystis sp. (strain PCC 6803 / Kazusa) (taxid: 1111708)
>sp|Q3M790|MNMG_ANAVT tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|Q8YR87|MNMG_NOSS1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|B0JGQ4|MNMG_MICAN tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Microcystis aeruginosa (strain NIES-843) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|Q110Q9|MNMG_TRIEI tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Trichodesmium erythraeum (strain IMS101) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|B1XJY4|MNMG_SYNP2 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|Q31KG6|MNMG_SYNE7 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Synechococcus elongatus (strain PCC 7942) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|Q5N1E7|MNMG_SYNP6 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|Q2JXG8|MNMG_SYNJA tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Synechococcus sp. (strain JA-3-3Ab) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|Q8DLF8|MNMG_THEEB tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Thermosynechococcus elongatus (strain BP-1) GN=mnmG PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query699
359477001722 PREDICTED: tRNA uridine 5-carboxymethyla 0.969 0.939 0.796 0.0
449451193730 PREDICTED: tRNA uridine 5-carboxymethyla 0.975 0.934 0.789 0.0
449493251730 PREDICTED: LOW QUALITY PROTEIN: tRNA uri 0.975 0.934 0.791 0.0
357520027727 tRNA uridine 5-carboxymethylaminomethyl 0.929 0.894 0.817 0.0
356512856724 PREDICTED: tRNA uridine 5-carboxymethyla 0.957 0.924 0.787 0.0
356526872719 PREDICTED: tRNA uridine 5-carboxymethyla 0.984 0.956 0.775 0.0
15225046723 glucose-inhibited division family A prot 0.874 0.845 0.818 0.0
297835986730 glucose-inhibited division family A prot 0.874 0.836 0.817 0.0
293334449710 uncharacterized protein LOC100383575 [Ze 0.947 0.932 0.744 0.0
242059989713 hypothetical protein SORBIDRAFT_03g04656 0.872 0.855 0.789 0.0
>gi|359477001|ref|XP_002264011.2| PREDICTED: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1154 bits (2986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/719 (79%), Positives = 622/719 (86%), Gaps = 41/719 (5%)

Query: 13  RLTRHFFTPLLF-----IWAAPTRAGTRTRTRVLPIRCYLRRASNFSRRFSVVPSAASAS 67
           RL RHF  P LF     I + P    +R + R        R  + F+  F+V  ++A+  
Sbjct: 7   RLPRHFPFPSLFPRFPRILSNPCHLTSRRKPR--------RTFTFFTCNFTVAATSATYG 58

Query: 68  GSPEWNID-ERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPA 126
            +     D ER+DVIVVGGGHAGCEAALASARLGAKTLLLTLNID+IAWQPCNPAVGGPA
Sbjct: 59  RNDNVGADNERYDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDRIAWQPCNPAVGGPA 118

Query: 127 KSQLVHEVDALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVEST 186
           KSQLVHEVDALGGEIGKVAD CYLQKRVLN SRGPAV ALRAQTDKR+YA++MKNIVES 
Sbjct: 119 KSQLVHEVDALGGEIGKVADRCYLQKRVLNISRGPAVRALRAQTDKRDYALQMKNIVESC 178

Query: 187 ANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGR 246
            NL IREAMVTDILLGKNDNVEGV TFFGM+FYAPSV+LTTGTFMSGKIWVGRTSMPAGR
Sbjct: 179 PNLSIREAMVTDILLGKNDNVEGVRTFFGMDFYAPSVILTTGTFMSGKIWVGRTSMPAGR 238

Query: 247 AGESASHGLTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFH 306
           AGESASHGLTENLQRLGFETDRLKTGTP+RVD RTVDFSGLEPQHGDEEVSWFSFDPDFH
Sbjct: 239 AGESASHGLTENLQRLGFETDRLKTGTPARVDCRTVDFSGLEPQHGDEEVSWFSFDPDFH 298

Query: 307 IEREQMCCYLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDK----------- 355
           IEREQMCCYLTRTTK THQLIK+NLHETPTYGGWVEAKGPRYCP+IEDK           
Sbjct: 299 IEREQMCCYLTRTTKSTHQLIKENLHETPTYGGWVEAKGPRYCPSIEDKIVRFQDKESHQ 358

Query: 356 ----------------GFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCY 399
                           GFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYD+LPA+QC 
Sbjct: 359 IFLEPEGRNVPELYVQGFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDFLPAYQCS 418

Query: 400 RSLMTKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLI 459
           RSLMTK++EGLFFSGQINGTTGYEEAAAQG+ISGINAAR+SDGKSLIVLERESSY+GTLI
Sbjct: 419 RSLMTKQIEGLFFSGQINGTTGYEEAAAQGLISGINAARYSDGKSLIVLERESSYIGTLI 478

Query: 460 DDLVTKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVS 519
           DDLVTKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGRE+GLIDDRRWK+YQDK A++S
Sbjct: 479 DDLVTKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGREIGLIDDRRWKIYQDKQAQIS 538

Query: 520 EEKRRLKTVRISGGDLAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDKHGFGNGLLSR 579
           +EK+RL+TVRISGGDLA+DVT LSGQPVKDSSTLES+LKKPH+QY++LDKHGFGN LLS+
Sbjct: 539 QEKKRLRTVRISGGDLASDVTHLSGQPVKDSSTLESILKKPHVQYKVLDKHGFGNELLSK 598

Query: 580 AEKQCVEIDIKYEGFIVRQQSQLQQMVHQQHRPLPPDLDYYAMTTLSLESREKLSKVRPQ 639
            EK+CVEIDIKYEGFI+RQQSQLQQM  QQHRPLP DLDYYAMTTLSLE+REKLSK+RPQ
Sbjct: 599 IEKECVEIDIKYEGFIMRQQSQLQQMARQQHRPLPEDLDYYAMTTLSLEAREKLSKIRPQ 658

Query: 640 TIGQASRVGGVSPADITALLIILEANRRKAQEQMRHQVLASVRADSNQQSEGPLTETIS 698
           TIGQASRVGGVSPADITALLIILE NRRKAQEQ R Q+L SV  D ++    PL ET++
Sbjct: 659 TIGQASRVGGVSPADITALLIILETNRRKAQEQRRCQLLTSVMVDQDKCITAPLPETLN 717

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449451193|ref|XP_004143346.1| PREDICTED: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449493251|ref|XP_004159235.1| PREDICTED: LOW QUALITY PROTEIN: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357520027|ref|XP_003630302.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme mnmG [Medicago truncatula] gi|355524324|gb|AET04778.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme mnmG [Medicago truncatula] Back     alignment and taxonomy information
>gi|356512856|ref|XP_003525131.1| PREDICTED: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG-like [Glycine max] Back     alignment and taxonomy information
>gi|356526872|ref|XP_003532040.1| PREDICTED: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG-like [Glycine max] Back     alignment and taxonomy information
>gi|15225046|ref|NP_178974.1| glucose-inhibited division family A protein [Arabidopsis thaliana] gi|4733959|gb|AAD28643.1| similar to glucose inhibited division protein A from prokaryotes [Arabidopsis thaliana] gi|330251139|gb|AEC06233.1| glucose-inhibited division family A protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297835986|ref|XP_002885875.1| glucose-inhibited division family A protein [Arabidopsis lyrata subsp. lyrata] gi|297331715|gb|EFH62134.1| glucose-inhibited division family A protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|293334449|ref|NP_001169694.1| uncharacterized protein LOC100383575 [Zea mays] gi|224030947|gb|ACN34549.1| unknown [Zea mays] gi|414878624|tpg|DAA55755.1| TPA: hypothetical protein ZEAMMB73_848392 [Zea mays] Back     alignment and taxonomy information
>gi|242059989|ref|XP_002459140.1| hypothetical protein SORBIDRAFT_03g046560 [Sorghum bicolor] gi|241931115|gb|EES04260.1| hypothetical protein SORBIDRAFT_03g046560 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query699
TAIR|locus:2060326723 AT2G13440 [Arabidopsis thalian 0.402 0.388 0.879 3.9e-267
UNIPROTKB|Q746Q4627 mnmG "tRNA uridine 5-carboxyme 0.399 0.444 0.526 7.4e-137
TIGR_CMR|GSU_3464627 GSU_3464 "glucose inhibited di 0.399 0.444 0.526 7.4e-137
UNIPROTKB|Q81JH3629 mnmG "tRNA uridine 5-carboxyme 0.394 0.438 0.485 4.1e-134
TIGR_CMR|BA_5733629 BA_5733 "glucose-inhibited div 0.394 0.438 0.485 4.1e-134
UNIPROTKB|Q3AG55631 mnmG "tRNA uridine 5-carboxyme 0.394 0.437 0.514 1.1e-131
TIGR_CMR|CHY_0007631 CHY_0007 "glucose inhibited di 0.394 0.437 0.514 1.1e-131
UNIPROTKB|Q71VV1632 mnmG "tRNA uridine 5-carboxyme 0.393 0.435 0.498 3.7e-131
UNIPROTKB|Q8E8A9629 mnmG "tRNA uridine 5-carboxyme 0.399 0.443 0.5 6.1e-131
TIGR_CMR|SO_4758629 SO_4758 "glucose-inhibited div 0.399 0.443 0.5 6.1e-131
TAIR|locus:2060326 AT2G13440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1336 (475.4 bits), Expect = 3.9e-267, Sum P(2) = 3.9e-267
 Identities = 247/281 (87%), Positives = 263/281 (93%)

Query:    75 DERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEV 134
             D  +DVIVVG GHAGCEAALASARLGA TLLLTLN+D+IAWQPCNPAVGGPAKSQLVHEV
Sbjct:    70 DSTYDVIVVGAGHAGCEAALASARLGASTLLLTLNLDRIAWQPCNPAVGGPAKSQLVHEV 129

Query:   135 DALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREA 194
             DALGG+IGKVAD CYLQKR+LN SRGPAV +LRAQTDKREYA  MK IV+ST NLCIREA
Sbjct:   130 DALGGDIGKVADRCYLQKRILNVSRGPAVRSLRAQTDKREYATEMKKIVDSTENLCIREA 189

Query:   195 MVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHG 254
             MVTDI++GKNDNVEGV TFFGMNFYAPSV+LTTGTFMSGKIWVG+ SMPAGRAGESAS G
Sbjct:   190 MVTDIIVGKNDNVEGVATFFGMNFYAPSVILTTGTFMSGKIWVGKKSMPAGRAGESASQG 249

Query:   255 LTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMCC 314
             LTENLQ+LGFETDRLKTGTP+RVD RT+DFS LE QHGDEEVSWFSFDPDFHIEREQMCC
Sbjct:   250 LTENLQKLGFETDRLKTGTPARVDRRTIDFSNLEAQHGDEEVSWFSFDPDFHIEREQMCC 309

Query:   315 YLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDK 355
             YLTRTTK THQLI+DNLHETPTYGGWVEAKGPRYCP+IEDK
Sbjct:   310 YLTRTTKITHQLIRDNLHETPTYGGWVEAKGPRYCPSIEDK 350
GO:0002098 "tRNA wobble uridine modification" evidence=IEA
GO:0008033 "tRNA processing" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
UNIPROTKB|Q746Q4 mnmG "tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3464 GSU_3464 "glucose inhibited division protein A" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q81JH3 mnmG "tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5733 BA_5733 "glucose-inhibited division protein A" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q3AG55 mnmG "tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0007 CHY_0007 "glucose inhibited division protein A" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q71VV1 mnmG "tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
UNIPROTKB|Q8E8A9 mnmG "tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4758 SO_4758 "glucose-inhibited division protein A" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q317W7MNMG_PROM9No assigned EC number0.53210.85400.9018yesno
A3PFG3MNMG_PROM0No assigned EC number0.53370.85400.9045yesno
Q0I6D8MNMG_SYNS3No assigned EC number0.57770.85260.9183yesno
Q7TU19MNMG_PROMPNo assigned EC number0.52110.85550.9143yesno
Q5N1E7MNMG_SYNP6No assigned EC number0.64600.85400.9401yesno
Q2JXG8MNMG_SYNJANo assigned EC number0.64530.85260.9269yesno
B0BZY6MNMG_ACAM1No assigned EC number0.64770.84120.9259yesno
Q7U3P8MNMG_SYNPXNo assigned EC number0.57920.84970.9266yesno
B0K5N3MNMG_THEPXNo assigned EC number0.47120.84540.9336yesno
Q814F7MNMG_BACCRNo assigned EC number0.45740.84690.9411yesno
A2BTQ6MNMG_PROMSNo assigned EC number0.53530.85400.9114yesno
Q49UI5MNMG_STAS1No assigned EC number0.46060.83690.936yesno
Q7TUJ1MNMG_PROMMNo assigned EC number0.56760.84830.9081yesno
B2A469MNMG_NATTJNo assigned EC number0.45650.84120.9130yesno
Q6HAF3MNMG_BACHKNo assigned EC number0.45540.83970.9332yesno
A2C5E1MNMG_PROM1No assigned EC number0.56820.84970.9054yesno
A5GPI1MNMG_SYNPWNo assigned EC number0.56760.85830.9104yesno
A4XN50MNMG_CALS8No assigned EC number0.46530.84540.9440yesno
Q31KG6MNMG_SYNE7No assigned EC number0.64760.85400.9401yesno
Q3AUG9MNMG_SYNS9No assigned EC number0.57370.84830.9251yesno
Q8YR87MNMG_NOSS1No assigned EC number0.65380.85260.9312yesno
B0JGQ4MNMG_MICANNo assigned EC number0.64960.85400.9401yesno
Q8RAT8MNMG1_THETNNo assigned EC number0.46970.84830.9368yesno
Q2JI26MNMG_SYNJBNo assigned EC number0.64570.84830.9222yesno
A3DHY7MNMG_CLOTHNo assigned EC number0.46300.84400.9365yesno
O32806MNMG_LACLMNo assigned EC number0.440.84400.944yesno
A2CDR8MNMG_PROM3No assigned EC number0.57230.84830.9081yesno
Q9CEJ4MNMG_LACLANo assigned EC number0.43820.84690.9472yesno
A4ITX0MNMG_GEOTNNo assigned EC number0.46670.83970.9332yesno
Q67J34MNMG_SYMTHNo assigned EC number0.48060.84120.9333yesno
A2BZ61MNMG_PROM5No assigned EC number0.54380.84120.8990yesno
Q46IB4MNMG_PROMTNo assigned EC number0.56820.84970.9054yesno
A4J9S0MNMG_DESRMNo assigned EC number0.48300.83970.9317yesno
A5GWP3MNMG_SYNR3No assigned EC number0.58370.84970.9237yesno
Q55694MNMG_SYNY3No assigned EC number0.65750.84970.9354N/Ano
Q02X03MNMG_LACLSNo assigned EC number0.440.84400.944yesno
Q5KU58MNMG_GEOKANo assigned EC number0.46760.83830.9316yesno
Q3AGK9MNMG_SYNSCNo assigned EC number0.57500.85120.9253yesno
Q3M790MNMG_ANAVTNo assigned EC number0.65700.84830.9265yesno
B0K8H8MNMG_THEP3No assigned EC number0.47120.84540.9336yesno
B0TAB5MNMG_HELMINo assigned EC number0.47120.84400.9262yesno
Q8DLF8MNMG_THEEBNo assigned EC number0.63560.85120.9340yesno
Q110Q9MNMG_TRIEINo assigned EC number0.63470.85690.9403yesno
B1XJY4MNMG_SYNP2No assigned EC number0.64080.85260.9327yesno
A8G7I0MNMG_PROM2No assigned EC number0.53840.84970.9068yesno
Q7NM86MNMG_GLOVINo assigned EC number0.61230.82830.8826yesno
Q7V9J7MNMG_PROMANo assigned EC number0.55090.87830.9205yesno
A5CY45MNMG_PELTSNo assigned EC number0.48390.84830.9397yesno
Q630B9MNMG_BACCZNo assigned EC number0.45700.83970.9332yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
PRK05192618 PRK05192, PRK05192, tRNA uridine 5-carboxymethylam 0.0
COG0445621 COG0445, GidA, Flavin-dependent tRNA uridine 5-car 0.0
TIGR00136617 TIGR00136, gidA, glucose-inhibited division protei 0.0
pfam01134391 pfam01134, GIDA, Glucose inhibited division protei 0.0
pfam1393272 pfam13932, GIDA_assoc_3, GidA associated domain 3 9e-29
PRK05335436 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransfe 3e-14
COG1206439 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly i 1e-12
TIGR00137433 TIGR00137, gid_trmFO, tRNA:m(5)U-54 methyltransfer 5e-12
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 3e-07
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 3e-05
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 9e-05
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 1e-04
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate 1e-04
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 3e-04
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 3e-04
PRK08274466 PRK08274, PRK08274, tricarballylate dehydrogenase; 9e-04
COG2081408 COG2081, COG2081, Predicted flavoproteins [General 0.001
PLN02785587 PLN02785, PLN02785, Protein HOTHEAD 0.002
PRK07121492 PRK07121, PRK07121, hypothetical protein; Validate 0.002
PRK12843578 PRK12843, PRK12843, putative FAD-binding dehydroge 0.002
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase 0.003
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, larg 0.004
PRK07804541 PRK07804, PRK07804, L-aspartate oxidase; Provision 0.004
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase sub 0.004
>gnl|CDD|235362 PRK05192, PRK05192, tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information 
 Score =  965 bits (2497), Expect = 0.0
 Identities = 319/624 (51%), Positives = 421/624 (67%), Gaps = 34/624 (5%)

Query: 75  DERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEV 134
            E +DVIVVGGGHAGCEAALA+AR+GAKTLLLT N+D I    CNPA+GG AK  LV E+
Sbjct: 2   PEEYDVIVVGGGHAGCEAALAAARMGAKTLLLTHNLDTIGQMSCNPAIGGIAKGHLVREI 61

Query: 135 DALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREA 194
           DALGGE+GK  D   +Q R+LNTS+GPAV ALRAQ D++ Y   M+ I+E+  NL + + 
Sbjct: 62  DALGGEMGKAIDKTGIQFRMLNTSKGPAVRALRAQADRKLYRAAMREILENQPNLDLFQG 121

Query: 195 MVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHG 254
            V D+++ +N  V GV T  G+ F A +VVLTTGTF+ GKI +G  +   GRAGE  S G
Sbjct: 122 EVEDLIV-ENGRVVGVVTQDGLEFRAKAVVLTTGTFLRGKIHIGEKNYSGGRAGEPPSIG 180

Query: 255 LTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMCC 314
           L+E+L+ LGFE  RLKTGTP R+D R++DFS LE Q GD+    FSF  +  I   Q+ C
Sbjct: 181 LSESLRELGFELGRLKTGTPPRIDGRSIDFSKLEEQPGDDPPPPFSFMTE-KIHPPQVPC 239

Query: 315 YLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDK------------------- 355
           Y+T T + TH++I++NLH +P Y G +E  GPRYCP+IEDK                   
Sbjct: 240 YITYTNEETHEIIRENLHRSPMYSGVIEGVGPRYCPSIEDKIVRFADKDRHQIFLEPEGL 299

Query: 356 --------GFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLMTKKV 407
                   G ST LPE +QL +LR++PGLEN  +LRP YA+EYDY+   Q   +L TKK+
Sbjct: 300 DTNEVYPNGISTSLPEDVQLEMLRSIPGLENAEILRPGYAIEYDYVDPRQLKPTLETKKI 359

Query: 408 EGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLIDDLVTKDL 467
           +GLFF+GQINGTTGYEEAAAQG+I+GINAA         +L+R  +Y+G LIDDLVTK  
Sbjct: 360 KGLFFAGQINGTTGYEEAAAQGLIAGINAALKV-QGEPFILKRSEAYIGVLIDDLVTKGT 418

Query: 468 REPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEKRRLKT 527
           +EPYRM TSR+E+RLLLR DNAD RLT  G ELGL+DD RW  +++K   + EE  RLK+
Sbjct: 419 KEPYRMFTSRAEYRLLLREDNADLRLTEKGYELGLVDDERWARFEEKKEAIEEEIERLKS 478

Query: 528 VRISGGDLAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDKHGFGNGLLSRAEKQCVEI 587
            R++  +L      L G P+K   +L  LL++P I YE L K       L     + VEI
Sbjct: 479 TRVTPDELN----ELGGDPLKREVSLLDLLRRPEITYEDLAKLDPELADLDPEVAEQVEI 534

Query: 588 DIKYEGFIVRQQSQLQQMVHQQHRPLPPDLDYYAMTTLSLESREKLSKVRPQTIGQASRV 647
           +IKYEG+I RQQ +++++   +++ +P D+DY A++ LS E+REKL+K+RP+TIGQASR+
Sbjct: 535 EIKYEGYIERQQEEIEKLKRLENKKIPEDIDYDAISGLSNEAREKLNKIRPETIGQASRI 594

Query: 648 GGVSPADITALLIILEANRRKAQE 671
            GV+PADI+ LL+ L+   R  + 
Sbjct: 595 SGVTPADISILLVYLKKRGRLRRS 618

Length = 618
>gnl|CDD|223522 COG0445, GidA, Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|129242 TIGR00136, gidA, glucose-inhibited division protein A Back     alignment and domain information
>gnl|CDD|216319 pfam01134, GIDA, Glucose inhibited division protein A Back     alignment and domain information
>gnl|CDD|206103 pfam13932, GIDA_assoc_3, GidA associated domain 3 Back     alignment and domain information
>gnl|CDD|235416 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>gnl|CDD|224127 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129243 TIGR00137, gid_trmFO, tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|236214 PRK08274, PRK08274, tricarballylate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
>gnl|CDD|180854 PRK07121, PRK07121, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|237225 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|237942 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|226160 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236102 PRK07804, PRK07804, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|234119 TIGR03140, AhpF, alkyl hydroperoxide reductase subunit F Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 699
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 100.0
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 100.0
KOG2311679 consensus NAD/FAD-utilizing protein possibly invol 100.0
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 100.0
PF01134392 GIDA: Glucose inhibited division protein A; InterP 100.0
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 100.0
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 100.0
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 100.0
PF1393272 GIDA_assoc_3: GidA associated domain 3; PDB: 3CES_ 99.95
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.88
COG2081408 Predicted flavoproteins [General function predicti 99.88
TIGR00275400 flavoprotein, HI0933 family. The model when search 99.71
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 99.65
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 99.62
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 99.61
PRK09231582 fumarate reductase flavoprotein subunit; Validated 99.61
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.61
PRK07395553 L-aspartate oxidase; Provisional 99.6
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 99.6
PLN02815594 L-aspartate oxidase 99.58
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.58
PRK07804541 L-aspartate oxidase; Provisional 99.57
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 99.57
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.56
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.56
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 99.56
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 99.55
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.55
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 99.55
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 99.55
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 99.55
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.55
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 99.54
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.54
PRK06175433 L-aspartate oxidase; Provisional 99.53
PRK08401466 L-aspartate oxidase; Provisional 99.52
PRK08626657 fumarate reductase flavoprotein subunit; Provision 99.52
PRK09077536 L-aspartate oxidase; Provisional 99.52
PRK08275554 putative oxidoreductase; Provisional 99.5
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.5
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 99.5
PRK07512513 L-aspartate oxidase; Provisional 99.5
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 99.49
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 99.49
PRK08071510 L-aspartate oxidase; Provisional 99.48
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 99.47
PRK07121492 hypothetical protein; Validated 99.47
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.44
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.43
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.4
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 99.4
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 99.38
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.38
PRK06116450 glutathione reductase; Validated 99.38
PLN02507499 glutathione reductase 99.36
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.36
PRK14694468 putative mercuric reductase; Provisional 99.35
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.34
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.33
PRK06370463 mercuric reductase; Validated 99.33
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.33
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.32
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.31
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.3
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.3
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 99.3
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.29
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.29
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.28
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.28
PTZ00058561 glutathione reductase; Provisional 99.28
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.27
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.26
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.26
PRK13748561 putative mercuric reductase; Provisional 99.25
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.24
TIGR02053463 MerA mercuric reductase. This model represents the 99.22
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.21
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.21
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.2
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.2
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.2
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.2
KOG2853509 consensus Possible oxidoreductase [General functio 99.19
PRK10157428 putative oxidoreductase FixC; Provisional 99.18
KOG1298509 consensus Squalene monooxygenase [Lipid transport 99.18
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.17
PLN02661357 Putative thiazole synthesis 99.17
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.16
PRK08274466 tricarballylate dehydrogenase; Validated 99.16
PRK14727479 putative mercuric reductase; Provisional 99.15
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.15
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.14
PRK10015429 oxidoreductase; Provisional 99.13
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.13
PLN02697529 lycopene epsilon cyclase 99.12
PLN02546558 glutathione reductase 99.12
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 99.12
PRK07045388 putative monooxygenase; Reviewed 99.12
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.12
PRK08013400 oxidoreductase; Provisional 99.11
PLN02985514 squalene monooxygenase 99.11
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.11
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.1
COG0579429 Predicted dehydrogenase [General function predicti 99.09
PLN02463447 lycopene beta cyclase 99.08
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 99.08
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.07
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.07
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.07
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.07
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.07
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.07
PRK09126392 hypothetical protein; Provisional 99.07
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.06
PRK06185407 hypothetical protein; Provisional 99.06
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.05
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.05
PRK06847375 hypothetical protein; Provisional 99.04
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.04
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.04
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.03
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.03
COG3573552 Predicted oxidoreductase [General function predict 99.03
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.03
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 99.03
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.03
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.02
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 99.02
PLN02464627 glycerol-3-phosphate dehydrogenase 99.02
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.02
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.01
PRK06834488 hypothetical protein; Provisional 99.01
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.01
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.01
PTZ003061167 NADH-dependent fumarate reductase; Provisional 99.0
PRK11728393 hydroxyglutarate oxidase; Provisional 98.99
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.99
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.98
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.98
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.97
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.97
PRK11445351 putative oxidoreductase; Provisional 98.97
PRK06184502 hypothetical protein; Provisional 98.96
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.96
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 98.96
PRK08163396 salicylate hydroxylase; Provisional 98.96
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.96
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.95
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.94
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.94
PTZ00367567 squalene epoxidase; Provisional 98.94
PRK12839572 hypothetical protein; Provisional 98.94
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.93
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 98.92
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.91
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.91
PRK08244493 hypothetical protein; Provisional 98.91
PRK07236386 hypothetical protein; Provisional 98.9
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 98.9
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.89
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.87
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 98.87
PRK07190487 hypothetical protein; Provisional 98.87
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 98.87
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.86
PRK06126545 hypothetical protein; Provisional 98.86
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.85
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.84
PRK07588391 hypothetical protein; Provisional 98.83
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.83
PRK12842574 putative succinate dehydrogenase; Reviewed 98.82
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.82
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.82
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.81
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 98.81
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.8
PRK06753373 hypothetical protein; Provisional 98.79
PRK12831464 putative oxidoreductase; Provisional 98.79
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.79
PTZ00153659 lipoamide dehydrogenase; Provisional 98.79
PRK05868372 hypothetical protein; Validated 98.78
PRK06475400 salicylate hydroxylase; Provisional 98.78
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.78
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 98.77
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 98.77
PRK07538413 hypothetical protein; Provisional 98.77
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.76
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.76
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.76
PRK05257494 malate:quinone oxidoreductase; Validated 98.76
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.75
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 98.75
PRK08294634 phenol 2-monooxygenase; Provisional 98.75
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.73
PTZ00052499 thioredoxin reductase; Provisional 98.73
PRK10262321 thioredoxin reductase; Provisional 98.72
PRK06996398 hypothetical protein; Provisional 98.71
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.71
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 98.69
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.68
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.68
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 98.68
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.66
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.65
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.65
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 98.64
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.64
PRK07846451 mycothione reductase; Reviewed 98.64
PRK12779944 putative bifunctional glutamate synthase subunit b 98.64
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.61
PLN02612567 phytoene desaturase 98.59
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.58
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.54
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.53
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.52
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.51
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 98.51
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.5
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 98.5
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.49
PLN02487569 zeta-carotene desaturase 98.48
PRK12814652 putative NADPH-dependent glutamate synthase small 98.43
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 98.4
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.4
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.4
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.4
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.34
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.34
PRK13977576 myosin-cross-reactive antigen; Provisional 98.34
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.34
KOG2852380 consensus Possible oxidoreductase [General functio 98.33
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.32
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.31
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.29
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.27
KOG2960328 consensus Protein involved in thiamine biosynthesi 98.25
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 98.24
PRK02106560 choline dehydrogenase; Validated 98.23
PRK07846451 mycothione reductase; Reviewed 98.23
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.23
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.21
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.19
PRK13984604 putative oxidoreductase; Provisional 98.18
PRK09897534 hypothetical protein; Provisional 98.17
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.14
PRK12771564 putative glutamate synthase (NADPH) small subunit; 98.13
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.13
KOG4716503 consensus Thioredoxin reductase [Posttranslational 98.12
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.11
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.1
PLN02785587 Protein HOTHEAD 98.09
PRK07233434 hypothetical protein; Provisional 98.06
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.06
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.04
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 98.03
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.02
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.02
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 98.01
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 98.0
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 97.95
COG4529474 Uncharacterized protein conserved in bacteria [Fun 97.93
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.92
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.9
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.89
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.88
PRK13512438 coenzyme A disulfide reductase; Provisional 97.86
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.85
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.84
KOG1238623 consensus Glucose dehydrogenase/choline dehydrogen 97.84
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.82
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.81
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.76
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.75
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 97.74
COG2303542 BetA Choline dehydrogenase and related flavoprotei 97.73
PRK06116450 glutathione reductase; Validated 97.72
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.71
TIGR02374785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.7
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.7
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.68
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.67
PLN02852491 ferredoxin-NADP+ reductase 97.65
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.64
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.63
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.61
PRK065671028 putative bifunctional glutamate synthase subunit b 97.6
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.59
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.59
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.58
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.57
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.55
TIGR02053463 MerA mercuric reductase. This model represents the 97.54
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.54
PRK07208479 hypothetical protein; Provisional 97.54
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.53
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.53
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.52
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.52
PRK06370463 mercuric reductase; Validated 97.52
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.51
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 97.51
PLN02507499 glutathione reductase 97.5
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.5
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.48
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.47
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.47
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 97.44
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.44
PTZ00058561 glutathione reductase; Provisional 97.44
PLN02576496 protoporphyrinogen oxidase 97.4
PRK13512438 coenzyme A disulfide reductase; Provisional 97.38
KOG2403642 consensus Succinate dehydrogenase, flavoprotein su 97.37
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.37
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.37
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.36
PTZ00052499 thioredoxin reductase; Provisional 97.35
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.34
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.34
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.34
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.34
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.33
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.33
PRK14727479 putative mercuric reductase; Provisional 97.3
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.3
PRK14694468 putative mercuric reductase; Provisional 97.3
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.29
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.27
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.27
PRK10262321 thioredoxin reductase; Provisional 97.27
PLN02546558 glutathione reductase 97.22
PLN02268435 probable polyamine oxidase 97.21
PRK13748561 putative mercuric reductase; Provisional 97.19
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.17
PTZ00188506 adrenodoxin reductase; Provisional 97.17
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 97.17
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.12
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.11
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 97.11
PTZ00153659 lipoamide dehydrogenase; Provisional 97.08
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.06
PRK12831464 putative oxidoreductase; Provisional 97.03
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.94
COG1231450 Monoamine oxidase [Amino acid transport and metabo 96.93
PRK12416463 protoporphyrinogen oxidase; Provisional 96.91
COG3349485 Uncharacterized conserved protein [Function unknow 96.9
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.89
PLN02568539 polyamine oxidase 96.88
PLN02676487 polyamine oxidase 96.78
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.76
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 96.68
COG1251793 NirB NAD(P)H-nitrite reductase [Energy production 96.67
PLN02529738 lysine-specific histone demethylase 1 96.62
PLN02328808 lysine-specific histone demethylase 1 homolog 96.48
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 96.31
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.18
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.1
PRK12779944 putative bifunctional glutamate synthase subunit b 96.06
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 95.96
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 95.9
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 95.87
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 95.78
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 95.74
PLN03000881 amine oxidase 95.69
PLN02976 1713 amine oxidase 95.56
PRK098531019 putative selenate reductase subunit YgfK; Provisio 95.36
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 95.34
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 95.29
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 95.23
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 95.2
PRK13984604 putative oxidoreductase; Provisional 94.86
PRK12814652 putative NADPH-dependent glutamate synthase small 94.57
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 94.41
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 94.39
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 94.3
COG2907447 Predicted NAD/FAD-binding protein [General functio 94.07
PRK065671028 putative bifunctional glutamate synthase subunit b 94.04
PLN02172461 flavin-containing monooxygenase FMO GS-OX 93.53
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 93.1
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 92.67
KOG2755334 consensus Oxidoreductase [General function predict 92.63
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 92.55
KOG4405547 consensus GDP dissociation inhibitor [Signal trans 92.25
KOG03992142 consensus Glutamate synthase [Amino acid transport 92.16
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 92.13
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 91.98
PLN02852491 ferredoxin-NADP+ reductase 91.51
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 91.26
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 91.18
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 90.98
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.53
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 90.22
PRK12771564 putative glutamate synthase (NADPH) small subunit; 90.18
PRK08274466 tricarballylate dehydrogenase; Validated 90.17
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 89.51
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 89.36
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 89.18
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.06
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 88.94
PRK12842574 putative succinate dehydrogenase; Reviewed 88.91
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 88.87
COG0569225 TrkA K+ transport systems, NAD-binding component [ 88.83
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 88.41
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 88.26
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 88.23
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 88.22
KOG1439440 consensus RAB proteins geranylgeranyltransferase c 87.86
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 87.79
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 87.61
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 87.49
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 87.26
PRK06719157 precorrin-2 dehydrogenase; Validated 87.26
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.24
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.11
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 87.07
KOG0404322 consensus Thioredoxin reductase [Posttranslational 86.68
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.16
PRK06718202 precorrin-2 dehydrogenase; Reviewed 86.14
PRK15116268 sulfur acceptor protein CsdL; Provisional 86.05
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.04
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 86.03
PLN02976 1713 amine oxidase 85.78
PTZ003061167 NADH-dependent fumarate reductase; Provisional 85.73
PRK12921305 2-dehydropantoate 2-reductase; Provisional 85.66
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 85.25
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 85.17
PRK05708305 2-dehydropantoate 2-reductase; Provisional 85.15
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 84.84
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 84.8
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 84.42
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 84.41
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 84.38
PRK06249313 2-dehydropantoate 2-reductase; Provisional 84.28
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 84.23
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 84.14
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 84.03
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 83.97
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 83.96
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 83.85
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 83.78
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 83.72
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 83.54
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 83.31
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 82.99
cd01483143 E1_enzyme_family Superfamily of activating enzymes 82.84
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 82.57
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 82.56
PRK08229341 2-dehydropantoate 2-reductase; Provisional 82.18
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 82.0
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 81.87
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 81.66
COG4529474 Uncharacterized protein conserved in bacteria [Fun 81.63
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 81.44
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 81.35
PRK12549284 shikimate 5-dehydrogenase; Reviewed 81.21
PRK08328231 hypothetical protein; Provisional 81.12
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 80.7
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 80.08
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information 
Probab=100.00  E-value=5.2e-174  Score=1387.26  Aligned_cols=589  Identities=53%  Similarity=0.851  Sum_probs=573.1

Q ss_pred             CcccEEEECCChHHHHHHHHHHHcCCceeEEeeecccccCCCCCCCCCCCccchhhHHHHhhcCccchhhchhhhhHHhh
Q 048823           76 ERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADMCYLQKRVL  155 (699)
Q Consensus        76 ~~~DVvVIGgG~AGl~AA~~LAr~G~kV~LlE~~~~~~g~~~c~~s~Gg~~~~~l~~el~~lg~~~~~~~d~~~i~~~~~  155 (699)
                      ..||||||||||||++||+++||+|++|+|+..+.+++|.|+|||++||++++++++|+|++||.|++.+|.+++||+++
T Consensus         3 ~~~DVIVIGgGHAG~EAA~AaARmG~ktlLlT~~~dtig~msCNPaIGG~~KG~lvrEIDALGG~Mg~~~D~~~IQ~r~L   82 (621)
T COG0445           3 KEYDVIVIGGGHAGVEAALAAARMGAKTLLLTLNLDTIGEMSCNPAIGGPGKGHLVREIDALGGLMGKAADKAGIQFRML   82 (621)
T ss_pred             CCCceEEECCCccchHHHHhhhccCCeEEEEEcCCCceeecccccccCCcccceeEEeehhccchHHHhhhhcCCchhhc
Confidence            45999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCccccccccccCHHHHHHHHHHHHHccCCeEEEeeEEEEEEecCCCCEEEEEEcCccEEecCeEEEecCCCCCCce
Q 048823          156 NTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKI  235 (699)
Q Consensus       156 ~~s~g~~~~~~r~~~d~~~~~~~L~~~l~~~~gv~i~~~~V~~l~~e~~g~v~gV~t~dG~~i~Ad~VVlAtG~~~~~~~  235 (699)
                      |.++||++|++|+|.|+..|..+|++.+++.+|+.+++..|++|+.+++.+|+||++.+|..|.|++||++||+|+++++
T Consensus        83 N~sKGPAVra~RaQaDk~~Y~~~mk~~le~~~NL~l~q~~v~dli~e~~~~v~GV~t~~G~~~~a~aVVlTTGTFL~G~I  162 (621)
T COG0445          83 NSSKGPAVRAPRAQADKWLYRRAMKNELENQPNLHLLQGEVEDLIVEEGQRVVGVVTADGPEFHAKAVVLTTGTFLRGKI  162 (621)
T ss_pred             cCCCcchhcchhhhhhHHHHHHHHHHHHhcCCCceehHhhhHHHhhcCCCeEEEEEeCCCCeeecCEEEEeecccccceE
Confidence            99999999999999999999999999999999999999999999987333699999999999999999999999999999


Q ss_pred             eecccccCCCCcccccchhHHHHHHHcCCcccccccCcccccCCcccccccccccCCCCCccccccCCCccCCccceeee
Q 048823          236 WVGRTSMPAGRAGESASHGLTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMCCY  315 (699)
Q Consensus       236 ~~g~~~~~~gr~g~~~s~~L~~~L~~~G~~~~r~ktgtppr~~~~sid~~~~~~q~~d~~~~~fs~~~~~~~~~~~~~~~  315 (699)
                      |+|...+++||.|+.++.+|++.|+++||++.|||||||||++++||||+.++.|+||.++.+|||..  ....+|++||
T Consensus       163 ~iG~~~~~aGr~ge~~s~~Ls~~L~~lGf~l~RlKTGTPpRi~~~sIDfs~le~q~gD~~~~~fs~~~--~~~~~Qi~C~  240 (621)
T COG0445         163 HIGDTNYSAGRLGEPPSIGLSDRLRELGFKLGRLKTGTPPRIDARSIDFSKLEEQPGDEPPPVFSFTT--EPHPPQIPCY  240 (621)
T ss_pred             EeccccccCCCCCCccchHHHHHHHhcCcEEeeeccCCCCccCCCccChhhhccCcCCCCCCccccCC--CCCcccccee
Confidence            99999999999999999999999999999999999999999999999999999999999999999876  3456799999


Q ss_pred             ccCCChhHHHHHHhccccCCCCCCcccCCCCeeeeccccc---------------------------CCCCCCCHHHHHH
Q 048823          316 LTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDK---------------------------GFSTGLPERLQLP  368 (699)
Q Consensus       316 ~~~t~~~~~~ii~~~~~~s~~~~g~i~~~g~ryc~siEdk---------------------------G~~tslp~~~q~~  368 (699)
                      +|+||++||++|++|+|+||||+|.|++.|||||||||||                           |+|||||+++|.+
T Consensus       241 iT~Tn~~TH~iIr~Nl~rSpmysG~Ieg~GPRYCPSIEDKIvrF~dK~~HqIFlEPEGl~~~evY~nGlSTSlP~dVQ~~  320 (621)
T COG0445         241 ITYTNEKTHEIIRDNLHRSPMYSGEIEGVGPRYCPSIEDKIVRFADKERHQIFLEPEGLDTDEVYPNGLSTSLPEDVQEQ  320 (621)
T ss_pred             eecCChHHHHHHHHhhhhCchhcccccccCCCCCCCHHHhhccCCCCccceEEecCCCCCCceEecCcccccCCHHHHHH
Confidence            9999999999999999999999999999999999999998                           9999999999999


Q ss_pred             HHhcccCCcCCccccccccccCCCcCccccCcccccCCCCCEEEecccCCCchHHHHHHHHHHHHHHHHHHhcCCCCccC
Q 048823          369 LLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLMTKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVL  448 (699)
Q Consensus       369 ~lr~ipgLe~a~i~r~gy~~eyd~i~p~~l~~~letk~i~gLf~AGqi~G~~Gy~eA~a~G~~Ag~naa~~~~~~~~~~~  448 (699)
                      ++|+|||||||+|+||||++||||++|++|.++||||.|+|||||||||||+|||||||||++||+|||++++|++||+|
T Consensus       321 ~irsipGlEna~i~rpgYAIEYD~v~p~qL~~tLEtK~I~GLf~AGQINGTtGYEEAAaQGliAGiNAal~~~~~~p~il  400 (621)
T COG0445         321 IIRSIPGLENAEILRPGYAIEYDYVDPRQLKPTLETKKIKGLFFAGQINGTTGYEEAAAQGLIAGINAALKVQGKEPFIL  400 (621)
T ss_pred             HHHhCcccccceeeccceeeeecccChhhcccchhhceecceEEcccccCCchhHHHHhhhHHHHHHHHHHhcCCCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccchhHHHHHhhhhcCCCCCCcccccChHHhhhhccCCCccccCchhhHhhCCCcHHHHHHHHHHHHHHHHHHHHHhcc
Q 048823          449 ERESSYVGTLIDDLVTKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEKRRLKTV  528 (699)
Q Consensus       449 ~r~~~~igvl~~dl~~~~~~~pyrm~tsr~e~rl~lr~dna~~rl~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~  528 (699)
                      .|++||||||||||||||++||||||||||||||+||+||||+||||+|+++|||+++||+.|+++++.+++++++|+++
T Consensus       401 ~R~eaYIGVlIDDLvTkGt~EPYRmfTSRAEyRL~LR~DNAd~RLt~~g~~lGLv~~~r~~~f~~k~~~i~~~~~~L~~~  480 (621)
T COG0445         401 RRDEAYIGVLIDDLVTKGTNEPYRMFTSRAEYRLLLREDNADLRLTEIGRELGLVDDERYERFLKKKENIEEEIERLKST  480 (621)
T ss_pred             ccCcceeeeEehhhhcCCCCCchhhcchHHHHHHHhhccchhhhhhHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHhe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccchhhHHHHhhhcCCCCCCCCCHHHhhcCCCCCHHHHhccCCCCCCCCHHHHHHHHHHhcchHHHHHHHHHHHHHHHh
Q 048823          529 RISGGDLAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDKHGFGNGLLSRAEKQCVEIDIKYEGFIVRQQSQLQQMVHQ  608 (699)
Q Consensus       529 ~~~~~~~~~~~~~~~~~~~~~~~s~~~ll~rp~v~~~~l~~~~~~~~~~~~~~~~~ieie~kY~gYi~rq~~~i~~~~~~  608 (699)
                      +++|++|...+..+...+.+...+++|+|+||+++|++|..+.+....++.++.++|||++||+|||+||+++|++++|+
T Consensus       481 ~v~p~~~~~~~~~~~~~~~~~~~~~~~lL~rpe~~~~~l~~~~~~~~~~~~~v~eqveieiKY~gYI~rq~~~i~~~~~~  560 (621)
T COG0445         481 WVTPSEVAKELLALGGQPLKRRSSLYDLLRRPEISYDDLISLFPLPADLDAEVLEQVEIEIKYEGYIKRQQEQIEKLKRL  560 (621)
T ss_pred             ecChHHHHHHHHHhhcCCcccchhHHHHhcCCCCCHHHHHHhCCcccccCHHHHhHhheehhHHHHHHHHHHHHHHHHHh
Confidence            99998888888888778888889999999999999999999887555789999999999999999999999999999999


Q ss_pred             cCCCCCCCCCCCCCCCccHHHHHHhhccCCCCHHHHhcCCCCCHHHHHHHHHHHHhhh
Q 048823          609 QHRPLPPDLDYYAMTTLSLESREKLSKVRPQTIGQASRVGGVSPADITALLIILEANR  666 (699)
Q Consensus       609 e~~~IP~~~dY~~i~~LS~E~rekL~~~rP~TlgqAsRI~GVtPa~i~~L~~~l~~~~  666 (699)
                      |+++||+||||+.|+|||+|+||||+++||.||||||||+|||||||++|++||++.+
T Consensus       561 e~~~IP~~~Dy~~i~~LS~Ea~~KL~~~rP~tigqAsRIsGitpadI~~Ll~~l~~~~  618 (621)
T COG0445         561 ENTKIPEDIDYDKIPGLSNEAREKLNKIRPLTIGQASRISGVTPADISILLVYLKKGK  618 (621)
T ss_pred             hcccCCCCcChhhccchhHHHHHHHhhcCCCcHHHhhhcCCCCHHHHHHHHHHHhhhc
Confidence            9999999999999999999999999999999999999999999999999999999754

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13932 GIDA_assoc_3: GidA associated domain 3; PDB: 3CES_C 3CP2_A 3G05_A 3CP8_A 2ZXI_B 2ZXH_A Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG2403 consensus Succinate dehydrogenase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
3ces_A651 Crystal Structure Of E.Coli Mnmg (Gida), A Highly-C 1e-138
3cp2_A649 Crystal Structure Of Gida From E. Coli Length = 649 1e-138
2zxh_A637 Structure Of Aquifex Aeolicus Gida In The Form I Cr 1e-135
3cp8_A641 Crystal Structure Of Gida From Chlorobium Tepidum L 1e-127
3g05_A576 Crystal Structure Of N-Terminal Domain (2-550) Of E 1e-126
2cul_A232 Crystal Structure Of The Gida-Related Protein From 5e-08
3g5q_A443 Crystal Structure Of Thermus Thermophilus Trmfo Len 2e-04
3g5s_A443 Crystal Structure Of Thermus Thermophilus Trmfo In 2e-04
>pdb|3CES|A Chain A, Crystal Structure Of E.Coli Mnmg (Gida), A Highly-Conserved Trna Modifying Enzyme Length = 651 Back     alignment and structure 
Iteration: 1

 Score =  489 bits (1259), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 267/615 (43%), Positives = 363/615 (59%), Gaps = 30/615 (4%)
Query: 78  FDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDAL 137
           FDVI++GGGHAG EAA+A+AR+G +TLLLT NID +    CNPA+GG  K  LV EVDAL
Sbjct: 29  FDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDAL 88
Query: 138 GGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVT 197
           GG + K  D   +Q R+LN S+GPAV A RAQ D+  Y   ++  +E+  NL I +  V 
Sbjct: 89  GGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMIFQQAVE 148
Query: 198 DILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGLTE 257
           D+++ +ND V G  T  G+ F A +VVLT GTF+ GKI +G  +   GRAG+  S  L+ 
Sbjct: 149 DLIV-ENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPSIPLSR 207
Query: 258 NLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMCCYLT 317
            L+ L     RLKTGTP R+D RT+DFS L  QHGD  +  FSF  +     +Q+ CY+T
Sbjct: 208 RLRELPLRVGRLKTGTPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNASQHPQQVPCYIT 267
Query: 318 RTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDK---------------------- 355
            T ++TH +I+ NL  +P Y G +E  GPRYCP+IEDK                      
Sbjct: 268 HTNEKTHDVIRSNLDRSPMYAGVIEGVGPRYCPSIEDKVMRFADRNQHQIFLEPEGLTSN 327
Query: 356 -----GFSXXXXXXXXXXXXXXXXXXXNCSMLRPAYAVEYDYLPAHQCYRSLMTKKVEGL 410
                G S                   N  ++RP YA+EYD+        +L +K ++GL
Sbjct: 328 EIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIEYDFFDPRDLKPTLESKFIQGL 387
Query: 411 FFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLIDDLVTKDLREP 470
           FF+GQINGTTGYEEAAAQG+++G+NAAR S  K      R  +Y+G L+DDL T   +EP
Sbjct: 388 FFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEGWAPARSQAYLGVLVDDLCTLGTKEP 447
Query: 471 YRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEKRRLKTVRI 530
           YRM TSR+E+RL+LR DNAD RLT +GRELGL+DD RW  + +KL  +  E++RLK+  +
Sbjct: 448 YRMFTSRAEYRLMLREDNADLRLTEIGRELGLVDDERWARFNEKLENIERERQRLKSTWV 507
Query: 531 S-GGDLAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDK-HGFGNGLLSRAEKQCVEID 588
           +   + AA+V      P+   ++ E LL++P + YE L     F   L      + VEI 
Sbjct: 508 TPSAEAAAEVNAHLTAPLSREASGEDLLRRPEMTYEKLTTLTPFAPALTDEQAAEQVEIQ 567
Query: 589 IKYEGFIVRXXXXXXXXXXXXHRPLPPDLDYYAMTTLSLESREKLSKVRPQTIGQASRVG 648
           +KYEG+I R            +  LP  LDY  ++ LS E   KL+  +P +IGQASR+ 
Sbjct: 568 VKYEGYIARQQDEIEKQLRNENTLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRIS 627
Query: 649 GVSPADITALLIILE 663
           GV+PA I+ LL+ L+
Sbjct: 628 GVTPAAISILLVWLK 642
>pdb|3CP2|A Chain A, Crystal Structure Of Gida From E. Coli Length = 649 Back     alignment and structure
>pdb|2ZXH|A Chain A, Structure Of Aquifex Aeolicus Gida In The Form I Crystal Length = 637 Back     alignment and structure
>pdb|3CP8|A Chain A, Crystal Structure Of Gida From Chlorobium Tepidum Length = 641 Back     alignment and structure
>pdb|3G05|A Chain A, Crystal Structure Of N-Terminal Domain (2-550) Of E.Coli Mnmg Length = 576 Back     alignment and structure
>pdb|2CUL|A Chain A, Crystal Structure Of The Gida-Related Protein From Thermus Thermophilus Hb8 Length = 232 Back     alignment and structure
>pdb|3G5Q|A Chain A, Crystal Structure Of Thermus Thermophilus Trmfo Length = 443 Back     alignment and structure
>pdb|3G5S|A Chain A, Crystal Structure Of Thermus Thermophilus Trmfo In Complex With Glutathione Length = 443 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 0.0
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 0.0
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 0.0
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 1e-111
2cul_A232 Glucose-inhibited division protein A-related PROT 1e-111
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 1e-07
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 3e-07
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 6e-07
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 7e-07
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 8e-07
3atr_A453 Conserved archaeal protein; saturating double bond 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 1e-05
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 2e-05
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 5e-05
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 5e-05
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 7e-05
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 7e-05
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 1e-04
4fk1_A304 Putative thioredoxin reductase; structural genomic 1e-04
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 2e-04
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 2e-04
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 2e-04
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 2e-04
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 2e-04
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 3e-04
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 3e-04
2gqf_A401 Hypothetical protein HI0933; structural genomics, 4e-04
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 4e-04
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 5e-04
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 5e-04
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 6e-04
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 7e-04
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 7e-04
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Length = 641 Back     alignment and structure
 Score =  990 bits (2562), Expect = 0.0
 Identities = 259/626 (41%), Positives = 366/626 (58%), Gaps = 35/626 (5%)

Query: 72  WNIDERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLV 131
                 +DVIVVG GHAGCEAALA AR G   LL+T ++  +A   CNPA+GG AK Q+ 
Sbjct: 16  PRGSHMYDVIVVGAGHAGCEAALAVARGGLHCLLITSDLSAVARMSCNPAIGGVAKGQIT 75

Query: 132 HEVDALGGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCI 191
            E+DALGGE+GK  D   +Q R+LN S+GPA+ + RAQ DK +Y++ M+ IVE   N+ +
Sbjct: 76  REIDALGGEMGKAIDATGIQFRMLNRSKGPAMHSPRAQADKTQYSLYMRRIVEHEPNIDL 135

Query: 192 REAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRA-GES 250
            +  V  +    +     V    G    A + +L  GTF++G I +G    P GR+  E 
Sbjct: 136 LQDTVIGVSA-NSGKFSSVTVRSGRAIQAKAAILACGTFLNGLIHIGMDHFPGGRSTAEP 194

Query: 251 ASHGLTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIERE 310
              GLTE+L  LGF   RLKTGTP R+D R+VD++ +  Q GD +   FSF       R 
Sbjct: 195 PVEGLTESLASLGFSFGRLKTGTPPRIDSRSVDYTIVTEQPGDVDPVPFSFSSTSVANRN 254

Query: 311 QMCCYLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDK--------------- 355
            + CYLT+TT++TH +++     +P + G V+  GPRYCP+IEDK               
Sbjct: 255 LVSCYLTKTTEKTHDILRTGFDRSPLFTGKVQGVGPRYCPSIEDKISRFPDKSSHHIFLE 314

Query: 356 ------------GFSTGLPERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLM 403
                       GFST LPE +Q+  LR++PGLE   M+RP YA+EYD+    Q   ++ 
Sbjct: 315 PEGTDTVEMYVNGFSTSLPEDIQIAGLRSIPGLEEAKMIRPGYAIEYDFFHPWQIRSTME 374

Query: 404 TKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDGKSLIVLERESSYVGTLIDDLV 463
           T+ VE LFF+GQINGT+GYEEAAAQG+++GINA R   GK LIVL R+ +Y+G LIDDL+
Sbjct: 375 TRPVENLFFAGQINGTSGYEEAAAQGLMAGINAVRKILGKELIVLGRDQAYIGVLIDDLI 434

Query: 464 TKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEKR 523
           TK+ +EPYRM TS +EHRL+LR DNAD RL  +G +  L+        +  + RV     
Sbjct: 435 TKETKEPYRMFTSSAEHRLILRHDNADLRLRKIGYDCNLVSSDDLHRTESIIKRVQHCLE 494

Query: 524 RLKTVRISGGDLAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDKHGFG------NGLL 577
            +KT +++  ++   +     Q +K  +   SL+K+P I  + + +H             
Sbjct: 495 VMKTAKVTPAEINTLLMNKGLQELKTPARALSLIKRPGISLQDILEHSLSVRSAAEELCN 554

Query: 578 SRAEKQCVEIDIKYEGFIVRQQSQLQQMVHQQHRPLPPDLDYYAMTTLSLESREKLSKVR 637
                + V+I+IKYEG+I R+Q    ++       +P + +Y ++ +LS E REKL K R
Sbjct: 555 DPRVAEQVQIEIKYEGYIKREQLVADRIARLDSLHIPDNFNYDSLNSLSSEGREKLLKHR 614

Query: 638 PQTIGQASRVGGVSPADITALLIILE 663
           P TIGQASR+ GVSP+D++ L+I L 
Sbjct: 615 PATIGQASRILGVSPSDVSILMIRLG 640
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Length = 651 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Length = 637 Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Length = 443 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Length = 232 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Length = 621 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 662 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Length = 660 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Length = 588 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query699
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 100.0
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 100.0
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 100.0
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 100.0
2cul_A232 Glucose-inhibited division protein A-related PROT 99.89
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.87
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.81
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.77
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.71
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.59
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 99.57
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.56
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.55
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.53
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 99.53
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.53
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.52
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 99.51
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.51
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.49
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.48
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.47
3dme_A369 Conserved exported protein; structural genomics, P 99.45
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 99.44
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.41
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.41
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.4
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.38
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.34
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.34
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.34
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.33
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.33
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.29
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.29
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.26
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.25
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.24
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.23
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.21
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.21
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.2
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.19
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.19
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.19
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.18
3atr_A453 Conserved archaeal protein; saturating double bond 99.17
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.16
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.16
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.15
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.15
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.14
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.14
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.14
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.13
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.12
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.12
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.12
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.12
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.1
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.1
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.09
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.09
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.09
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.09
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.08
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.08
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.07
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.07
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.06
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.05
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.04
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 99.04
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.03
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.03
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.03
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.03
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.03
4dna_A463 Probable glutathione reductase; structural genomic 99.02
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.01
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.01
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.01
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.0
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.99
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.99
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.99
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.97
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.96
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.95
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.95
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.95
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.93
2bry_A497 NEDD9 interacting protein with calponin homology a 98.93
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.93
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.93
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.93
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.9
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.89
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.87
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.86
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.86
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.85
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.84
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.84
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.83
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.81
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.8
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.77
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.76
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.73
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.73
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.72
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.71
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.69
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.69
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.68
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 98.68
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.65
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.63
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.62
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.62
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.61
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 98.61
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.61
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.61
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.61
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.59
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.58
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.56
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.55
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.54
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.54
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.54
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.54
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.53
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.53
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.53
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.51
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.5
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.49
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.46
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.46
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.46
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.45
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.43
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.41
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.41
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.4
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.38
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.36
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 98.35
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.33
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.32
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.31
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.3
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.3
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.29
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.28
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.27
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.26
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.26
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.25
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.24
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.23
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.22
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.21
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.21
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 98.21
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 98.2
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.2
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.16
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.16
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.16
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.14
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.14
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.13
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.1
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.06
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.04
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.04
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.03
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 98.02
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.01
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.01
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.99
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.98
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.98
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.97
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.96
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.96
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.95
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.94
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.92
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.92
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.91
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.91
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.9
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.9
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.88
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.86
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.85
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.85
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.84
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.83
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.83
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.83
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.82
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.8
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.8
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.79
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.79
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.74
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.74
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.73
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.71
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.71
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.7
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.7
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.68
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.68
4dna_A463 Probable glutathione reductase; structural genomic 97.67
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.67
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.65
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.64
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.63
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.62
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.6
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.59
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.59
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.59
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.57
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.55
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.55
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.55
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.53
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.53
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.52
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.51
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.51
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.5
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.5
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.49
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.49
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.48
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.48
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.48
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.45
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.43
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.43
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.4
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.39
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.39
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.38
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.37
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.36
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.36
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.35
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.34
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.33
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.32
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.31
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.21
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.2
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.19
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.18
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.14
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.14
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.13
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.13
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.06
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.04
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 96.96
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 96.88
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.87
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.87
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 96.86
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.86
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.86
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 96.83
1vg0_A650 RAB proteins geranylgeranyltransferase component A 96.82
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 96.78
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.7
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.68
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.67
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 96.65
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.6
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 96.58
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 96.53
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.41
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.41
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.27
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 96.16
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.14
4fk1_A304 Putative thioredoxin reductase; structural genomic 96.07
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 95.73
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.26
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 95.13
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 94.72
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 94.26
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 93.81
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 93.55
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 93.45
1lss_A140 TRK system potassium uptake protein TRKA homolog; 92.51
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 92.33
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 92.14
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 92.0
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 91.06
1id1_A153 Putative potassium channel protein; RCK domain, E. 90.9
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 90.61
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 90.27
3c85_A183 Putative glutathione-regulated potassium-efflux S 89.51
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 88.04
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 87.76
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 87.59
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 87.34
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 87.24
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 87.21
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 87.09
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 86.26
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 86.23
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 86.23
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 85.85
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 85.72
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 85.48
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 84.46
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 84.41
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 84.24
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 84.07
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 83.87
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 83.85
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 83.77
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 83.68
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 83.63
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 83.47
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 83.02
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 82.71
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 82.59
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 82.56
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 82.56
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 82.48
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 82.42
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 82.29
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 82.24
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 82.2
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 82.05
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 81.9
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 81.89
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 81.86
1vg0_A650 RAB proteins geranylgeranyltransferase component A 81.74
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 81.69
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 81.47
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 81.26
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 81.21
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 81.19
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 81.18
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 81.17
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 80.66
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 80.36
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 80.09
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 80.09
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
Probab=100.00  E-value=3.2e-138  Score=1182.26  Aligned_cols=576  Identities=47%  Similarity=0.779  Sum_probs=530.3

Q ss_pred             CcccEEEECCChHHHHHHHHHHHcCCceeEEeeecccccCCCCCCCCCCCccchhhHHHHhhcCccchhhchhhhhHHhh
Q 048823           76 ERFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADMCYLQKRVL  155 (699)
Q Consensus        76 ~~~DVvVIGgG~AGl~AA~~LAr~G~kV~LlE~~~~~~g~~~c~~s~Gg~~~~~l~~el~~lg~~~~~~~d~~~i~~~~~  155 (699)
                      .+|||||||||+||++||++|++.|++|+|||++.+.++.++|+++.||.++++++++++++++.+..+.+..+++++++
T Consensus        26 ~~yDVIVIGgG~AGl~AAlalAr~G~kVlLIEk~~~~iG~~~Cnps~GGia~g~lv~eldalgg~~~~~~d~~gi~f~~l  105 (637)
T 2zxi_A           26 DEFDVVVIGGGHAGIEAALAAARMGAKTAMFVLNADTIGQMSCNPAIGGIAKGIVVREIDALGGEMGKAIDQTGIQFKML  105 (637)
T ss_dssp             GCCSEEEECCSHHHHHHHHHHHHTTCCEEEEESCGGGTTCCCSCSEEECTTHHHHHHHHHHHTCSHHHHHHHHEEEEEEE
T ss_pred             CcCCEEEECCCHHHHHHHHHHHHCCCCEEEEEecccccCCcCccccccccchHHHHHHHHHhhhHHHHHhhhcccceeec
Confidence            35999999999999999999999999999999976678899999999999888999999999998888888888888888


Q ss_pred             ccCCCccccccccccCHHHHHHHHHHHHHccCCeEEEeeEEEEEEecCCCCEEEEEEcCccEEecCeEEEecCCCCCCce
Q 048823          156 NTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKI  235 (699)
Q Consensus       156 ~~s~g~~~~~~r~~~d~~~~~~~L~~~l~~~~gv~i~~~~V~~l~~e~~g~v~gV~t~dG~~i~Ad~VVlAtG~~~~~~~  235 (699)
                      +..++++++.++.++|+..|...|.+.+++.+|+++++++|++|..+ ++++++|.+.+|..+.|+.||+|||+|+++..
T Consensus       106 ~~~kGpav~~~r~~~Dr~~~~~~L~~~Le~~~GVeI~~~~Vt~L~~e-~g~V~GV~t~dG~~i~AdaVVLATG~~s~~~~  184 (637)
T 2zxi_A          106 NTRKGKAVQSPRAQADKKRYREYMKKVCENQENLYIKQEEVVDIIVK-NNQVVGVRTNLGVEYKTKAVVVTTGTFLNGVI  184 (637)
T ss_dssp             STTSCGGGCEEEEEECHHHHHHHHHHHHHTCTTEEEEESCEEEEEES-SSBEEEEEETTSCEEECSEEEECCTTCBTCEE
T ss_pred             ccccCccccchhhhCCHHHHHHHHHHHHHhCCCCEEEEeEEEEEEec-CCEEEEEEECCCcEEEeCEEEEccCCCccCce
Confidence            88888999888888999999999999999877999999999999876 68899999999999999999999999999999


Q ss_pred             eecccccCCCCcccccchhHHHHHHHcCCcccccccCcccccCCcccccccccccCCCCCccccccCCCcc------CCc
Q 048823          236 WVGRTSMPAGRAGESASHGLTENLQRLGFETDRLKTGTPSRVDLRTVDFSGLEPQHGDEEVSWFSFDPDFH------IER  309 (699)
Q Consensus       236 ~~g~~~~~~gr~g~~~s~~L~~~L~~~G~~~~r~ktgtppr~~~~sid~~~~~~q~~d~~~~~fs~~~~~~------~~~  309 (699)
                      +.|...++.|+.|+.++..++..|.++|+++.++++|+|||++.++|||+.++.|.+|..+.+|||.....      ...
T Consensus       185 ~~G~~~~~~Gr~G~~~A~~la~~L~~lG~~v~~l~tgtppRi~~~sId~~~~~~q~~d~~~~~fs~~~~~~~~~~~~~~~  264 (637)
T 2zxi_A          185 YIGDKMIPGGRLGEPRSEGLSDFYRRFDFPLIRFKTGTPARLDKRTIDFSALEVAPGDDPPPKFSFWTEPVGSYWFPKGK  264 (637)
T ss_dssp             EETTEEEECSBTTBCCBCTHHHHHHHTTCCCEEEEEEECCEEEGGGCCCTTSEEECCCSSCBCSCSSSSSTTCSBCCTTC
T ss_pred             eccceecCCCCCCchhHHHHHHHHHhcCCceEEecCCcCceecccccCHHHhccccCCCCCCCccccCCCcccccccCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999975421      034


Q ss_pred             cceeeeccCCChhHHHHHHhccccCCCCCCcccCCCCeeeeccccc---------------------------CCCCCCC
Q 048823          310 EQMCCYLTRTTKRTHQLIKDNLHETPTYGGWVEAKGPRYCPAIEDK---------------------------GFSTGLP  362 (699)
Q Consensus       310 ~~~~~~~~~t~~~~~~ii~~~~~~s~~~~g~i~~~g~ryc~siEdk---------------------------G~~tslp  362 (699)
                      +|++||+++|++++|+++++|++++++|.|.+.+.|||||||||||                           ||||+||
T Consensus       265 ~ql~c~~t~t~~~~~~ii~~~l~~~~~~~g~i~~~Gprycpsie~k~~rf~dk~~h~i~lepEg~~~~~~y~~G~stslp  344 (637)
T 2zxi_A          265 EQVNCWITYTTPKTHEIIRKNLHRTALYGGLIKGIGPRYCPSIEDKIVKFPDKERHQIFLEPEGLDTIEIYPNGLSTSLP  344 (637)
T ss_dssp             CCCCEEEEECCHHHHHHHHHTC---------------CCCCSHHHHHHHCTTCSCCEEEEEECCSSCCEEEEETCCCCSC
T ss_pred             cceeccccCccHHHHHHHHhcchhccccCccccccCCccCcchhhhhcccCCcccceeeeccccccCceeeecCCCCcCC
Confidence            7999999999999999999999999999999999999999999976                           9999999


Q ss_pred             HHHHHHHHhcccCCcCCccccccccccCCCcCccccCcccccCCCCCEEEecccCCCchHHHHHHHHHHHHHHHHHHhcC
Q 048823          363 ERLQLPLLRTLPGLENCSMLRPAYAVEYDYLPAHQCYRSLMTKKVEGLFFSGQINGTTGYEEAAAQGIISGINAARHSDG  442 (699)
Q Consensus       363 ~~~q~~~lr~ipgLe~a~i~r~gy~~eyd~i~p~~l~~~letk~i~gLf~AGqi~G~~Gy~eA~a~G~~Ag~naa~~~~~  442 (699)
                      +++|.+++++|||||||+|+||||++||||++|.+|+++||+|.+||||||||||||+||+||++||++||+|||++++|
T Consensus       345 ~~~Q~~~~~~ipGle~a~~~r~Gy~ieyd~i~p~~l~~tLe~k~~~gLf~AGqinGt~GyeEAaaqGl~AG~nAa~~~~~  424 (637)
T 2zxi_A          345 EEVQWEMYRSIPGLENVVLIRPAYAIEYDVVPPTELYPTLETKKIRGLFHAGNFNGTTGYEEAAGQGIVAGINAALRAFG  424 (637)
T ss_dssp             HHHHHHHHTTSTTCTTCCEEECCEEEEEEECCGGGBCTTSBBSSSBTEEECGGGGTBCSHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHhhCcCcccceEeccccccccceEchhhcCccccccCCCCEEEeeecCCcchHHHHHHHHHHHHHHHHHHhcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCccCCccchhHHHHHhhhhcCCCCCCcccccChHHhhhhccCCCccccCchhhHhhCCCcHHHHHHHHHHHHHHHHHH
Q 048823          443 KSLIVLERESSYVGTLIDDLVTKDLREPYRMLTSRSEHRLLLRSDNADSRLTPLGRELGLIDDRRWKVYQDKLARVSEEK  522 (699)
Q Consensus       443 ~~~~~~~r~~~~igvl~~dl~~~~~~~pyrm~tsr~e~rl~lr~dna~~rl~~~~~~~g~~~~~~~~~~~~~~~~~~~~~  522 (699)
                      ++|++|+|+++|||||||||||||++||||||||||||||+||+||||+||||+||++|||+++||+.|++|++.+++.+
T Consensus       425 ~~~~~~~r~~ayig~liddl~t~g~~epyrm~tsrae~rl~lr~dnad~rl~~~~~~~g~~~~~~~~~~~~~~~~~~~~~  504 (637)
T 2zxi_A          425 KEPIYLRRDESYIGVMIDDLTTKGVTEPYRLFTSRSEYRLYIRQDNAILRLAKLGRELGLLSEEQYKLVKELEREIEKWK  504 (637)
T ss_dssp             CCCCCCCTTTCHHHHHHHHHHHHCCSSCBCGGGCCCTTTTTSCSTTHHHHHHHHHHHHTSSCHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCChhheehhhHHHHHhhcCCCchhhhcccHHHHHHHhccCChhhhhHHHHHHhCCCCHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcccccchhhHHHHhhhcCCCCCCCCCHHHhhcCCCCCHHHHhc-cCCCCCCCCHHHHHHHHHHhcchHHHHHHHHH
Q 048823          523 RRLKTVRISGGDLAADVTRLSGQPVKDSSTLESLLKKPHIQYEILDK-HGFGNGLLSRAEKQCVEIDIKYEGFIVRQQSQ  601 (699)
Q Consensus       523 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~ll~rp~v~~~~l~~-~~~~~~~~~~~~~~~ieie~kY~gYi~rq~~~  601 (699)
                      ++|++++++|.        +.. + +...|++|+|+ |+|+|++|.. +.+. ..+++++.+++||++||+|||+||+++
T Consensus       505 ~~l~~~~~~~~--------~~~-~-~~~~~~~~~l~-~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~y~~y~~~~~~~  572 (637)
T 2zxi_A          505 EFYKSERVSVA--------VGG-D-TRSYSVATLMT-MNYTLDDVKEKFGYE-VPQHPYVKEEVEIQLKYEPYIERERKL  572 (637)
T ss_dssp             HHHTTCEEEEE--------ETT-E-EEEEEHHHHTT-TTCCHHHHHHHHCCC-CCSSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHhccCccCC--------CCC-C-CCcCCHHHHhC-CCCCHHHHHHhhCCc-cCCCHHHHHHHHHHhHHHHHHHHHHHH
Confidence            99999999876        112 2 45679999999 9999999988 5454 357899999999999999999999999


Q ss_pred             HHHHHHhcCCCCCCCCCCCCCCCccHHHHHHhhccCCCCHHHHhcCCCCCHHHHHHHHHHHHh
Q 048823          602 LQQMVHQQHRPLPPDLDYYAMTTLSLESREKLSKVRPQTIGQASRVGGVSPADITALLIILEA  664 (699)
Q Consensus       602 i~~~~~~e~~~IP~~~dY~~i~~LS~E~rekL~~~rP~TlgqAsRI~GVtPa~i~~L~~~l~~  664 (699)
                      |++++|+|+++||+||||+.|+|||+|+||||+++||.||||||||||||||||++|++||++
T Consensus       573 ~~~~~~~e~~~~p~~~~y~~~~~ls~e~~~kl~~~~p~~~~~a~ri~gv~p~~~~~l~~~~~~  635 (637)
T 2zxi_A          573 NEKLKKLEDTKIPPDIDYDKIPGLTKEAREKLKKFKPITVGQASRIDGITPAAITALLVYLGK  635 (637)
T ss_dssp             THHHHHHHTCBCCTTCCGGGCTTCCHHHHHHHHHHCCSBHHHHTTSTTCCHHHHHHHHHHTTC
T ss_pred             HHHHHhhhCCCCcCCCCcccCCCcCHHHHHHHHhcCCCCHHHHhhCCCCCHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999999999999999999999999999999975
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 699
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 7e-68
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 1e-08
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 2e-08
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 6e-08
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 7e-08
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 7e-08
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 1e-07
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 1e-07
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 2e-07
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 3e-07
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 4e-07
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 5e-07
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 5e-07
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 5e-07
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 5e-07
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 7e-07
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 7e-07
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 9e-07
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 1e-06
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 2e-06
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 2e-06
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 2e-06
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 4e-06
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 4e-06
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 8e-06
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 1e-05
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 2e-05
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 2e-05
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 3e-05
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 6e-05
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 9e-05
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 1e-04
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 2e-04
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 2e-04
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 2e-04
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 2e-04
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 5e-04
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 0.001
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 0.001
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 0.001
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 0.001
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 0.001
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 0.002
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 0.002
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 0.002
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 0.003
d1gtea3153 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenas 0.004
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GidA-like
domain: GidA-related protein TTHA1897
species: Thermus thermophilus [TaxId: 274]

 Score =  220 bits (561), Expect = 7e-68
 Identities = 62/264 (23%), Positives = 99/264 (37%), Gaps = 45/264 (17%)

Query: 78  FDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDAL 137
           + V++VG G +G E A   A+ G +  LLT ++D +      P    P  S L    D  
Sbjct: 3   YQVLIVGAGFSGAETAFWLAQKGVRVGLLTQSLDAVMMPFLPPKPPFPPGSLLERAYD-- 60

Query: 138 GGEIGKVADMCYLQKRVLNTSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVT 197
                                +   VWA  A+          K ++E    L + +A  T
Sbjct: 61  --------------------PKDERVWAFHAR---------AKYLLEGLRPLHLFQATAT 91

Query: 198 DILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIWVGRTSMPAGRAGESASHGLTE 257
             LL + + V GV T+ G       VVL  G+F+  ++++G     AGR  E++   L E
Sbjct: 92  G-LLLEGNRVVGVRTWEGPPARGEKVVLAVGSFLGARLFLGGVVEEAGRLSEASYPDLLE 150

Query: 258 NLQRLGFETDRLKTGTPS--RVDLRTVDFSGLEPQHGDEEVSWFSFDPDFHIEREQMC-- 313
           +L RLGF     +   P         V +    P+  +E+   F       +E       
Sbjct: 151 DLSRLGFRFVEREGEVPETPSTPGYRVRYLAFHPEEWEEK--TFRLK---RLEGLYAVGL 205

Query: 314 ----CYLTRTTKRTHQLIKDNLHE 333
                   R ++   +L +  LHE
Sbjct: 206 CVREGDYARMSEEGKRLAEHLLHE 229
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query699
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 100.0
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.83
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.71
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.7
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.7
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.69
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.47
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.45
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.42
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.41
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.4
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.39
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.38
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.33
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.31
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.3
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.24
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.23
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.19
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.18
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.16
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.14
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.12
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.12
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.12
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.11
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.1
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.1
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 99.07
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.04
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.02
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.97
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.95
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.94
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.93
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.91
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.8
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.79
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.76
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.73
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.72
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.71
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.71
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.7
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.7
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.69
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.67
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.67
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.66
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.65
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.65
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.64
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.62
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.6
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.6
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.59
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.59
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.57
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.55
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.55
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.52
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.52
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.5
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.46
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.44
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.43
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.33
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 98.3
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 98.21
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.17
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.1
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.09
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.09
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.07
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.98
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.97
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.91
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.88
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.8
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.79
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 97.77
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.63
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.62
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.61
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.61
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.58
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.44
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.35
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.31
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.29
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.18
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.07
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 96.99
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.45
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 95.32
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.05
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.92
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 94.71
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.59
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.59
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.5
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.47
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.45
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.41
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.11
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 93.02
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.86
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.73
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 92.64
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 92.35
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.96
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 91.66
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 91.13
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 91.1
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 90.67
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 90.64
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 88.95
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 88.61
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 88.56
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 88.46
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 88.12
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 87.75
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 87.57
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 87.55
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 87.18
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 86.99
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 86.81
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 86.72
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 86.58
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 86.23
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 86.23
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 86.14
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 85.35
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 85.22
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 85.21
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 84.76
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 84.74
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 84.53
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 84.23
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 84.05
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 83.46
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 83.4
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 83.07
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 82.8
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 82.52
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 82.34
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 82.2
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 81.34
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 81.31
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 80.88
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 80.8
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 80.78
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 80.72
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 80.26
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GidA-like
domain: GidA-related protein TTHA1897
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=5.5e-40  Score=327.71  Aligned_cols=225  Identities=27%  Similarity=0.376  Sum_probs=197.2

Q ss_pred             cccEEEECCChHHHHHHHHHHHcCCceeEEeeecccccCCCCCCCCCCCccchhhHHHHhhcCccchhhchhhhhHHhhc
Q 048823           77 RFDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDKIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADMCYLQKRVLN  156 (699)
Q Consensus        77 ~~DVvVIGgG~AGl~AA~~LAr~G~kV~LlE~~~~~~g~~~c~~s~Gg~~~~~l~~el~~lg~~~~~~~d~~~i~~~~~~  156 (699)
                      .||||||||||||++||+++||.|++|+||+++.+.+++++|||..|+..++.+.++++                     
T Consensus         2 ~YDVIVIGgG~AG~eAA~~aAR~G~ktllit~~~~~ig~~~cnp~~gg~~kg~l~reid---------------------   60 (230)
T d2cula1           2 AYQVLIVGAGFSGAETAFWLAQKGVRVGLLTQSLDAVMMPFLPPKPPFPPGSLLERAYD---------------------   60 (230)
T ss_dssp             CCSEEEECCSHHHHHHHHHHHHTTCCEEEEESCGGGTTCCSSCCCSCCCTTCHHHHHCC---------------------
T ss_pred             CCcEEEECcCHHHHHHHHHHHHCCCcEEEEEeccchhcccccCCccccCCCcceeeeee---------------------
Confidence            49999999999999999999999999999999999999999999999999888877653                     


Q ss_pred             cCCCccccccccccCHHHHHHHHHHHHHccCCeEEEeeEEEEEEecCCCCEEEEEEcCccEEecCeEEEecCCCCCCcee
Q 048823          157 TSRGPAVWALRAQTDKREYAMRMKNIVESTANLCIREAMVTDILLGKNDNVEGVCTFFGMNFYAPSVVLTTGTFMSGKIW  236 (699)
Q Consensus       157 ~s~g~~~~~~r~~~d~~~~~~~L~~~l~~~~gv~i~~~~V~~l~~e~~g~v~gV~t~dG~~i~Ad~VVlAtG~~~~~~~~  236 (699)
                       ++++++|+++++         +.+.+.+.+|+++++.+|+++..+ ++++.+|++.+|.+|.|+.||+|||+|+++++|
T Consensus        61 -~kG~av~a~raQ---------~k~~l~~~~nL~i~q~~V~dli~e-~~~v~gV~t~~G~~~~AkaVILtTGTFL~G~ih  129 (230)
T d2cula1          61 -PKDERVWAFHAR---------AKYLLEGLRPLHLFQATATGLLLE-GNRVVGVRTWEGPPARGEKVVLAVGSFLGARLF  129 (230)
T ss_dssp             -TTCCCHHHHHHH---------HHHHHHTCTTEEEEECCEEEEEEE-TTEEEEEEETTSCCEECSEEEECCTTCSSCEEE
T ss_pred             -ccchhhhhHHHH---------HHHHHhhhcCHHHHhccceeeEec-ccceeeEEeccccEEEEeEEEEccCcceeeEEE
Confidence             356777766555         455677788999999999999987 789999999999999999999999999999999


Q ss_pred             ecccccCCCCcccccchhHHHHHHHcCCcccccccCcc--cccCCcccccccccccCCCCCccccccCCCc-cCCcccee
Q 048823          237 VGRTSMPAGRAGESASHGLTENLQRLGFETDRLKTGTP--SRVDLRTVDFSGLEPQHGDEEVSWFSFDPDF-HIEREQMC  313 (699)
Q Consensus       237 ~g~~~~~~gr~g~~~s~~L~~~L~~~G~~~~r~ktgtp--pr~~~~sid~~~~~~q~~d~~~~~fs~~~~~-~~~~~~~~  313 (699)
                      +|...+++||.|+.++..|++.|+++||++.|+|||||  ||+++++|||+.++.|++|+.+..|++.+.. .......+
T Consensus       130 iG~~~~~~GR~ge~~s~~Ls~~L~~lGf~~~rlkTgTPa~pR~~~~sId~~~~~~q~~d~~~f~~~~~~~~~~~~~~~~~  209 (230)
T d2cula1         130 LGGVVEEAGRLSEASYPDLLEDLSRLGFRFVEREGEVPETPSTPGYRVRYLAFHPEEWEEKTFRLKRLEGLYAVGLCVRE  209 (230)
T ss_dssp             ETTEEESEEETTEECCSHHHHHHHHTTCCEEEEEEEEC-----CCEEEEEEEECGGGEETTTTEETTSBSEEECGGGTSC
T ss_pred             EEeeeeeccccCCchhhhHHHHHHhcCCceeeecCCCCCCCCCCCCeecccccccccCCCCCceeEeeccccccceeecc
Confidence            99999999999999999999999999999999999999  9999999999999999999877666653321 12234578


Q ss_pred             eeccCCChhHHHHHHhcccc
Q 048823          314 CYLTRTTKRTHQLIKDNLHE  333 (699)
Q Consensus       314 ~~~~~t~~~~~~ii~~~~~~  333 (699)
                      |+.++++.++|.++.+++|+
T Consensus       210 ~~~~~~~~~~~~l~~~~~~~  229 (230)
T d2cula1         210 GDYARMSEEGKRLAEHLLHE  229 (230)
T ss_dssp             CCHHHHHHHHHHHHHHHHHH
T ss_pred             ccHHHHhHHHHHHHHHHhhc
Confidence            89999999999999998874
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure