Psyllid ID: psy10019

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MAYQPQRMPEQDVSMAQGDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLESKKELEIKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMVLYIKEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELEEDEEEEKEKDKEENEDDKTPKIEDYGWTANMERIMKAQALRDTSTMGYMAAKKHLEINPDHNIIETLRQKADADKNDKAVKDLVMLLFETALLSSGFGLEDPQVHAARIHRMIKLGLGIDDDDEVPAEASKAADVDITPVDGDSEDASRMEEVD
ccccccccccHHHcccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcHHHHHHHHHHHcccccccccccccEEEEEEEcccccEEEEEEccccccHHHHHHcccccccccHHHHHHHHHccccccccccccccccEEEEEEEEEEEEEccccccEEEEEEcccccEEEEccccccccccEEEEEEEcccHHHHccHHHHHHHHHHccccccccEEEEEEHHHccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccccHHHHHcccEEcccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccc
cccccccccHHcccccccccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccEEEEEEccccEEEEEEccccccHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHccHHHHHHHcEEEEEEEEEcccccEEEEEEccccEEEEEEccccccccEEEEEEEEccccHHHHcHHHHHHHHHHHcccccccEEEcccEEccccccccccEEEEEcccccccccEEEEcccccccccccHHHHcccccccHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccHHcccccccccccccccccHcccccccc
mayqpqrmpeqdvsmaQGDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRyesltdpsrleskkeleikiipdkesrtltiidsgigmtKADLVNNLGTIAKSGTKAFMEALQAgadismigqfgvGFYSAYLVADKVtvhskhnddeqyiwessaggsftikpdhgeqlgrgTKMVLYIKEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELEEDEEEEkekdkeeneddktpkiedygWTANMERIMKAQALRDTSTMGYMAAKKHleinpdhnIIETLRQKADADKNDKAVKDLVMLLFETALlssgfgledpqVHAARIHRMIKLglgiddddevpaeaskaadvditpvdgdsedasrmeevd
mayqpqrmpeqdvSMAQGDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYesltdpsrleskkeleikiipdkesrtltiidsgigmtkaDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMVLYIKEDQAEYLEEKKIKEIVkkhsqfigypikllveKEREKeleedeeeekekdkeeneddktpkiedygwtaNMERIMKAQALRDTSTMGYMAAKKHLEINPDHNIIETLRQKADADKNDKAVKDLVMLLFETALLSSGFGLEDPQVHAARIHRMIKLGLGIDDDDEVPAEaskaadvditpvdgdsedasrmeevd
MAYQPQRMPEQDVSMAQGDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLESKKELEIKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMVLYIKEDQAEYLeekkikeivkkHSQFIGYPIKLLVekerekeleedeeeekekdkeeneddkTPKIEDYGWTANMERIMKAQALRDTSTMGYMAAKKHLEINPDHNIIETLRQkadadkndkavkdLVMLLFETALLSSGFGLEDPQVHAARIHRMIKLGLGIDDDDEVPAEASKAADVDITPVDGDSEDASRMEEVD
*******************VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISN**************************IKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMVLYIKEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLV*********************************YGWTANMERIMKAQALRDTSTMGYMAAKKHLEINPDHNIIETL**********KAVKDLVMLLFETALLSSGFGLEDPQVHAARIHRMIKLGLGID**********************************
************************FQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLESKKELEIKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMVLYIKEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELEEDEEEEKEKDKEENEDDKTPKIEDYGWTANMERIMKAQALRDTSTMGYMAAKKHLEINPDHNIIETLRQKADADKNDKAVKDLVMLLFETALLSSGFGLEDPQVHAARIHRMIKLGLGIDDDD*******************************
*************SMAQGDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLESKKELEIKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMVLYIKEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKE************************TPKIEDYGWTANMERIMKAQALRDTSTMGYMAAKKHLEINPDHNIIETLRQKADADKNDKAVKDLVMLLFETALLSSGFGLEDPQVHAARIHRMIKLGLGIDDDDEVPAEASKAADVDITPVD*************
******************DVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLESKKELEIKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMVLYIKEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELEEDEEEEKEKDKEENEDDKTPKIEDYGWTANMERIMKAQALRDTSTMGYMAAKKHLEINPDHNIIETLRQKADADKNDKAVKDLVMLLFETALLSSGFGLEDPQVHAARIHRMIKLGLGID**********************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYQPQRMPEQDVSMAQGDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLESKKELEIKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMVLYIKEDQAEYLEEKKIKEIVKKHSQFIGYPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKTPKIEDYGWTANMERIMKAQALRDTSTMGYMAAKKHLEINPDHNIIETLRQKADADKNDKAVKDLVMLLFETALLSSGFGLEDPQVHAARIHRMIKLGLGIDDDDEVPAEASKAADVDITPVDGDSEDASRMEEVD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query388 2.2.26 [Sep-21-2011]
P30946 694 Heat shock protein HSP 90 yes N/A 0.636 0.355 0.765 1e-109
P82995 733 Heat shock protein HSP 90 yes N/A 0.657 0.347 0.755 1e-108
P07901 733 Heat shock protein HSP 90 yes N/A 0.657 0.347 0.755 1e-108
Q90474 725 Heat shock protein HSP 90 yes N/A 0.652 0.348 0.764 1e-108
P02828 717 Heat shock protein 83 OS= yes N/A 0.631 0.341 0.784 1e-108
Q7PT10 720 Heat shock protein 83 OS= no N/A 0.530 0.286 0.892 1e-107
Q4R4P1 733 Heat shock protein HSP 90 N/A N/A 0.587 0.311 0.807 1e-107
P07900 732 Heat shock protein HSP 90 yes N/A 0.587 0.311 0.807 1e-107
O02705 733 Heat shock protein HSP 90 yes N/A 0.587 0.311 0.807 1e-107
Q76LV2 733 Heat shock protein HSP 90 yes N/A 0.587 0.311 0.807 1e-107
>sp|P30946|HS90A_RABIT Heat shock protein HSP 90-alpha OS=Oryctolagus cuniculus GN=HSP90AA1 PE=1 SV=2 Back     alignment and function desciption
 Score =  397 bits (1019), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/256 (76%), Positives = 223/256 (87%), Gaps = 9/256 (3%)

Query: 5   PQRMPEQDVSMAQGDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRY 64
           P+    QD  M + +VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRY
Sbjct: 2   PEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRY 61

Query: 65  ESLTDPSRLESKKELEIKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEA 124
           ESLTDPS+L+S KEL I +IP+K+ RTLTI+D+GIGMTKADL+NNLGTIAKSGTKAFMEA
Sbjct: 62  ESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEA 121

Query: 125 LQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLG 184
           LQAGADISMIGQFGVGFYSAYLVA+KVTV +KHNDDEQY WESSAGGSFT++ D GE +G
Sbjct: 122 LQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDAGEPMG 181

Query: 185 RGTKMVLYIKEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELEEDEEEEKEKD 244
           RGTK+VL++KEDQ EYLEE++IKEIVKKHSQFIGYPI L VEKER+KE+ +DE ++    
Sbjct: 182 RGTKVVLHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAKQP--- 238

Query: 245 KEENEDDKTPKIEDYG 260
                DDK P+IED G
Sbjct: 239 -----DDK-PEIEDVG 248
Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.
Oryctolagus cuniculus (taxid: 9986)
>sp|P82995|HS90A_RAT Heat shock protein HSP 90-alpha OS=Rattus norvegicus GN=Hsp90aa1 PE=1 SV=3 Back     alignment and function description
>sp|P07901|HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus musculus GN=Hsp90aa1 PE=1 SV=4 Back     alignment and function description
>sp|Q90474|H90A1_DANRE Heat shock protein HSP 90-alpha 1 OS=Danio rerio GN=hsp90a.1 PE=1 SV=3 Back     alignment and function description
>sp|P02828|HSP83_DROME Heat shock protein 83 OS=Drosophila melanogaster GN=Hsp83 PE=1 SV=1 Back     alignment and function description
>sp|Q7PT10|HSP83_ANOGA Heat shock protein 83 OS=Anopheles gambiae GN=Hsp83 PE=3 SV=3 Back     alignment and function description
>sp|Q4R4P1|HS90A_MACFA Heat shock protein HSP 90-alpha OS=Macaca fascicularis GN=HSP90AA1 PE=2 SV=3 Back     alignment and function description
>sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens GN=HSP90AA1 PE=1 SV=5 Back     alignment and function description
>sp|O02705|HS90A_PIG Heat shock protein HSP 90-alpha OS=Sus scrofa GN=HSP90AA1 PE=2 SV=3 Back     alignment and function description
>sp|Q76LV2|HS90A_BOVIN Heat shock protein HSP 90-alpha OS=Bos taurus GN=HSP90AA1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
118778687393 AGAP006959-PA [Anopheles gambiae str. PE 0.961 0.949 0.730 1e-154
158286538369 AGAP006961-PA [Anopheles gambiae str. PE 0.896 0.943 0.691 1e-136
292606981 730 heat shock protein 90 [Nilaparvata lugen 0.644 0.342 0.819 1e-113
388540224 730 heat shock protein 90 [Sogatella furcife 0.644 0.342 0.823 1e-112
190402564 725 HSP90 [Macrocentrus cingulum] gi|1937951 0.649 0.347 0.822 1e-111
226446417253 heat shock protein 90 [Apis mellifera] 0.644 0.988 0.793 1e-111
301137080 723 heat shock protein 90 [Gryllus firmus] 0.559 0.300 0.899 1e-111
157419936 723 heat shock protein 90 [Microplitis media 0.595 0.319 0.857 1e-110
423292559 722 90 kDa heat shock protein [Lygus hesperu 0.646 0.347 0.834 1e-110
304368179 716 heat shock protein 90 [Exangerona pratti 0.579 0.314 0.853 1e-110
>gi|118778687|ref|XP_308799.3| AGAP006959-PA [Anopheles gambiae str. PEST] gi|116132504|gb|EAA04769.4| AGAP006959-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 288/394 (73%), Positives = 323/394 (81%), Gaps = 21/394 (5%)

Query: 15  MAQG-DVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRL 73
           M +G + ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPS+L
Sbjct: 1   MPEGPEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKL 60

Query: 74  ESKKELEIKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISM 133
           ES KEL IKIIP+KE+ TLT+ID+GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISM
Sbjct: 61  ESGKELFIKIIPNKEAGTLTLIDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISM 120

Query: 134 IGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMVLYI 193
           IGQFGVGFYSAYLVADKV V SK+NDDEQY+WESSAGGSFT++PD GE LGRGTK+VL+I
Sbjct: 121 IGQFGVGFYSAYLVADKVVVTSKNNDDEQYVWESSAGGSFTVRPDSGEPLGRGTKIVLHI 180

Query: 194 KEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELEED--------EEEEKEKDK 245
           KEDQ EYLEE KIK+IV KHSQFIGYPIKLL ++E +K   E+         E + EK  
Sbjct: 181 KEDQLEYLEESKIKQIVNKHSQFIGYPIKLLKKREEDKAKFENLCKVMKSVLESKVEKVM 240

Query: 246 EENEDDKTPKI---EDYGWTANMERIMKAQALRDTSTMGYMAAKKHLEINPDHNIIETLR 302
             N    +P       YGW+ANMERIMKAQALRD+S MGYMA KKHLEINPDH IIETLR
Sbjct: 241 VSNRLVDSPCCIVTSQYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAIIETLR 300

Query: 303 QKADADKNDKAVKDLVMLLFETALLSSGFGLEDPQVHAARIHRMIKLGLGIDDDDEVPAE 362
           Q+A+ADKNDKAVKDLV+LLFETALLSSGF L++P  HA+RI+RMIKLGLGID+D+ +  +
Sbjct: 301 QRAEADKNDKAVKDLVILLFETALLSSGFSLDEPGTHASRIYRMIKLGLGIDEDEPMTTD 360

Query: 363 --------ASKAADVDITPVDGDSEDASRMEEVD 388
                   A+ A+      VD DSED S MEEVD
Sbjct: 361 ESSSGAAAAAPASGDAPPLVD-DSEDLSHMEEVD 393

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|158286538|ref|XP_308797.3| AGAP006961-PA [Anopheles gambiae str. PEST] gi|157020517|gb|EAA45456.3| AGAP006961-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|292606981|gb|ADE34169.1| heat shock protein 90 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|388540224|gb|AFK64820.1| heat shock protein 90 [Sogatella furcifera] Back     alignment and taxonomy information
>gi|190402564|gb|ACE77780.1| HSP90 [Macrocentrus cingulum] gi|193795158|gb|ACE77781.2| heat shock protein 90 [Macrocentrus cingulum] Back     alignment and taxonomy information
>gi|226446417|gb|ACO58574.1| heat shock protein 90 [Apis mellifera] Back     alignment and taxonomy information
>gi|301137080|gb|ADK64952.1| heat shock protein 90 [Gryllus firmus] Back     alignment and taxonomy information
>gi|157419936|gb|ABV55506.1| heat shock protein 90 [Microplitis mediator] Back     alignment and taxonomy information
>gi|423292559|gb|AFX84559.1| 90 kDa heat shock protein [Lygus hesperus] Back     alignment and taxonomy information
>gi|304368179|gb|ADM26739.1| heat shock protein 90 [Exangerona prattiaria] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query388
UNIPROTKB|Q76LV2 733 HSP90AA1 "Heat shock protein H 0.569 0.301 0.769 2.6e-132
UNIPROTKB|O02705 733 HSP90AA1 "Heat shock protein H 0.569 0.301 0.769 2.6e-132
UNIPROTKB|P07900 732 HSP90AA1 "Heat shock protein H 0.569 0.301 0.769 3.3e-132
UNIPROTKB|Q9GKX7 733 HSP90AA1 "Heat shock protein H 0.569 0.301 0.769 3.3e-132
RGD|631409 733 Hsp90aa1 "heat shock protein 9 0.569 0.301 0.769 4.2e-132
MGI|MGI:96250 733 Hsp90aa1 "heat shock protein 9 0.569 0.301 0.769 5.3e-132
UNIPROTKB|P11501 728 HSP90AA1 "Heat shock protein H 0.567 0.302 0.769 6.8e-132
UNIPROTKB|F1NVN4 583 F1NVN4 "Uncharacterized protei 0.567 0.377 0.773 1.4e-131
UNIPROTKB|P46633 733 HSP90AA1 "Heat shock protein H 0.569 0.301 0.764 2.3e-131
ZFIN|ZDB-GENE-990415-94 725 hsp90aa1.1 "heat shock protein 0.561 0.300 0.771 7.7e-131
UNIPROTKB|Q76LV2 HSP90AA1 "Heat shock protein HSP 90-alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 868 (310.6 bits), Expect = 2.6e-132, Sum P(2) = 2.6e-132
 Identities = 170/221 (76%), Positives = 190/221 (85%)

Query:     5 PQRMPEQDVSMAQGDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRY 64
             P+    QD  M + +VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRY
Sbjct:     2 PEETQAQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRY 61

Query:    65 ESLTDPSRLESKKELEIKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEA 124
             ESLTDPS+L+S KEL I +IP+K+ RTLTI+D+GIGMTKADL+NNLGTIAKSGTKAFMEA
Sbjct:    62 ESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEA 121

Query:   125 LQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLG 184
             LQAGADISMIGQFGVGFYSAYLVA+KVTV +KHNDDEQY WESSAGGSFT++ D GE +G
Sbjct:   122 LQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMG 181

Query:   185 RGTKMVLYIKEDQAEYLXXXXXXXXXXXHSQFIGYPIKLLV 225
             RGTK++L++KEDQ EYL           HSQFIGYPI L V
Sbjct:   182 RGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFV 222
GO:0005737 "cytoplasm" evidence=ISS
GO:0045429 "positive regulation of nitric oxide biosynthetic process" evidence=ISS
GO:0042803 "protein homodimerization activity" evidence=ISS
GO:0030235 "nitric-oxide synthase regulator activity" evidence=ISS
GO:0030911 "TPR domain binding" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
GO:0042470 "melanosome" evidence=IEA
GO:0051131 "chaperone-mediated protein complex assembly" evidence=IEA
GO:0045040 "protein import into mitochondrial outer membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0006950 "response to stress" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
UNIPROTKB|O02705 HSP90AA1 "Heat shock protein HSP 90-alpha" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P07900 HSP90AA1 "Heat shock protein HSP 90-alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GKX7 HSP90AA1 "Heat shock protein HSP 90-alpha" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
RGD|631409 Hsp90aa1 "heat shock protein 90, alpha (cytosolic), class A member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:96250 Hsp90aa1 "heat shock protein 90, alpha (cytosolic), class A member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P11501 HSP90AA1 "Heat shock protein HSP 90-alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVN4 F1NVN4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P46633 HSP90AA1 "Heat shock protein HSP 90-alpha" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-94 hsp90aa1.1 "heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R710HS90B_PONABNo assigned EC number0.82540.54380.2914yesN/A
P55737HS902_ARATHNo assigned EC number0.79620.54120.3004yesN/A
P07900HS90A_HUMANNo assigned EC number0.80780.58760.3114yesN/A
P07901HS90A_MOUSENo assigned EC number0.75570.65720.3478yesN/A
P04811HSP83_DROVINo assigned EC number0.79130.63140.6550N/AN/A
P04810HSP83_DROSINo assigned EC number0.78430.63140.6533N/AN/A
P51818HS903_ARATHNo assigned EC number0.79140.54120.3004yesN/A
Q69QQ6HSP82_ORYSJNo assigned EC number0.75820.54120.3004yesN/A
O16076HSP83_DROPENo assigned EC number0.76470.63140.9107N/AN/A
P40292HSP90_ASPFUNo assigned EC number0.75230.54890.3016yesN/A
Q9GKX7HS90A_HORSENo assigned EC number0.80780.58760.3110yesN/A
Q0J4P2HSP81_ORYSJNo assigned EC number0.76190.53860.2989yesN/A
P46633HS90A_CRIGRNo assigned EC number0.80340.58760.3110yesN/A
Q07078HSP83_ORYSJNo assigned EC number0.75820.54120.3004yesN/A
O16068HSP83_DROPBNo assigned EC number0.72150.63140.9107N/AN/A
O43109HSP90_PODASNo assigned EC number0.72450.59530.3295yesN/A
Q90474H90A1_DANRENo assigned EC number0.76470.65200.3489yesN/A
P02828HSP83_DROMENo assigned EC number0.78430.63140.3417yesN/A
P54651HSC90_DICDINo assigned EC number0.73830.59790.3314yesN/A
O02705HS90A_PIGNo assigned EC number0.80780.58760.3110yesN/A
O16087HSP83_DROMINo assigned EC number0.78030.63140.9107N/AN/A
Q76LV2HS90A_BOVINNo assigned EC number0.80780.58760.3110yesN/A
O03986HS904_ARATHNo assigned EC number0.78670.54120.3004yesN/A
Q04619HS90B_CHICKNo assigned EC number0.79470.58760.3144yesN/A
Q18688HSP90_CAEELNo assigned EC number0.79510.50510.2792yesN/A
P04809HSP83_DROPSNo assigned EC number0.78430.63140.3417yesN/A
P30946HS90A_RABITNo assigned EC number0.76560.63650.3559yesN/A
P82995HS90A_RATNo assigned EC number0.75570.65720.3478yesN/A
A5A6K9HS90A_PANTRNo assigned EC number0.80340.58760.3110yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
PTZ00272 701 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp 1e-105
PRK05218 613 PRK05218, PRK05218, heat shock protein 90; Provisi 4e-97
COG0326 623 COG0326, HtpG, Molecular chaperone, HSP90 family [ 2e-95
PTZ00130 814 PTZ00130, PTZ00130, heat shock protein 90; Provisi 9e-69
pfam00183529 pfam00183, HSP90, Hsp90 protein 8e-55
PTZ00272701 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp 4e-39
PRK14083 601 PRK14083, PRK14083, HSP90 family protein; Provisio 2e-26
pfam00183 529 pfam00183, HSP90, Hsp90 protein 5e-19
COG0326623 COG0326, HtpG, Molecular chaperone, HSP90 family [ 9e-15
PRK05218613 PRK05218, PRK05218, heat shock protein 90; Provisi 2e-13
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyras 1e-11
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPas 5e-10
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; 4e-08
PTZ00130814 PTZ00130, PTZ00130, heat shock protein 90; Provisi 1e-07
pfam13589134 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyr 3e-06
>gnl|CDD|240341 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information 
 Score =  324 bits (832), Expect = e-105
 Identities = 161/238 (67%), Positives = 202/238 (84%)

Query: 21  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLESKKELE 80
           ETFAFQAEI QLMSLIINTFYSNKEIFLRELISN+SDA DKIRY+SLTDPS L     L 
Sbjct: 3   ETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASDACDKIRYQSLTDPSVLGESPRLC 62

Query: 81  IKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVG 140
           I+++PDKE++TLT+ D+GIGMTKADLVNNLGTIA+SGTKAFMEAL+AG D+SMIGQFGVG
Sbjct: 63  IRVVPDKENKTLTVEDNGIGMTKADLVNNLGTIARSGTKAFMEALEAGGDMSMIGQFGVG 122

Query: 141 FYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMVLYIKEDQAEY 200
           FYSAYLVAD+VTV SK+N DE Y+WESSAGG+FTI       + RGT++ L++KEDQ EY
Sbjct: 123 FYSAYLVADRVTVTSKNNSDESYVWESSAGGTFTITSTPESDMKRGTRITLHLKEDQMEY 182

Query: 201 LEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELEEDEEEEKEKDKEENEDDKTPKIED 258
           LE +++KE++KKHS+FIGY I+L+VEK  EKE+ +++EE+ +K  E+ E+ K  ++++
Sbjct: 183 LEPRRLKELIKKHSEFIGYDIELMVEKTTEKEVTDEDEEDTKKADEDGEEPKVEEVKE 240

Length = 701
>gnl|CDD|235366 PRK05218, PRK05218, heat shock protein 90; Provisional Back     alignment and domain information
>gnl|CDD|223403 COG0326, HtpG, Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185466 PTZ00130, PTZ00130, heat shock protein 90; Provisional Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|240341 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>gnl|CDD|237603 PRK14083, PRK14083, HSP90 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|223403 COG0326, HtpG, Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235366 PRK05218, PRK05218, heat shock protein 90; Provisional Back     alignment and domain information
>gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|185466 PTZ00130, PTZ00130, heat shock protein 90; Provisional Back     alignment and domain information
>gnl|CDD|222246 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 388
KOG0020|consensus 785 100.0
PTZ00272 701 heat shock protein 83 kDa (Hsp83); Provisional 100.0
PTZ00130 814 heat shock protein 90; Provisional 100.0
COG0326 623 HtpG Molecular chaperone, HSP90 family [Posttransl 100.0
KOG0019|consensus656 100.0
PRK05218 613 heat shock protein 90; Provisional 100.0
PRK14083 601 HSP90 family protein; Provisional 100.0
PF00183531 HSP90: Hsp90 protein; InterPro: IPR001404 Molecula 99.96
PF13589137 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and 99.72
TIGR00585312 mutl DNA mismatch repair protein MutL. All protein 99.64
COG0323 638 MutL DNA mismatch repair enzyme (predicted ATPase) 99.64
COG1389 538 DNA topoisomerase VI, subunit B [DNA replication, 99.59
PRK00095 617 mutL DNA mismatch repair protein; Reviewed 99.52
PRK04184 535 DNA topoisomerase VI subunit B; Validated 99.42
TIGR01052 488 top6b DNA topoisomerase VI, B subunit. This model 99.31
PRK14868 795 DNA topoisomerase VI subunit B; Provisional 99.28
KOG1979|consensus 694 99.18
KOG1978|consensus 672 99.02
PRK14867 659 DNA topoisomerase VI subunit B; Provisional 98.99
TIGR01055 625 parE_Gneg DNA topoisomerase IV, B subunit, proteob 98.99
PRK05559 631 DNA topoisomerase IV subunit B; Reviewed 98.96
TIGR01059 654 gyrB DNA gyrase, B subunit. This model describes t 98.88
smart00433 594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras 98.86
PRK05644 638 gyrB DNA gyrase subunit B; Validated 98.84
PRK14939 756 gyrB DNA gyrase subunit B; Provisional 98.76
PF02518111 HATPase_c: Histidine kinase-, DNA gyrase B-, and H 98.67
KOG1977|consensus 1142 98.33
cd00075103 HATPase_c Histidine kinase-like ATPases; This fami 97.99
TIGR01058 637 parE_Gpos DNA topoisomerase IV, B subunit, Gram-po 97.82
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine 97.68
PRK10755356 sensor protein BasS/PmrB; Provisional 97.6
PRK10604433 sensor protein RstB; Provisional 97.58
PRK11006430 phoR phosphate regulon sensor protein; Provisional 97.55
PRK10549466 signal transduction histidine-protein kinase BaeS; 97.5
PRK09470461 cpxA two-component sensor protein; Provisional 97.5
COG0187 635 GyrB Type IIA topoisomerase (DNA gyrase/topo II, t 97.45
PLN03237 1465 DNA topoisomerase 2; Provisional 97.44
TIGR02916679 PEP_his_kin putative PEP-CTERM system histidine ki 97.44
PLN03128 1135 DNA topoisomerase 2; Provisional 97.41
PRK09303380 adaptive-response sensory kinase; Validated 97.4
PRK11100475 sensory histidine kinase CreC; Provisional 97.36
COG3290537 CitA Signal transduction histidine kinase regulati 97.35
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 97.34
PTZ00108 1388 DNA topoisomerase 2-like protein; Provisional 97.33
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 97.31
PRK10364457 sensor protein ZraS; Provisional 97.29
PRK11466914 hybrid sensory histidine kinase TorS; Provisional 97.29
PRK15347921 two component system sensor kinase SsrA; Provision 97.26
TIGR01386457 cztS_silS_copS heavy metal sensor kinase. Members 97.23
PTZ00109 903 DNA gyrase subunit b; Provisional 97.23
PHA02569 602 39 DNA topoisomerase II large subunit; Provisional 97.22
PRK11086542 sensory histidine kinase DcuS; Provisional 97.2
PRK10618894 phosphotransfer intermediate protein in two-compon 97.19
TIGR02956968 TMAO_torS TMAO reductase sytem sensor TorS. This p 97.17
PRK10815485 sensor protein PhoQ; Provisional 97.14
PRK15053545 dpiB sensor histidine kinase DpiB; Provisional 97.14
PRK13837828 two-component VirA-like sensor kinase; Provisional 97.13
PRK09467435 envZ osmolarity sensor protein; Provisional 97.11
TIGR01925137 spIIAB anti-sigma F factor. This model describes t 97.09
PRK11091779 aerobic respiration control sensor protein ArcB; P 97.02
PRK11360607 sensory histidine kinase AtoS; Provisional 96.99
COG4191603 Signal transduction histidine kinase regulating C4 96.97
PRK10841924 hybrid sensory kinase in two-component regulatory 96.97
PRK03660146 anti-sigma F factor; Provisional 96.93
PRK10490895 sensor protein KdpD; Provisional 96.92
PRK04069161 serine-protein kinase RsbW; Provisional 96.88
COG0642336 BaeS Signal transduction histidine kinase [Signal 96.84
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 96.81
PRK09835482 sensor kinase CusS; Provisional 96.77
PRK10337449 sensor protein QseC; Provisional 96.77
TIGR03785703 marine_sort_HK proteobacterial dedicated sortase s 96.76
TIGR01924159 rsbW_low_gc serine-protein kinase RsbW. This model 96.54
PF13581125 HATPase_c_2: Histidine kinase-like ATPase domain 96.43
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 96.28
PRK13557540 histidine kinase; Provisional 95.96
PRK099591197 hybrid sensory histidine kinase in two-component r 95.85
PRK10547670 chemotaxis protein CheA; Provisional 95.8
COG4585365 Signal transduction histidine kinase [Signal trans 95.64
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 95.57
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Si 95.42
KOG0787|consensus414 94.92
COG3850574 NarQ Signal transduction histidine kinase, nitrate 94.87
COG4251750 Bacteriophytochrome (light-regulated signal transd 94.67
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein 94.04
COG3920221 Signal transduction histidine kinase [Signal trans 93.45
PRK11644495 sensory histidine kinase UhpB; Provisional 93.2
PRK13560807 hypothetical protein; Provisional 92.71
COG4192673 Signal transduction histidine kinase regulating ph 92.47
PRK10935565 nitrate/nitrite sensor protein NarQ; Provisional 92.32
COG2972456 Predicted signal transduction protein with a C-ter 92.32
COG0643716 CheA Chemotaxis protein histidine kinase and relat 91.58
KOG1845|consensus 775 90.88
COG5000712 NtrY Signal transduction histidine kinase involved 90.45
COG5002459 VicK Signal transduction histidine kinase [Signal 88.99
PRK13559361 hypothetical protein; Provisional 85.19
KOG0355|consensus 842 83.09
>KOG0020|consensus Back     alignment and domain information 
Probab=100.00  E-value=2e-72  Score=558.12  Aligned_cols=218  Identities=61%  Similarity=0.948  Sum_probs=205.0

Q ss_pred             CceeeeehhhHHHHHHHHHHhcCCCchHHHHHHHhchHhHhhhhhhhccCCCccccCCCcceEEEEEcCCCCEEEEEeCC
Q psy10019         19 DVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLESKKELEIKIIPDKESRTLTIIDSG   98 (388)
Q Consensus        19 ~~~~~~F~vd~~~ll~lL~~~LYs~~~~~lRELIqNA~DA~~~~r~~~~~~~~~~~~~~~~~I~I~~d~~~~~l~V~DNG   98 (388)
                      .++++.||++++||++||+++||+|+.+||||||+||.||..++|+.+++++..+.....+.|.|..|+.++.|.|.|.|
T Consensus        71 kaeKf~FQaEVnRmMklIINSLY~NKeIFLRELISNASDAlDKIRllaLtd~~~L~~~~el~ikIK~Dke~klLhi~DtG  150 (785)
T KOG0020|consen   71 KAEKFEFQAEVNRMMKLIINSLYRNKEIFLRELISNASDALDKIRLLALTDKDVLGETEELEIKIKADKEKKLLHITDTG  150 (785)
T ss_pred             HhhhhhHHHHHHHHHHHHHHHHhhhhHHHHHHHHhhhhhhhhheeeeeccChhHhCcCcceEEEEeechhhCeeeEeccc
Confidence            36899999999999999999999999999999999999999999999999999998889999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHhhccCchhHHHHHhcCCCC-----ccccccchhhhhhhhccCeEEEEeecCCCeeEEEEEecCCce
Q psy10019         99 IGMTKADLVNNLGTIAKSGTKAFMEALQAGADI-----SMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSF  173 (388)
Q Consensus        99 ~GMs~edl~~~l~~Ig~S~k~~f~~~~~~~~~~-----~~IG~FGIGf~S~F~v~d~v~V~Sk~~~~~~~~w~~~~~~~~  173 (388)
                      +|||++||.++|++||.||+..|.+++++..+.     ..|||||+||||+|+|+|+|.|+|+++++.+|.|+++.. .|
T Consensus       151 iGMT~edLi~NLGTIAkSGTs~Fl~Km~~~~~~~~~~~dlIGQFGVGFYsAfLVAD~vvVtsKhNdD~QyiWESdan-~F  229 (785)
T KOG0020|consen  151 IGMTREDLIKNLGTIAKSGTSEFLEKMQDSGDSEGLMNDLIGQFGVGFYSAFLVADRVVVTSKHNDDSQYIWESDAN-SF  229 (785)
T ss_pred             CCccHHHHHHhhhhhhcccHHHHHHHhhccccchhhHHHHHHhcchhhhhhhhhcceEEEEeccCCccceeeeccCc-ce
Confidence            999999999999999999999999999875443     789999999999999999999999999999999999874 89


Q ss_pred             eeecCC-CCCCCCCcEEEEEEeeCccccccHHHHHHHHHHhcccCCcceEEeeeeeeeeeccchh
Q psy10019        174 TIKPDH-GEQLGRGTKMVLYIKEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELEEDE  237 (388)
Q Consensus       174 ~i~~~~-~~~~~~GT~I~l~Lk~~~~e~~~~~~i~~~i~kys~~l~~PI~i~~~~~~~~~~~~~~  237 (388)
                      .|...+ ++..++||+|+|+|+++...|++.++++++|++|++|+.|||++|..++..+++|-+|
T Consensus       230 svseDprg~tL~RGt~ItL~LkeEA~dyLE~dtlkeLvkkYSqFINFpI~lWsSKt~~~E~pvEE  294 (785)
T KOG0020|consen  230 SVSEDPRGNTLGRGTEITLYLKEEAGDYLEEDTLKELVKKYSQFINFPISLWSSKTVEVEVPVEE  294 (785)
T ss_pred             eeecCCCCCcccCccEEEEEehhhhhhhcchhHHHHHHHHHHHhcCCceeeeeccceeeeccccc
Confidence            988765 5778999999999999999999999999999999999999999999999999888544

>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0019|consensus Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>PRK14083 HSP90 family protein; Provisional Back     alignment and domain information
>PF00183 HSP90: Hsp90 protein; InterPro: IPR001404 Molecular chaperones, or heat shock proteins (Hsps) are ubiquitous proteins that act to maintain proper protein folding within the cell [] Back     alignment and domain information
>PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>KOG1979|consensus Back     alignment and domain information
>KOG1978|consensus Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>PRK14939 gyrB DNA gyrase subunit B; Provisional Back     alignment and domain information
>PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>KOG1977|consensus Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit, Gram-positive Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03237 DNA topoisomerase 2; Provisional Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase Back     alignment and domain information
>PLN03128 DNA topoisomerase 2; Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PTZ00108 DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information
>PHA02569 39 DNA topoisomerase II large subunit; Provisional Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>TIGR01924 rsbW_low_gc serine-protein kinase RsbW Back     alignment and domain information
>PF13581 HATPase_c_2: Histidine kinase-like ATPase domain Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0787|consensus Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>KOG1845|consensus Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>KOG0355|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
3qdd_A237 Hsp90a N-Terminal Domain In Complex With Biib021 Le 7e-98
2fwy_A256 Structure Of Human Hsp90-Alpha Bound To The Potent 7e-98
2bsm_A235 Novel, Potent Small Molecule Inhibitors Of The Mole 7e-98
1uy6_A236 Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trimethoxy- 8e-98
3d0b_A232 Crystal Structure Of Benzamide Tetrahydro-4h-Carbaz 8e-98
2yi0_A229 Structural Characterization Of 5-Aryl-4-(5-Substitu 1e-97
3hhu_A224 Human Heat-Shock Protein 90 (Hsp90) In Complex With 1e-97
2ccs_A236 Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Yl-1h-Py 1e-97
1uyi_A236 Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benzyl)-2-F 2e-97
3b24_A229 Hsp90 Alpha N-Terminal Domain In Complex With An Am 2e-96
3r4m_A228 Optimization Of Potent, Selective, And Orally Bioav 2e-96
3ft5_A249 Structure Of Hsp90 Bound With A Novel Fragment Leng 2e-96
4egh_A232 Hsp90-Alpha Atpase Domain In Complex With (4-Hydrox 2e-96
4eeh_A229 Hsp90 Alpha N-Terminal Domain In Complex With An In 3e-96
4awo_A230 Complex Of Hsp90 Atpase Domain With Tropane Derived 3e-96
3k98_A232 Hsp90 N-Terminal Domain In Complex With (1r)-2-(5-C 3e-96
3eko_A226 Dihydroxylphenyl Amides As Inhibitors Of The Hsp90 3e-96
3inw_A228 Hsp90 N-Terminal Domain With Pochoxime A Length = 2 3e-96
2ye2_A252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 3e-96
3k97_A251 Hsp90 N-Terminal Domain In Complex With 4-Chloro-6- 3e-96
1byq_A228 Hsp90 N-Terminal Domain Bound To Adp-Mg Length = 22 4e-96
1osf_A215 Human Hsp90 In Complex With 17-desmethoxy-17-n,n- D 4e-96
2xjg_A249 Structure Of Hsp90 With Small Molecule Inhibitor Bo 5e-96
1yc1_A264 Crystal Structures Of Human Hsp90alpha Complexed Wi 6e-96
2ye7_A252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 6e-96
3bm9_A226 Discovery Of Benzisoxazoles As Potent Inhibitors Of 9e-96
3tuh_A209 Crystal Structure Of The N-Terminal Domain Of An Hs 1e-95
2xjj_A249 Structre Of Hsp90 With Small Molecule Inhibitor Bou 2e-95
2jjc_A218 Hsp90 Alpha Atpase Domain With Bound Small Molecule 2e-95
2yjw_A209 Tricyclic Series Of Hsp90 Inhibitors Length = 209 2e-95
2qfo_A207 Hsp90 Complexed With A143571 And A516383 Length = 2 2e-95
2k5b_A210 Human Cdc37-Hsp90 Docking Model Based On Nmr Length 2e-95
2xdu_A236 Structre Of Hsp90 With Small Molecule Inhibitor Bou 2e-95
2qf6_A207 Hsp90 Complexed With A56322 Length = 207 4e-95
2yee_A252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 5e-95
1uym_A220 Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-Trimetho 3e-93
3nmq_A239 Hsp90b N-Terminal Domain In Complex With Ec44, A Py 6e-93
2xcm_A214 Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord 1e-87
2jki_A223 Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Leng 2e-87
4gqt_A227 N-Terminal Domain Of C. Elegans Hsp90 Length = 227 4e-87
3h80_A231 Crystal Structure Of The Amino-Terminal Domain Of H 4e-83
3k60_A223 Crystal Structure Of N-Terminal Domain Of Plasmodiu 8e-82
3opd_A231 Crystal Structure Of The N-Terminal Domain Of An Hs 1e-80
3o6o_A214 Crystal Structure Of The N-Terminal Domain Of An Hs 4e-80
2cg9_A 677 Crystal Structure Of An Hsp90-Sba1 Closed Chaperone 3e-79
2cg9_A677 Crystal Structure Of An Hsp90-Sba1 Closed Chaperone 1e-17
2bre_A219 Structure Of A Hsp90 Inhibitor Bound To The N-Termi 3e-79
1us7_A214 Complex Of Hsp90 And P50 Length = 214 4e-79
1a4h_A230 Structure Of The N-Terminal Domain Of The Yeast Hsp 4e-79
2xx2_A214 Macrolactone Inhibitor Bound To Hsp90 N-Term Length 5e-79
2cgf_A225 A Radicicol Analogue Bound To The Atp Binding Site 5e-79
1am1_A213 Atp Binding Site In The Hsp90 Molecular Chaperone L 5e-79
1bgq_A225 Radicicol Bound To The Atp Binding Site Of The N-Te 5e-79
1ah8_A220 Structure Of The Orthorhombic Form Of The N-Termina 5e-79
1zw9_A240 Yeast Hsp82 In Complex With The Novel Hsp90 Inhibit 7e-79
2wep_A220 Yeast Hsp90 N-Terminal Domain Li-Iv Mutant With Adp 1e-78
2yge_A220 E88g-n92l Mutant Of N-term Hsp90 Complexed With Gel 3e-78
2ygf_A220 L89v, L93i And V136m Mutant Of N-term Hsp90 Complex 6e-78
3c0e_A240 Yeast Hsp82 N-Terminal Domain: Effects Of Mutants 9 9e-78
2yga_A220 E88g-n92l Mutant Of N-term Hsp90 Complexed With Gel 2e-77
2akp_A186 Hsp90 Delta24-n210 Mutant Length = 186 3e-68
3peh_A281 Crystal Structure Of The N-Terminal Domain Of An Hs 1e-62
1qy5_A269 Crystal Structure Of The N-Domain Of The Er Hsp90 C 1e-57
1u0y_A273 N-Domain Of Grp94, With The Charged Domain, In Comp 1e-57
1u2o_A236 Crystal Structure Of The N-Domain Of Grp94 Lacking 2e-57
2o1u_A 666 Structure Of Full Length Grp94 With Amp-Pnp Bound L 6e-57
2o1u_A666 Structure Of Full Length Grp94 With Amp-Pnp Bound L 2e-17
2o1w_A 506 Structure Of N-Terminal Plus Middle Domains (N+m) O 9e-57
2esa_A236 Grp94 N-Terminal Domain Bound To Geldanamycin: Effe 3e-56
1y4s_A 559 Conformation Rearrangement Of Heat Shock Protein 90 2e-47
2iop_A 624 Crystal Structure Of Full-Length Htpg, The Escheric 2e-47
2ior_A235 Crystal Structure Of The N-Terminal Domain Of Htpg, 2e-47
3q6m_A448 Crystal Structure Of Human Mc-Hsp90 In C2221 Space 9e-47
3ied_A272 Crystal Structure Of N-Terminal Domain Of Plasmodiu 2e-42
3hjc_A444 Crystal Structure Of The Carboxy-Terminal Domain Of 4e-24
2o1t_A450 Structure Of Middle Plus C-Terminal Domains (M+c) O 8e-18
2cge_A405 Crystal Structure Of An Hsp90-Sba1 Closed Chaperone 1e-17
>pdb|3QDD|A Chain A, Hsp90a N-Terminal Domain In Complex With Biib021 Length = 237 Back     alignment and structure 
Iteration: 1

 Score =  353 bits (907), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 191/223 (85%)
Query: 3   YQPQRMPEQDVSMAQGDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKI 62
           + P+    QD  M + +VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKI
Sbjct: 1   HMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKI 60
Query: 63  RYESLTDPSRLESKKELEIKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFM 122
           RYESLTDPS+L+S KEL I +IP+K+ RTLTI+D+GIGMTKADL+NNLGTIAKSGTKAFM
Sbjct: 61  RYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFM 120
Query: 123 EALQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQ 182
           EALQAGADISMIGQFGVGFYSAYLVA+KVTV +KHNDDEQY WESSAGGSFT++ D GE 
Sbjct: 121 EALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEP 180
Query: 183 LGRGTKMVLYIKEDQAEYLXXXXXXXXXXXHSQFIGYPIKLLV 225
           +GRGTK++L++KEDQ EYL           HSQFIGYPI L V
Sbjct: 181 MGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFV 223
>pdb|2FWY|A Chain A, Structure Of Human Hsp90-Alpha Bound To The Potent Water Soluble Inhibitor Pu-H64 Length = 256 Back     alignment and structure
>pdb|2BSM|A Chain A, Novel, Potent Small Molecule Inhibitors Of The Molecular Chaperone Hsp90 Discovered Through Structure-Based Design Length = 235 Back     alignment and structure
>pdb|1UY6|A Chain A, Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trimethoxy-Benzyl)-9h-Purin-6-Ylamine Length = 236 Back     alignment and structure
>pdb|3D0B|A Chain A, Crystal Structure Of Benzamide Tetrahydro-4h-Carbazol-4-One Bound To Hsp90 Length = 232 Back     alignment and structure
>pdb|2YI0|A Chain A, Structural Characterization Of 5-Aryl-4-(5-Substituted-2-4- Dihydroxyphenyl)-1,2,3-Thiadiazole Hsp90 Inhibitors. Length = 229 Back     alignment and structure
>pdb|3HHU|A Chain A, Human Heat-Shock Protein 90 (Hsp90) In Complex With {4-[3- (2,4-Dihydroxy-5-Isopropyl-Phenyl)-5-Thioxo- 1,5-Dihydro- [1,2,4]triazol-4-Yl]-Benzyl}-Carbamic Acid Ethyl Ester {zk 2819} Length = 224 Back     alignment and structure
>pdb|2CCS|A Chain A, Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Yl-1h-Pyrazol-3- Yl)-Benzene-1,2-Diol Length = 236 Back     alignment and structure
>pdb|1UYI|A Chain A, Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benzyl)-2-Fluoro-9- Pent-9h-Purin-6-Ylamine Length = 236 Back     alignment and structure
>pdb|3B24|A Chain A, Hsp90 Alpha N-Terminal Domain In Complex With An Aminotriazine Fragment Molecule Length = 229 Back     alignment and structure
>pdb|3R4M|A Chain A, Optimization Of Potent, Selective, And Orally Bioavailable Pyrrolodinopyrimidine-Containing Inhibitors Of Heat Shock Protein 90. Identification Of Development Candidate 2-Amino-4-{4-Chloro-2-[2-(4- Fluoro-1h-Pyrazol-1-Yl)ethoxy]-6-Methylphenyl}-N-(2,2- Difluoropropyl)-5,7-Dihydro-6h-Pyrrolo[3, 4-D]pyrimidine-6-Carboxamide Length = 228 Back     alignment and structure
>pdb|3FT5|A Chain A, Structure Of Hsp90 Bound With A Novel Fragment Length = 249 Back     alignment and structure
>pdb|4EGH|A Chain A, Hsp90-Alpha Atpase Domain In Complex With (4-Hydroxyphenyl)morpholin- 4-Yl Methanone Length = 232 Back     alignment and structure
>pdb|4EEH|A Chain A, Hsp90 Alpha N-Terminal Domain In Complex With An Inhibitor 3-(4- Hydroxy-Phenyl)-1h-Indazol-6-Ol Length = 229 Back     alignment and structure
>pdb|4AWO|A Chain A, Complex Of Hsp90 Atpase Domain With Tropane Derived Inhibitors Length = 230 Back     alignment and structure
>pdb|3K98|A Chain A, Hsp90 N-Terminal Domain In Complex With (1r)-2-(5-Chloro-2, 4-Dihydroxybenzoyl)-N-Ethylisoindoline-1-Carboxamide Length = 232 Back     alignment and structure
>pdb|3EKO|A Chain A, Dihydroxylphenyl Amides As Inhibitors Of The Hsp90 Molecular Chaperone Length = 226 Back     alignment and structure
>pdb|3INW|A Chain A, Hsp90 N-Terminal Domain With Pochoxime A Length = 228 Back     alignment and structure
>pdb|2YE2|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|3K97|A Chain A, Hsp90 N-Terminal Domain In Complex With 4-Chloro-6-{[(2r)-2- (2-Methylphenyl)pyrrolidin-1-Yl]carbonyl}benzene-1, 3-Diol Length = 251 Back     alignment and structure
>pdb|1BYQ|A Chain A, Hsp90 N-Terminal Domain Bound To Adp-Mg Length = 228 Back     alignment and structure
>pdb|1OSF|A Chain A, Human Hsp90 In Complex With 17-desmethoxy-17-n,n- Dimethylaminoethylamino-geldanamycin Length = 215 Back     alignment and structure
>pdb|2XJG|A Chain A, Structure Of Hsp90 With Small Molecule Inhibitor Bound Length = 249 Back     alignment and structure
>pdb|1YC1|A Chain A, Crystal Structures Of Human Hsp90alpha Complexed With Dihydroxyphenylpyrazoles Length = 264 Back     alignment and structure
>pdb|2YE7|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|3BM9|A Chain A, Discovery Of Benzisoxazoles As Potent Inhibitors Of Chaperone Hsp90 Length = 226 Back     alignment and structure
>pdb|3TUH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 In The Presence Of An The Inhibitor Ganetespib Length = 209 Back     alignment and structure
>pdb|2XJJ|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound Length = 249 Back     alignment and structure
>pdb|2JJC|A Chain A, Hsp90 Alpha Atpase Domain With Bound Small Molecule Fragment Length = 218 Back     alignment and structure
>pdb|2YJW|A Chain A, Tricyclic Series Of Hsp90 Inhibitors Length = 209 Back     alignment and structure
>pdb|2QFO|A Chain A, Hsp90 Complexed With A143571 And A516383 Length = 207 Back     alignment and structure
>pdb|2K5B|A Chain A, Human Cdc37-Hsp90 Docking Model Based On Nmr Length = 210 Back     alignment and structure
>pdb|2XDU|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound Length = 236 Back     alignment and structure
>pdb|2QF6|A Chain A, Hsp90 Complexed With A56322 Length = 207 Back     alignment and structure
>pdb|2YEE|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|1UYM|A Chain A, Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-Trimethoxy-Benzyl)-9h-Purin-6-Ylamine) Length = 220 Back     alignment and structure
>pdb|3NMQ|A Chain A, Hsp90b N-Terminal Domain In Complex With Ec44, A Pyrrolo-Pyrimidine Methoxypyridine Inhibitor Length = 239 Back     alignment and structure
>pdb|2XCM|A Chain A, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 Domain Length = 214 Back     alignment and structure
>pdb|2JKI|A Chain A, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Length = 223 Back     alignment and structure
>pdb|4GQT|A Chain A, N-Terminal Domain Of C. Elegans Hsp90 Length = 227 Back     alignment and structure
>pdb|3H80|A Chain A, Crystal Structure Of The Amino-Terminal Domain Of Hsp90 From Leishmania Major, Lmjf33.0312:m1-K213 Length = 231 Back     alignment and structure
>pdb|3K60|A Chain A, Crystal Structure Of N-Terminal Domain Of Plasmodium Falciparum Hsp90 (Pf07_0029) Bound To Adp Length = 223 Back     alignment and structure
>pdb|3OPD|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Trypanosoma Brucei, Tb10.26.1080 In The Presence Of A Benzamide Derivative Length = 231 Back     alignment and structure
>pdb|3O6O|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Trypanosoma Brucei, Tb10.26.1080 In The Presence Of An The Inhibitor Biib021 Length = 214 Back     alignment and structure
>pdb|2CG9|A Chain A, Crystal Structure Of An Hsp90-Sba1 Closed Chaperone Complex Length = 677 Back     alignment and structure
>pdb|2CG9|A Chain A, Crystal Structure Of An Hsp90-Sba1 Closed Chaperone Complex Length = 677 Back     alignment and structure
>pdb|2BRE|A Chain A, Structure Of A Hsp90 Inhibitor Bound To The N-Terminus Of Yeast Hsp90. Length = 219 Back     alignment and structure
>pdb|1US7|A Chain A, Complex Of Hsp90 And P50 Length = 214 Back     alignment and structure
>pdb|1A4H|A Chain A, Structure Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone In Complex With Geldanamycin Length = 230 Back     alignment and structure
>pdb|2XX2|A Chain A, Macrolactone Inhibitor Bound To Hsp90 N-Term Length = 214 Back     alignment and structure
>pdb|2CGF|A Chain A, A Radicicol Analogue Bound To The Atp Binding Site Of The N- Terminal Domain Of The Yeast Hsp90 Chaperone Length = 225 Back     alignment and structure
>pdb|1AM1|A Chain A, Atp Binding Site In The Hsp90 Molecular Chaperone Length = 213 Back     alignment and structure
>pdb|1BGQ|A Chain A, Radicicol Bound To The Atp Binding Site Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone Length = 225 Back     alignment and structure
>pdb|1AH8|A Chain A, Structure Of The Orthorhombic Form Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone Length = 220 Back     alignment and structure
>pdb|1ZW9|A Chain A, Yeast Hsp82 In Complex With The Novel Hsp90 Inhibitor 8-(6-Bromo- Benzo[1, 3]dioxol-5-Ylsulfanyl)-9-(3-Isopropylamino-Propyl)- Adenine Length = 240 Back     alignment and structure
>pdb|2WEP|A Chain A, Yeast Hsp90 N-Terminal Domain Li-Iv Mutant With Adp Length = 220 Back     alignment and structure
>pdb|2YGE|A Chain A, E88g-n92l Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|2YGF|A Chain A, L89v, L93i And V136m Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|3C0E|A Chain A, Yeast Hsp82 N-Terminal Domain: Effects Of Mutants 98-99 Ks- Aa Length = 240 Back     alignment and structure
>pdb|2YGA|A Chain A, E88g-n92l Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|2AKP|A Chain A, Hsp90 Delta24-n210 Mutant Length = 186 Back     alignment and structure
>pdb|3PEH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Plasmodium Falciparum, Pfl1070c In The Presence Of A Thienopyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1QY5|A Chain A, Crystal Structure Of The N-Domain Of The Er Hsp90 Chaperone Grp94 In Complex With The Specific Ligand Neca Length = 269 Back     alignment and structure
>pdb|1U0Y|A Chain A, N-Domain Of Grp94, With The Charged Domain, In Complex With The Novel Ligand N-Propyl Carboxyamido Adenosine Length = 273 Back     alignment and structure
>pdb|1U2O|A Chain A, Crystal Structure Of The N-Domain Of Grp94 Lacking The Charged Domain In Complex With Neca Length = 236 Back     alignment and structure
>pdb|2O1U|A Chain A, Structure Of Full Length Grp94 With Amp-Pnp Bound Length = 666 Back     alignment and structure
>pdb|2O1U|A Chain A, Structure Of Full Length Grp94 With Amp-Pnp Bound Length = 666 Back     alignment and structure
>pdb|2O1W|A Chain A, Structure Of N-Terminal Plus Middle Domains (N+m) Of Grp94 Length = 506 Back     alignment and structure
>pdb|2ESA|A Chain A, Grp94 N-Terminal Domain Bound To Geldanamycin: Effects Of Mutants 168- 169 Ks-Aa Length = 236 Back     alignment and structure
>pdb|1Y4S|A Chain A, Conformation Rearrangement Of Heat Shock Protein 90 Upon Adp Binding Length = 559 Back     alignment and structure
>pdb|2IOP|A Chain A, Crystal Structure Of Full-Length Htpg, The Escherichia Coli Hsp90, Bound To Adp Length = 624 Back     alignment and structure
>pdb|2IOR|A Chain A, Crystal Structure Of The N-Terminal Domain Of Htpg, The Escherichia Coli Hsp90, Bound To Adp Length = 235 Back     alignment and structure
>pdb|3Q6M|A Chain A, Crystal Structure Of Human Mc-Hsp90 In C2221 Space Group Length = 448 Back     alignment and structure
>pdb|3IED|A Chain A, Crystal Structure Of N-Terminal Domain Of Plasmodium Falciparum Hsp90 (Pf14_0417) In Complex With Amppn Length = 272 Back     alignment and structure
>pdb|3HJC|A Chain A, Crystal Structure Of The Carboxy-Terminal Domain Of Hsp90 From Leishmania Major, Lmjf33.0312 Length = 444 Back     alignment and structure
>pdb|2O1T|A Chain A, Structure Of Middle Plus C-Terminal Domains (M+c) Of Grp94 Length = 450 Back     alignment and structure
>pdb|2CGE|A Chain A, Crystal Structure Of An Hsp90-Sba1 Closed Chaperone Complex Length = 405 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query388
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 1e-160
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 1e-160
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 1e-159
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 1e-159
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 1e-156
3peh_A281 Endoplasmin homolog; structural genomics, structur 1e-156
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 1e-155
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 1e-154
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 1e-140
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 1e-136
2cg9_A677 ATP-dependent molecular chaperone HSP82; chaperone 2e-34
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 1e-132
2o1u_A666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 2e-37
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone 1e-123
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 1e-123
2ioq_A624 Chaperone protein HTPG; heat shock protein, HSP90; 2e-22
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 1e-121
3q6m_A448 Heat shock protein HSP 90-alpha; three domains, tr 1e-53
3hjc_A444 Heat shock protein 83-1; sleeping sickness, struct 7e-48
2cge_A405 ATP-dependent molecular chaperone HSP82; chaperone 6e-42
1sf8_A126 Chaperone protein HTPG; four helix bundle dimeriza 5e-29
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Length = 264 Back     alignment and structure
 Score =  449 bits (1156), Expect = e-160
 Identities = 185/229 (80%), Positives = 210/229 (91%)

Query: 11  QDVSMAQGDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDP 70
            D  M + +VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYE+LTDP
Sbjct: 36  SDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYETLTDP 95

Query: 71  SRLESKKELEIKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGAD 130
           S+L+S KEL I +IP+K+ RTLTI+D+GIGMTKADL+NNLGTIAKSGTKAFMEALQAGAD
Sbjct: 96  SKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGAD 155

Query: 131 ISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMV 190
           ISMIGQFGVGFYSAYLVA+KVTV +KHNDDEQY WESSAGGSFT++ D GE +GRGTK++
Sbjct: 156 ISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVI 215

Query: 191 LYIKEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELEEDEEE 239
           L++KEDQ EYLEE++IKEIVKKHSQFIGYPI L VEKER+KE+ +DE E
Sbjct: 216 LHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAE 264
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Length = 228 Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Length = 256 Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} Length = 239 Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Length = 220 Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Length = 281 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Length = 236 Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Length = 235 Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 677 Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 677 Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Length = 666 Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Length = 666 Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Length = 559 Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Length = 624 Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Length = 624 Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Length = 272 Back     alignment and structure
>3q6m_A Heat shock protein HSP 90-alpha; three domains, trimer of dimer, hexamer, chaperone; 3.00A {Homo sapiens} PDB: 3q6n_A Length = 448 Back     alignment and structure
>3hjc_A Heat shock protein 83-1; sleeping sickness, structura genomics, stress response protein, chaperone, structural GE consortium, SGC; 2.50A {Leishmania major} Length = 444 Back     alignment and structure
>2cge_A ATP-dependent molecular chaperone HSP82; chaperone complex, heat shock protein, CO-chaperone, ATP-binding, heat shock; 3.0A {Saccharomyces cerevisiae} Length = 405 Back     alignment and structure
>1sf8_A Chaperone protein HTPG; four helix bundle dimerization interface, exposed amphipathic helix, three stranded beta sheet; 2.60A {Escherichia coli} SCOP: d.271.1.1 Length = 126 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 100.0
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 100.0
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 100.0
3peh_A281 Endoplasmin homolog; structural genomics, structur 100.0
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 100.0
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 100.0
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 100.0
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 100.0
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 100.0
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 100.0
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 100.0
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 100.0
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone 100.0
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 100.0
3q6m_A448 Heat shock protein HSP 90-alpha; three domains, tr 99.95
1sf8_A126 Chaperone protein HTPG; four helix bundle dimeriza 99.92
3hjc_A444 Heat shock protein 83-1; sleeping sickness, struct 99.91
2cge_A405 ATP-dependent molecular chaperone HSP82; chaperone 99.86
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 99.77
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 99.7
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA 99.69
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein hom 99.63
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B 99.43
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 99.25
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 99.21
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 99.17
1s16_A390 Topoisomerase IV subunit B; two-domain protein com 99.14
4duh_A220 DNA gyrase subunit B; structure-based drug design, 99.1
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 99.09
1zxm_A400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozy 99.07
4emv_A226 DNA topoisomerase IV, B subunit; protein-inhibitor 99.06
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 99.0
3cwv_A369 DNA gyrase, B subunit, truncated; structural genom 98.98
3lnu_A408 Topoisomerase IV subunit B; PARE, ATP-binding, nuc 98.8
3ttz_A198 DNA gyrase subunit B; protein-inhibitor complex, A 98.69
1pvg_A418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA 98.55
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 98.07
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 97.93
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 97.87
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 97.79
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 97.77
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 97.77
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 97.75
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 97.73
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 97.7
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 97.68
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, G 97.68
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 97.68
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 97.66
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 97.65
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 97.62
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 97.62
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 97.61
4gfh_A 1177 DNA topoisomerase 2; topoisomerase, protein-DNA co 97.6
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 97.51
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, t 97.42
3zxo_A129 Redox sensor histidine kinase response regulator; 97.32
1b3q_A379 Protein (chemotaxis protein CHEA); histine kinase, 97.23
3zxq_A124 Hypoxia sensor histidine kinase response regulato; 97.15
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 96.87
4fpp_A247 Phosphotransferase; four helix bundle, bergerat fo 96.06
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-si 93.39
1ixm_A192 SPO0B, protein (sporulation response regulatory pr 84.92
1y4s_A559 Chaperone protein HTPG; HSP90, molecular chaperone 83.39
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=1e-66  Score=551.88  Aligned_cols=209  Identities=72%  Similarity=1.110  Sum_probs=192.5

Q ss_pred             ceeeeehhhHHHHHHHHHHhcCCCchHHHHHHHhchHhHhhhhhhhccCCCccccCCCcceEEEEEcCCCCEEEEEeCCC
Q psy10019         20 VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLESKKELEIKIIPDKESRTLTIIDSGI   99 (388)
Q Consensus        20 ~~~~~F~vd~~~ll~lL~~~LYs~~~~~lRELIqNA~DA~~~~r~~~~~~~~~~~~~~~~~I~I~~d~~~~~l~V~DNG~   99 (388)
                      .+++.||+++++|+++|+++||+|+.+|||||||||+||++++||.++++++.+...+.++|+|.++.++.+|+|.|||+
T Consensus         3 ~e~~~Fqae~~~Ll~li~~sLYsnkeifLRELIsNA~DA~~k~r~~~ltd~~~~~~~~~~~I~I~~d~~~~~I~I~DnGi   82 (677)
T 2cg9_A            3 SETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKSLSDPKQLETEPDLFIRITPKPEQKVLEIRDSGI   82 (677)
T ss_dssp             CEEEECCCCHHHHHHHHHHSCCSCTTHHHHHHHHHHHHHHHHHHHHTSSCTTTTTTCCCCCEEEEEEGGGTEEEEEECSC
T ss_pred             ccceehhhhHHHHHHHHHHhCCCCchHHHHHHhhCHHHHHHHHHHHhccChhhccCCCCcEEEEEEeCCCCEEEEEECCC
Confidence            48899999999999999999999999999999999999999999999999988777777899999988889999999999


Q ss_pred             CCCHHHHHHHHHHhhccCchhHHHHHhcCCCCccccccchhhhhhhhccCeEEEEeecCCCeeEEEEEecCCceeeecCC
Q psy10019        100 GMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDH  179 (388)
Q Consensus       100 GMs~edl~~~l~~Ig~S~k~~f~~~~~~~~~~~~IG~FGIGf~S~F~v~d~v~V~Sk~~~~~~~~w~~~~~~~~~i~~~~  179 (388)
                      |||+++|.++|++||+||++.|+++++...+...||||||||||+|++|++|+|+|++.++.+|.|.+.+++.|++.+..
T Consensus        83 GMt~edl~~~l~tIA~Sgt~~f~~kl~~~~d~~~IGqFGvGFySaf~vadkV~V~Sk~~~~~~~~W~s~g~~~~ti~~~~  162 (677)
T 2cg9_A           83 GMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKSNDDEQYIWESNAGGSFTVTLDE  162 (677)
T ss_dssp             CCCHHHHHGGGSSSSSCTTHHHHSCCCSSCCCCCCCCTTCTTGGGGGTEEEEEEEEECTTSCEEEEEECSSSEEEEEECC
T ss_pred             CCCHHHHHHHHHhHhccccHHHHHhhhcccchhhcCCCCchhHHHhhcCcEEEEEEccCCCceEEEEEcCCceEEEeecC
Confidence            99999999999999999999998777655567899999999999999999999999998878999999999999998742


Q ss_pred             -CCCCCCCcEEEEEEeeCccccccHHHHHHHHHHhcccCCcceEEeeeee
Q psy10019        180 -GEQLGRGTKMVLYIKEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKE  228 (388)
Q Consensus       180 -~~~~~~GT~I~l~Lk~~~~e~~~~~~i~~~i~kys~~l~~PI~i~~~~~  228 (388)
                       +....+||+|+|+|++++.+|++.++|+++|++||+|++|||+++.+++
T Consensus       163 ~~~~~~~GT~I~L~Lk~d~~e~l~~~~i~~lvkkys~fi~~PI~l~~~k~  212 (677)
T 2cg9_A          163 VNERIGRGTILRLFLKDDQLEYLEEKRIKEVIKRHSEFVAYPIQLVVTKE  212 (677)
T ss_dssp             SSCCCSSEEEEEEEECTTGGGGGCHHHHHHHHHHHSTTCSSCEEECCCCC
T ss_pred             CCCCCCCCeEEEEEEcchhhccccHHHHHHHHHHHHhhCCCCeEEeeccc
Confidence             2456899999999999999999999999999999999999999975444
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>3q6m_A Heat shock protein HSP 90-alpha; three domains, trimer of dimer, hexamer, chaperone; 3.00A {Homo sapiens} PDB: 3q6n_A Back     alignment and structure
>1sf8_A Chaperone protein HTPG; four helix bundle dimerization interface, exposed amphipathic helix, three stranded beta sheet; 2.60A {Escherichia coli} SCOP: d.271.1.1 Back     alignment and structure
>3hjc_A Heat shock protein 83-1; sleeping sickness, structura genomics, stress response protein, chaperone, structural GE consortium, SGC; 2.50A {Leishmania major} Back     alignment and structure
>2cge_A ATP-dependent molecular chaperone HSP82; chaperone complex, heat shock protein, CO-chaperone, ATP-binding, heat shock; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} Back     alignment and structure
>3lnu_A Topoisomerase IV subunit B; PARE, ATP-binding, nucleotide-BI topoisomerase; 2.20A {Xanthomonas oryzae PV} PDB: 3lps_A* Back     alignment and structure
>3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>4gfh_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, DNA supercoiling, DNA replication; HET: DNA PTR TSP ANP; 4.41A {Saccharomyces cerevisiae} Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A Back     alignment and structure
>3zxq_A Hypoxia sensor histidine kinase response regulato; transferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>4fpp_A Phosphotransferase; four helix bundle, bergerat fold, CCKA, CTRA, CPDR, bacterial cytoplasme; 2.20A {Caulobacter crescentus} PDB: 4fmt_A Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 388
d2gqpa1227 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) 1e-76
d1uyla_208 d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 8e-76
d2iwxa1213 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharo 6e-74
d1sf8a_115 d.271.1.1 (A:) Chaperone protein HtpG {Escherichia 1e-18
d2hkja3219 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A 0.004
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Length = 227 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Heat shock protein 90, HSP90, N-terminal domain
domain: HSP90
species: Dog (Canis familiaris) [TaxId: 9615]

 Score =  234 bits (598), Expect = 1e-76
 Identities = 118/224 (52%), Positives = 149/224 (66%), Gaps = 5/224 (2%)

Query: 21  ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLESKKELE 80
           E FAFQAE+ ++M LIIN+ Y NKEIFLRELISN+SDALDKIR  SLTD + L   +EL 
Sbjct: 1   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELT 60

Query: 81  IKIIPDKESRTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAG-----ADISMIG 135
           +KI  DKE   L + D+G+GMT+ +LV NLGTIAKSGT  F+  +        +   +IG
Sbjct: 61  VKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIG 120

Query: 136 QFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTIKPDHGEQLGRGTKMVLYIKE 195
           QFGVGFYSA+LVADKV V SKHN+D Q+IWES +     I    G  LGRGT + L +KE
Sbjct: 121 QFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKE 180

Query: 196 DQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELEEDEEE 239
           + ++YLE   IK +VKK+SQFI +PI +   K         + E
Sbjct: 181 EASDYLELDTIKNLVKKYSQFINFPIYVWSSKTGGGGKTVWDWE 224
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 213 Back     information, alignment and structure
>d1sf8a_ d.271.1.1 (A:) Chaperone protein HtpG {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query388
d2gqpa1227 HSP90 {Dog (Canis familiaris) [TaxId: 9615]} 100.0
d1uyla_208 HSP90 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2iwxa1213 HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1sf8a_115 Chaperone protein HtpG {Escherichia coli [TaxId: 5 99.91
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapi 99.68
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli 99.65
d2hkja3219 Topoisomerase VI-B subunit {Archaeon Sulfolobus sh 99.53
d1pvga2239 DNA topoisomerase II {Baker's yeast (Saccharomyces 98.6
d1kija2212 DNA gyrase B {Thermus thermophilus [TaxId: 274]} 98.5
d1ei1a2219 DNA gyrase B {Escherichia coli [TaxId: 562]} 98.47
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium t 98.11
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegi 98.11
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Es 98.07
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [Ta 98.02
d1th8a_139 Anti-sigma factor spoIIab {Bacillus stearothermoph 98.01
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritim 97.97
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase 97.91
d1y8oa2125 Pyruvate dehydrogenase kinase {Human (Homo sapiens 97.82
d1s14a_168 Topoisomerase IV subunit B {Escherichia coli [TaxI 97.41
d1r62a_156 Nitrogen regulation protein NtrB, C-terminal domai 96.88
d1ixma_179 Sporulation response regulatory protein Spo0B {Bac 96.71
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Heat shock protein 90, HSP90, N-terminal domain
domain: HSP90
species: Dog (Canis familiaris) [TaxId: 9615]

Probab=100.00  E-value=1.5e-54  Score=404.17  Aligned_cols=208  Identities=56%  Similarity=0.860  Sum_probs=177.6

Q ss_pred             eeeeehhhHHHHHHHHHHhcCCCchHHHHHHHhchHhHhhhhhhhccCCCccccCCCcceEEEEEcCCCCEEEEEeCCCC
Q psy10019         21 ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSRLESKKELEIKIIPDKESRTLTIIDSGIG  100 (388)
Q Consensus        21 ~~~~F~vd~~~ll~lL~~~LYs~~~~~lRELIqNA~DA~~~~r~~~~~~~~~~~~~~~~~I~I~~d~~~~~l~V~DNG~G  100 (388)
                      |++.||+|+++||+||+++||+||.+|||||||||+|||.++|+..+..+.......++.|.+..+.+.++|+|+|||+|
T Consensus         1 e~~~Fq~e~~~ll~ll~~sLYs~~~iflRELiqNA~DA~~k~r~~~~~~~~~~~~~~~~~i~i~~d~~~~~l~i~DnGiG   80 (227)
T d2gqpa1           1 EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVG   80 (227)
T ss_dssp             TEECCCHHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHHHHHHHHHHHHCTTTTTTCCCCCEEEEEETTTTEEEEEECSCC
T ss_pred             CceeeehhHHHHHHHHHhcccCCCchhHHHHHhhHHHHHHHHHHHhccCcccccccchhhhhcccCCCCcEEEEEecCcc
Confidence            57999999999999999999999999999999999999999999888777766666778999999999999999999999


Q ss_pred             CCHHHHHHHHHHhhccCchhHHHHHhc-----CCCCccccccchhhhhhhhccCeEEEEeecCCCeeEEEEEecCCceee
Q psy10019        101 MTKADLVNNLGTIAKSGTKAFMEALQA-----GADISMIGQFGVGFYSAYLVADKVTVHSKHNDDEQYIWESSAGGSFTI  175 (388)
Q Consensus       101 Ms~edl~~~l~~Ig~S~k~~f~~~~~~-----~~~~~~IG~FGIGf~S~F~v~d~v~V~Sk~~~~~~~~w~~~~~~~~~i  175 (388)
                      ||+++|.++|++||.|+++.|.++++.     .....+|||||||||||||||++|+|+|++.++.++.|.+.+.+.|.+
T Consensus        81 Mt~~e~~~~lgtIa~Sgt~~f~~~~~~~~~~~~~~~~~IGqFGvGfyS~FmVad~V~v~s~~~~~~~~~W~s~g~~~~~i  160 (227)
T d2gqpa1          81 MTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVI  160 (227)
T ss_dssp             CCHHHHHHHHHCC---------------------CHHHHHHTTCGGGGGGGTEEEEEEEEECTTSCCEEEEESSSCEEEE
T ss_pred             ccHHHHHHHHHHHhhcchHHHHHhhhhcccccccchhhhhhcCcceeEEEeeeeeEEEEEeccCCcccEEEecCCCceec
Confidence            999999999999999999999876642     123468999999999999999999999999888899999998888998


Q ss_pred             ecCCCCCCCCCcEEEEEEeeCccccccHHHHHHHHHHhcccCCcceEEeeeee
Q psy10019        176 KPDHGEQLGRGTKMVLYIKEDQAEYLEEKKIKEIVKKHSQFIGYPIKLLVEKE  228 (388)
Q Consensus       176 ~~~~~~~~~~GT~I~l~Lk~~~~e~~~~~~i~~~i~kys~~l~~PI~i~~~~~  228 (388)
                      ...+.....+||+|+|||+++..+|++.++|+++|++||.||+|||+|+.+++
T Consensus       161 ~~~~~~~~~rGT~I~L~Lk~d~~efl~~~rl~~iIkkYs~fI~~PI~l~~~k~  213 (227)
T d2gqpa1         161 ADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKT  213 (227)
T ss_dssp             ECTTCSCSSSEEEEEEEECGGGGGGGCHHHHHHHHHHHHTTCSSCEEEEEECC
T ss_pred             ccccccccccceEEEEEecccchhhcCHHHHHHHHHHHhcCCCCCeEeCcccc
Confidence            77545567789999999999999999999999999999999999999987654
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sf8a_ d.271.1.1 (A:) Chaperone protein HtpG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure