Psyllid ID: psy10072


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHIQQMLEIGHNMS
ccccccccccccccccccccccHHccccHHHHHHHHcccccccccccccccccccHHHHHccccccccccccHHccccHHHHcc
HHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccccHHHHccEEEEEccccc
mrnhirthtgekpykctfcpftaahsstMSYHLRIHqdlkvkcphcaykcvkqkdlnthierrhmpgdvLGHIQQMLEIGHNMS
mrnhirthtgekpykctFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHIQQMLEIGHNMS
MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHIQQMLEIGHNMS
************PYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVK********************************
MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHIQQMLEIGHN**
********TGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHIQQMLEIGHNMS
MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHIQQMLEIG****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooo
iiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHIQQMLEIGHNMS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query84 2.2.26 [Sep-21-2011]
Q7TS63 1237 Zinc finger protein ZFAT yes N/A 0.738 0.050 0.406 2e-09
Q9P243 1243 Zinc finger protein ZFAT no N/A 0.738 0.049 0.406 3e-09
O54963 1069 RE1-silencing transcripti no N/A 0.726 0.057 0.387 5e-09
P52746 1687 Zinc finger protein 142 O no N/A 0.702 0.034 0.466 9e-09
Q6DBW0 419 Zinc finger protein Pegas no N/A 0.726 0.145 0.435 2e-08
Q9JKD9465 Zinc finger and BTB domai no N/A 0.773 0.139 0.393 2e-08
Q13127 1097 RE1-silencing transcripti no N/A 0.726 0.055 0.387 3e-08
Q5ZLR2 421 Zinc finger protein Pegas no N/A 0.726 0.144 0.419 6e-08
Q9NPA5 681 Zinc finger protein 64 ho no N/A 0.797 0.098 0.442 7e-08
A4IFJ6 419 Zinc finger protein Pegas no N/A 0.726 0.145 0.419 7e-08
>sp|Q7TS63|ZFAT_MOUSE Zinc finger protein ZFAT OS=Mus musculus GN=Zfat PE=1 SV=2 Back     alignment and function desciption
 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 40/64 (62%)

Query: 1   MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHI 60
           ++ H+R HT EKPYKC+ C + +A  + ++ HLR H   K  C +C++ C+ +  L  HI
Sbjct: 286 LQAHLRIHTNEKPYKCSQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHI 345

Query: 61  ERRH 64
           ER H
Sbjct: 346 ERVH 349




May be involved in transcriptional regulation. Overexpression causes down-regulation of a number of genes involved in the immune response. Some genes are also up-regulated.
Mus musculus (taxid: 10090)
>sp|Q9P243|ZFAT_HUMAN Zinc finger protein ZFAT OS=Homo sapiens GN=ZFAT PE=1 SV=2 Back     alignment and function description
>sp|O54963|REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus GN=Rest PE=2 SV=1 Back     alignment and function description
>sp|P52746|ZN142_HUMAN Zinc finger protein 142 OS=Homo sapiens GN=ZNF142 PE=2 SV=4 Back     alignment and function description
>sp|Q6DBW0|IKZF5_DANRE Zinc finger protein Pegasus OS=Danio rerio GN=ikzf5 PE=2 SV=1 Back     alignment and function description
>sp|Q9JKD9|ZBT32_MOUSE Zinc finger and BTB domain-containing protein 32 OS=Mus musculus GN=Zbtb32 PE=1 SV=1 Back     alignment and function description
>sp|Q13127|REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 Back     alignment and function description
>sp|Q5ZLR2|IKZF5_CHICK Zinc finger protein Pegasus OS=Gallus gallus GN=IKZF5 PE=2 SV=1 Back     alignment and function description
>sp|Q9NPA5|ZF64A_HUMAN Zinc finger protein 64 homolog, isoforms 1 and 2 OS=Homo sapiens GN=ZFP64 PE=1 SV=3 Back     alignment and function description
>sp|A4IFJ6|IKZF5_BOVIN Zinc finger protein Pegasus OS=Bos taurus GN=IKZF5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
308481332 350 hypothetical protein CRE_31234 [Caenorha 0.726 0.174 0.442 2e-09
327269310 1241 PREDICTED: zinc finger protein ZFAT-like 0.738 0.049 0.406 1e-08
118601156 1198 zinc finger and AT hook domain containin 0.75 0.052 0.406 1e-08
432908270 1135 PREDICTED: zinc finger protein ZFAT-like 0.702 0.051 0.435 1e-08
449495195 1232 PREDICTED: zinc finger protein ZFAT [Tae 0.738 0.050 0.406 2e-08
427795957 211 Putative re1-silencing transcription fac 0.714 0.284 0.491 2e-08
113931316 234 novel zinc finger protein [Xenopus (Silu 0.797 0.286 0.405 2e-08
111307825 222 LOC733928 protein [Xenopus (Silurana) tr 0.797 0.301 0.405 2e-08
260801935 258 hypothetical protein BRAFLDRAFT_147142 [ 0.702 0.228 0.466 2e-08
391326883 567 PREDICTED: uncharacterized protein LOC10 0.821 0.121 0.436 3e-08
>gi|308481332|ref|XP_003102871.1| hypothetical protein CRE_31234 [Caenorhabditis remanei] gi|308260574|gb|EFP04527.1| hypothetical protein CRE_31234 [Caenorhabditis remanei] Back     alignment and taxonomy information
 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (65%)

Query: 4   HIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVKCPHCAYKCVKQKDLNTHIERR 63
           H+RTHTGEKP+ CT C  +   + T+  H+RIH  +K+KC HC + C +   L  H++R+
Sbjct: 218 HLRTHTGEKPFNCTKCSSSFTQNRTLLRHMRIHSGIKLKCKHCEFDCFRPAGLAEHVKRK 277

Query: 64  H 64
           H
Sbjct: 278 H 278




Source: Caenorhabditis remanei

Species: Caenorhabditis remanei

Genus: Caenorhabditis

Family: Rhabditidae

Order: Rhabditida

Class: Chromadorea

Phylum: Nematoda

Superkingdom: Eukaryota

>gi|327269310|ref|XP_003219437.1| PREDICTED: zinc finger protein ZFAT-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|118601156|ref|NP_001073041.1| zinc finger and AT hook domain containing [Xenopus (Silurana) tropicalis] gi|111305925|gb|AAI21282.1| zinc finger and AT hook domain containing [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|432908270|ref|XP_004077797.1| PREDICTED: zinc finger protein ZFAT-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|449495195|ref|XP_002188278.2| PREDICTED: zinc finger protein ZFAT [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|427795957|gb|JAA63430.1| Putative re1-silencing transcription factor, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|113931316|ref|NP_001039107.1| novel zinc finger protein [Xenopus (Silurana) tropicalis] gi|89268765|emb|CAJ83131.1| novel zinc finger protein [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|111307825|gb|AAI21338.1| LOC733928 protein [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|260801935|ref|XP_002595850.1| hypothetical protein BRAFLDRAFT_147142 [Branchiostoma floridae] gi|229281099|gb|EEN51862.1| hypothetical protein BRAFLDRAFT_147142 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|391326883|ref|XP_003737939.1| PREDICTED: uncharacterized protein LOC100898961 [Metaseiulus occidentalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
UNIPROTKB|E1C418150 E1C418 "Uncharacterized protei 0.869 0.486 0.389 1e-11
UNIPROTKB|E1BVZ6 1746 E1BVZ6 "Uncharacterized protei 0.702 0.033 0.5 1.6e-11
ZFIN|ZDB-GENE-040801-209 419 ikzf5 "IKAROS family zinc fing 0.892 0.178 0.397 5e-11
UNIPROTKB|F1SRY7 1430 ZNF142 "Uncharacterized protei 0.702 0.041 0.466 5.4e-11
UNIPROTKB|I3LF03 1548 LOC100626772 "Uncharacterized 0.702 0.038 0.466 5.9e-11
UNIPROTKB|E2REA6 1747 ZNF142 "Uncharacterized protei 0.702 0.033 0.466 6.8e-11
UNIPROTKB|E1BNL0 1848 ZNF142 "Uncharacterized protei 0.702 0.031 0.466 7.2e-11
UNIPROTKB|J9P6V2 1849 ZNF142 "Uncharacterized protei 0.702 0.031 0.466 7.2e-11
UNIPROTKB|O42424179 ZNF6 "ZNF6 protein" [Gallus ga 0.726 0.340 0.428 9.4e-11
UNIPROTKB|E1BYF2 1242 ZFAT "Uncharacterized protein" 0.761 0.051 0.390 9.4e-11
UNIPROTKB|E1C418 E1C418 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 159 (61.0 bits), Expect = 1.0e-11, P = 1.0e-11
 Identities = 30/77 (38%), Positives = 44/77 (57%)

Query:     1 MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIH-QDLKVKCPHCAYKCVKQKDLNTH 59
             +  H+RTHTGEKPY+CT C F  +    +  H R+H QD   +C  C Y+C + ++L  H
Sbjct:    25 LTRHLRTHTGEKPYRCTGCSFACSSLGNLKRHERVHSQDKPFQCAACDYRCNQSRNLKRH 84

Query:    60 IERRHMP-GDVLGHIQQ 75
             +    +P G+  G  QQ
Sbjct:    85 MLSHRLPEGE--GQHQQ 99


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|E1BVZ6 E1BVZ6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-209 ikzf5 "IKAROS family zinc finger 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRY7 ZNF142 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LF03 LOC100626772 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2REA6 ZNF142 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNL0 ZNF142 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6V2 ZNF142 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O42424 ZNF6 "ZNF6 protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYF2 ZFAT "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 32.4 bits (74), Expect = 0.002
 Identities = 14/25 (56%), Positives = 18/25 (72%)

Query: 1  MRNHIRTHTGEKPYKCTFCPFTAAH 25
          +R H+RTHTGEKPYKC  C  + + 
Sbjct: 2  LRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 84
KOG2462|consensus279 99.87
KOG2462|consensus279 99.85
KOG3623|consensus1007 99.51
KOG3623|consensus1007 99.47
KOG3576|consensus267 99.43
KOG1074|consensus 958 99.42
KOG3576|consensus267 99.36
PHA00733128 hypothetical protein 99.32
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.31
PHA0276855 hypothetical protein; Provisional 99.27
KOG3608|consensus467 99.07
KOG1074|consensus958 99.04
KOG3608|consensus 467 98.95
PHA0061644 hypothetical protein 98.75
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.7
PHA0073279 hypothetical protein 98.69
PHA0061644 hypothetical protein 98.67
PHA0276855 hypothetical protein; Provisional 98.64
PLN03086567 PRLI-interacting factor K; Provisional 98.62
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.45
PLN03086567 PRLI-interacting factor K; Provisional 98.45
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.41
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.41
KOG3993|consensus500 98.35
PHA00733128 hypothetical protein 98.27
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.21
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.09
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.0
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.97
KOG3993|consensus 500 97.96
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.77
COG5189423 SFP1 Putative transcriptional repressor regulating 97.72
smart0035526 ZnF_C2H2 zinc finger. 97.64
smart0035526 ZnF_C2H2 zinc finger. 97.61
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.59
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.42
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.42
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.38
PRK04860160 hypothetical protein; Provisional 97.32
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.22
PRK04860160 hypothetical protein; Provisional 96.84
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.69
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.44
COG404965 Uncharacterized protein containing archaeal-type C 96.41
PHA0073279 hypothetical protein 96.4
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 96.31
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 95.87
KOG2186|consensus 276 95.59
PF1371937 zinc_ribbon_5: zinc-ribbon domain 95.25
PF1371736 zinc_ribbon_4: zinc-ribbon domain 95.19
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 95.0
COG5048467 FOG: Zn-finger [General function prediction only] 94.69
COG404965 Uncharacterized protein containing archaeal-type C 94.58
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 94.53
KOG2893|consensus 341 94.2
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 94.11
COG5189423 SFP1 Putative transcriptional repressor regulating 93.79
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 92.41
KOG1146|consensus 1406 92.28
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 92.15
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 91.95
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 91.61
PF04959214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 91.43
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 91.27
PRK00464154 nrdR transcriptional regulator NrdR; Validated 91.17
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 91.15
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 91.12
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 91.12
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 91.01
PF14353128 CpXC: CpXC protein 90.98
smart00531147 TFIIE Transcription initiation factor IIE. 90.96
PF1526954 zf-C2H2_7: Zinc-finger 90.95
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 90.73
cd0092497 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb. 90.05
smart0044040 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo 89.77
COG5048467 FOG: Zn-finger [General function prediction only] 89.18
PRK06266178 transcription initiation factor E subunit alpha; V 88.48
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.11
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 87.68
COG1571421 Predicted DNA-binding protein containing a Zn-ribb 87.04
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 86.52
PLN02294174 cytochrome c oxidase subunit Vb 86.03
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 85.72
KOG4167|consensus907 85.63
KOG2593|consensus 436 85.04
PRK0967872 DNA-binding transcriptional regulator; Provisional 84.44
COG233182 Uncharacterized protein conserved in bacteria [Fun 84.0
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 83.93
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 83.58
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 82.94
KOG4173|consensus253 82.89
PF0109639 TFIIS_C: Transcription factor S-II (TFIIS); InterP 82.77
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 82.75
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 82.62
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 82.44
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 82.28
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 82.28
PF11672102 DUF3268: Protein of unknown function (DUF3268); In 80.98
KOG3408|consensus129 80.72
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 80.71
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 80.48
>KOG2462|consensus Back     alignment and domain information
Probab=99.87  E-value=6.3e-23  Score=112.71  Aligned_cols=72  Identities=26%  Similarity=0.483  Sum_probs=64.2

Q ss_pred             ChhhhhhhcCCCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhhhCCCCChhhhHH
Q psy10072          1 MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIERRHMPGDVLGHIQ   74 (84)
Q Consensus         1 l~~h~~~h~~~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~~   74 (84)
                      |+.|+|+|+  -++.|.+||+.|.++.-|+.|+++|+|++ |.|..|++.|.+.++|..||++|.+.+.|.|..+
T Consensus       177 LkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C  249 (279)
T KOG2462|consen  177 LKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRC  249 (279)
T ss_pred             HhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcch
Confidence            567888887  57999999999999999999999999988 9999999999999999999999999999988443



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF15269 zf-C2H2_7: Zinc-finger Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb Back     alignment and domain information
>smart00440 ZnF_C2C2 C2C2 Zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PLN02294 cytochrome c oxidase subunit Vb Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>KOG2593|consensus Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PF11672 DUF3268: Protein of unknown function (DUF3268); InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150 Back     alignment and domain information
>KOG3408|consensus Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-08
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 4e-07
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-06
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 4e-06
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 6e-06
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 2e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-04
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 8e-04
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure

Iteration: 1

Score = 54.7 bits (130), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 1 MRNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTH 59 ++ H+R HTG KPYKC C + AA SS+++ HLRIH D + KC C Y L H Sbjct: 24 LKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQICPYASRNSSQLTVH 83 Query: 60 I 60 + Sbjct: 84 L 84
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-07
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-07
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 8e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-06
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 1e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-05
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 4e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-04
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
 Score = 58.3 bits (142), Expect = 2e-13
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 2  RNHIRTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQDLKVK---CPHCAYKCVKQKDLNT 58
           +  RTH+GEKPY+C  C      S TM  H+       V    CPHC     ++ DL  
Sbjct: 4  GSSGRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGV 63

Query: 59 HIERRH 64
          H+ ++H
Sbjct: 64 HLRKQH 69


>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.87
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.86
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.84
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.84
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.83
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.83
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.82
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.82
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.81
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.81
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.81
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.8
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.8
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.79
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.79
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.79
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.79
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.78
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.78
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.78
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.77
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.77
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.76
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.75
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.74
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.74
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.74
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.74
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.73
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.73
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.73
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.73
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.72
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.72
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.72
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.71
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.71
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.7
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.69
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.69
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.69
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.69
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.69
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.69
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.68
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.68
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.68
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.68
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.67
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.66
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.66
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.65
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.63
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.63
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.62
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.62
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.62
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.62
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.62
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.62
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.62
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.62
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.62
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.62
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.62
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.61
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.61
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.61
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.61
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.61
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.61
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.61
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.6
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.6
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.6
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.6
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.6
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.6
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.6
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.6
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.6
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.6
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.59
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.59
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.59
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.59
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.59
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.59
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.59
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.59
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.59
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.59
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.59
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.59
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.58
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.58
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.58
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.57
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.57
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.57
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.55
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.54
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.53
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.53
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.53
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.53
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.53
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.52
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.52
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.52
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.52
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.52
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.52
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.52
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.52
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.52
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.51
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.51
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.51
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.51
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.51
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.51
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.51
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.51
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.51
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.51
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.51
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.51
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.5
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.5
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.5
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.5
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.49
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.49
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.48
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.48
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.47
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.47
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.47
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.47
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.47
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.47
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.46
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.46
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.46
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.46
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.45
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.44
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.43
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.42
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.4
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.4
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.39
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.39
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.38
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.37
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.36
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.34
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.33
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.32
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.31
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.3
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.29
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.29
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.29
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.28
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.28
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.28
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.28
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.27
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.27
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.27
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.26
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.26
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.26
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.25
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.25
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.25
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.25
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.25
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.25
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.24
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.23
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.22
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.22
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.22
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.21
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.21
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.2
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.2
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.2
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.19
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.17
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.15
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.14
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.13
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.12
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.11
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.1
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.1
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.1
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 99.09
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 99.07
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.05
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.05
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.03
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.03
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.01
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 99.0
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.0
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.0
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 99.0
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.0
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.98
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.98
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.94
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.94
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.93
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.93
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.9
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.9
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.89
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.89
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.88
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.86
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.83
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.81
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.8
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.79
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.79
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.77
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.77
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.76
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.76
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.75
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.75
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.72
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.72
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.72
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.7
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.66
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.65
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.65
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.64
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.08
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.07
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.62
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.61
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.6
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.6
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.6
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.59
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.58
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 98.0
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.58
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.58
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.55
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.55
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.54
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.51
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.5
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.47
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.47
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.46
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.45
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.45
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.45
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.42
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.79
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.4
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.67
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.53
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.15
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.07
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.94
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.87
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.02
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.92
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.81
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.81
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.37
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.22
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.49
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 95.15
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.04
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 93.69
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 93.62
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 93.54
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 92.99
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 92.36
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 91.85
2k5c_A95 Uncharacterized protein PF0385; structural genomic 91.61
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 91.12
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 89.87
2odx_A80 Cytochrome C oxidase polypeptide IV; all beta-prot 89.73
1wil_A89 KIAA1045 protein; ring finger domain, structural g 89.48
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 89.1
2czr_A226 TBP-interacting protein; tata-binding protein (TBP 88.95
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 87.9
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 87.09
1v54_F98 VI, cytochrome C oxidase polypeptide VB; oxidoredu 86.99
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 86.47
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 84.91
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 84.83
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 83.74
2y69_F129 Cytochrome C oxidase subunit 5B; electron transpor 83.69
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 83.66
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 83.63
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 82.61
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 82.2
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 81.21
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 81.08
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
Probab=99.87  E-value=1.3e-22  Score=90.29  Aligned_cols=57  Identities=30%  Similarity=0.588  Sum_probs=54.3

Q ss_pred             CCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhhhCCCC
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIERRHMPG   67 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~~~~~~   67 (84)
                      ||||.|.+|++.|.....|..|++.|++.+ |.|..|++.|.+.+.|..|+++|+++.
T Consensus         2 EKpy~C~~C~k~F~~~~~L~~H~~~Ht~ekp~~C~~C~k~F~~~~~L~~H~~~Htgep   59 (60)
T 4gzn_C            2 ERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLKVHQNKP   59 (60)
T ss_dssp             CCCEECTTTCCEESSHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHGGGGSCC-
T ss_pred             CCCccCCCCCCEeCCHHHHHHHHHHhCCCcCeECCCCCCCcCCHHHHHHHhCccCCCC
Confidence            799999999999999999999999999988 999999999999999999999999864



>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2czr_A TBP-interacting protein; tata-binding protein (TBP), hyperthermophilic archaeon, Zn-finger motif, transcription; 2.30A {Thermococcus kodakarensis} SCOP: c.52.4.1 Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ... Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>2y69_F Cytochrome C oxidase subunit 5B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 84
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d2dmda329 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 { 3e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-04
d2dmda128 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 { 7e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.4 bits (100), Expect = 7e-08
 Identities = 14/33 (42%), Positives = 18/33 (54%)

Query: 6  RTHTGEKPYKCTFCPFTAAHSSTMSYHLRIHQD 38
          RTHTGEKPY C+ C  T      +  H + + D
Sbjct: 1  RTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHD 33


>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.82
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.67
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.64
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.6
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.6
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.5
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.49
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.47
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.4
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.39
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.39
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.34
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.33
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.32
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.31
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.27
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.23
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.22
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.21
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.2
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.19
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.13
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.13
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.08
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.08
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.05
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.02
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.01
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.96
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.91
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.91
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.89
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.89
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.84
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.84
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.74
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.69
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.69
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.58
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.56
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.56
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.51
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.36
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.36
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.33
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.3
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.29
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.2
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.2
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.13
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.1
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.08
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.07
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.0
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.0
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.93
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.89
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.87
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.71
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.71
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.71
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.67
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.67
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.65
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.63
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.61
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.56
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.54
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.46
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.42
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.38
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.38
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.21
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.21
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.2
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.19
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.17
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.0
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.92
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.89
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.58
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.53
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.48
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.48
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.42
d1y0jb136 U-shaped transcription factor, different fingers { 96.36
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.14
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.08
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 95.79
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.77
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 95.6
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.26
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 94.75
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.45
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 94.36
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 94.29
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 94.19
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 93.12
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 92.74
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 89.56
d1fu9a_36 U-shaped transcription factor, different fingers { 89.3
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 88.85
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.72
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 86.97
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.79
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 86.35
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 83.68
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 81.5
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.82  E-value=1.9e-20  Score=80.38  Aligned_cols=52  Identities=27%  Similarity=0.512  Sum_probs=49.6

Q ss_pred             CCCeecCCCCccccChhhHHHHHHhcCCce-eeCCCCccccccchHHHHHHhhh
Q psy10072         11 EKPYKCTFCPFTAAHSSTMSYHLRIHQDLK-VKCPHCAYKCVKQKDLNTHIERR   63 (84)
Q Consensus        11 ~k~~~c~~C~~~f~~~~~l~~h~~~~~~~~-~~c~~C~~~f~~~~~l~~H~~~~   63 (84)
                      ||||.| +||+.|.....|..|++.|++.+ |.|..|++.|.+.+.|..|+++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            689999 59999999999999999999998 99999999999999999999876



>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure