Psyllid ID: psy10074


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
YLVNGNLQLIHAADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFEDSLTTEETEYYKILEH
ccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHHHHHccccccccccccccccccccccHHHHHcccccccccccccccccHHcccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccHHHcccccccccccccccccHHHccccccccccccccccccccccccccccccccc
ccccHcccEcccccEEccHcccccccccHHHHHHHHHHHcccccccccccccccccccEEcccccHHHHHHHcccccccccccccccccccccccccEEccccHHHHHHHHHcccccccccccccEccccccEEEccccccccccccccccEEEccccHHEHEHEccccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHcccccccccccccccEccccHHHHHHHHHHHcccccccccccccccEccccHHHHHHHHHcccccccccccccccEccccHHHHHHHHHHccccccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHHcccccccccccccccEccccHHHHHHHHHccccccccccccccHHcccc
ylvngnlqlihaadikcchcnkyISSDLRDLLEHcrlcpamtrtdllkHKYVCYACSYATYYNGNMKKHlrihlgdrpfmCTLLICQYCLICQYCNQYFVRSTQdilqhgkvcnfaprsdanfNFVCILCnyhipckwckycktkldnntEVLLQHCKLCVnvirpdvsyryvcftcdyhsfcsshMKDHirvhlgekpymciYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHVMRkhtgekpfhchycdyicrtkydlsshigrkhtDKEVLEKRyvcqlcpkqfltsgelkyhqttvhrkrvhecsecgfTFFLEKTLRAHIREthrketpfpcpfceykAKRKFELKShmkrkhtfedsltteETEYYKILEH
YLVNGNLQLIHAADIKCCHCNKYISSDLRDLLEHCRLCPAMtrtdllkhkYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLnitktrcelcDLRFFDKVGLKMHVMRkhtgekpfhCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPkqfltsgelkyHQTTVHRKRVHECSECGFTFFLEKTLRAHIREthrketpfpcpfceYKAKRKfelkshmkrkhtfedsltteeteyykileh
YLVNGNLQLIHAADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFEDSLTTEETEYYKILEH
**VNGNLQLIHAADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKF*****************************
YLVNGNLQLIHAADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLIC***N*****STQDILQHGKVCNFAPRSDANFNFVCILCNYHIPCKW*********************CVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFEDSLTTEETEYYKI***
YLVNGNLQLIHAADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFEDSLTTEETEYYKILEH
*****NLQLIHAADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFEDSLTTEETEYY*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YLVNGNLQLIHAADIKCCHCNKYISSDLRDLLEHCRLCPAMTRTDLLKHKYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQYFVRSTQDILQHGKVCNFAPRSDANFNFVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFEDSLTTEETEYYKILEH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query420 2.2.26 [Sep-21-2011]
Q01611794 Zinc finger Y-chromosomal N/A N/A 0.690 0.365 0.278 8e-24
P08045 1350 Zinc finger protein Xfin N/A N/A 0.728 0.226 0.282 2e-23
Q5R5U3 672 Zinc finger protein 271 O yes N/A 0.788 0.492 0.298 4e-23
Q147U1533 Zinc finger protein 846 O yes N/A 0.652 0.514 0.292 6e-23
P10076 861 Zinc finger protein 26 OS yes N/A 0.776 0.378 0.289 6e-23
A2ANX9761 Zinc finger protein 711 O no N/A 0.6 0.331 0.286 7e-22
Q99KE8 643 Zinc finger protein 64 OS no N/A 0.530 0.346 0.311 2e-21
Q5R633688 Zinc finger and BTB domai no N/A 0.692 0.422 0.292 2e-21
Q9NTW7 645 Zinc finger protein 64 ho no N/A 0.535 0.348 0.313 3e-21
P10074688 Zinc finger and BTB domai no N/A 0.692 0.422 0.292 3e-21
>sp|Q01611|ZFY1_XENLA Zinc finger Y-chromosomal protein 1 OS=Xenopus laevis GN=zfy1 PE=2 SV=1 Back     alignment and function desciption
 Score =  111 bits (278), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 99/355 (27%), Positives = 141/355 (39%), Gaps = 65/355 (18%)

Query: 46  LLKHKYVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQYFVRSTQD 105
           L++ KY C  C Y T    N K  L  HL       T++  +  L C+ C + F+ +   
Sbjct: 437 LVRKKYRCTDCDYTT----NKKVSLHNHLESHKLTATVIKTEKDLECEECGKIFLHANA- 491

Query: 106 ILQHGKVCNFAPRSDANFNFVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIR 165
           +  H    N       N   +C  C+Y    +           N  +L  H K       
Sbjct: 492 LFAHKLTHN---EKAGNKMHICKFCDYETAEQGLL--------NRHLLAVHSK------- 533

Query: 166 PDVSYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEV 225
              S+ ++C  C       S +K H+R H GEKPY+C YC YR    S+LK H++ KH  
Sbjct: 534 ---SFPHICVECGKGFRHPSELKKHMRTHTGEKPYLCQYCDYRSADSSNLKTHVKTKHSK 590

Query: 226 KHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHVMRKHTGE 285
           +  F                              +C++C   F D   L+ H +  H   
Sbjct: 591 EMPF------------------------------KCDICLQTFTDSKDLQEHAIL-HQES 619

Query: 286 KPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYV--CQLCPKQFLTSGELKYHQTTV 343
           K   C +CD+      DL  HI   HT      K Y   C++C K F    ELK H+   
Sbjct: 620 KNHQCLHCDHKSSNSSDLKRHIISVHT------KDYPHKCEVCEKGFHRPSELKKHEAAH 673

Query: 344 HRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMK 398
             K++H+C  C F       L  HI   H KE P+ C  C+   +++ ELK HMK
Sbjct: 674 KGKKMHQCRHCEFHIADPFVLSRHILSVHTKELPYRCKRCKKGFRQQIELKKHMK 728




Probable transcriptional activator.
Xenopus laevis (taxid: 8355)
>sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 Back     alignment and function description
>sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 Back     alignment and function description
>sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 Back     alignment and function description
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|A2ANX9|ZN711_MOUSE Zinc finger protein 711 OS=Mus musculus GN=Znf711 PE=3 SV=1 Back     alignment and function description
>sp|Q99KE8|ZFP64_MOUSE Zinc finger protein 64 OS=Mus musculus GN=Zfp64 PE=2 SV=1 Back     alignment and function description
>sp|Q5R633|ZBT48_PONAB Zinc finger and BTB domain-containing protein 48 OS=Pongo abelii GN=ZBTB48 PE=2 SV=1 Back     alignment and function description
>sp|Q9NTW7|ZF64B_HUMAN Zinc finger protein 64 homolog, isoforms 3 and 4 OS=Homo sapiens GN=ZFP64 PE=2 SV=3 Back     alignment and function description
>sp|P10074|ZBT48_HUMAN Zinc finger and BTB domain-containing protein 48 OS=Homo sapiens GN=ZBTB48 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
260832854 695 hypothetical protein BRAFLDRAFT_134906 [ 0.826 0.499 0.311 1e-29
260823062489 hypothetical protein BRAFLDRAFT_57770 [B 0.8 0.687 0.309 2e-29
260806225 603 hypothetical protein BRAFLDRAFT_79782 [B 0.814 0.567 0.292 4e-29
260823012 1154 hypothetical protein BRAFLDRAFT_71735 [B 0.819 0.298 0.292 5e-29
260815008 629 hypothetical protein BRAFLDRAFT_216782 [ 0.833 0.556 0.284 8e-29
260823046517 hypothetical protein BRAFLDRAFT_71717 [B 0.780 0.634 0.287 1e-28
260804320 791 hypothetical protein BRAFLDRAFT_96185 [B 0.773 0.410 0.314 2e-28
260823018507 hypothetical protein BRAFLDRAFT_71732 [B 0.780 0.646 0.289 2e-28
260823096 705 hypothetical protein BRAFLDRAFT_57766 [B 0.788 0.469 0.304 2e-28
260813270 773 hypothetical protein BRAFLDRAFT_82748 [B 0.864 0.469 0.277 3e-28
>gi|260832854|ref|XP_002611372.1| hypothetical protein BRAFLDRAFT_134906 [Branchiostoma floridae] gi|229296743|gb|EEN67382.1| hypothetical protein BRAFLDRAFT_134906 [Branchiostoma floridae] Back     alignment and taxonomy information
 Score =  137 bits (344), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 117/376 (31%), Positives = 161/376 (42%), Gaps = 29/376 (7%)

Query: 51  YVCYACSYATYYNGNMKKHLRIHLGDRPFMCTLLICQYCLICQYCNQY--FVRSTQDILQ 108
           Y+C  C Y T    N+  H+R+H G +P+ C    C Y    +   +Y    + T + L 
Sbjct: 67  YICDECGYKTAEKSNLSSHVRLHTGKKPYKCDQ--CDYSAAQKVSLKYHHLAKHTSEKLY 124

Query: 109 HGKVCNFAPRSDANFNFVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLCVNVIRPDV 168
               C +     +N +    +     P K C  C         + L H      + +   
Sbjct: 125 VCDECGYKTVVKSNLSRHVRIHTGEKPYK-CDQCDYSAARKCSLDLHH------LAKHTG 177

Query: 169 SYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHC 228
              YVC  C Y +   S++  H+R+H GEKPY C  C Y   QK  L +HL      KH 
Sbjct: 178 ENLYVCDECGYKTVVKSNLSQHVRIHTGEKPYKCDQCDYSAAQKCSLDQHL-----AKHT 232

Query: 229 FVNIVM---NSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFFDK-VGLKMHVMRKHTG 284
             N+ +     Y T +K  + RHV RIH      +C+ CD     K   L  H+  KHTG
Sbjct: 233 GENLYVCDECGYKTVVKSNLSRHV-RIHTGEKPYKCDQCDYSAAQKCTSLDQHLA-KHTG 290

Query: 285 EKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVH 344
           E  + C  C Y    K +LSSH+ R HT     EK Y C  C         L +H    H
Sbjct: 291 ENLYICDECGYKTAQKSNLSSHV-RIHTG----EKPYKCDQCDYSAAWKASLDHHHLAKH 345

Query: 345 -RKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTF 403
             ++ + C ECG+      TL  H+R TH  E P+ C  C+Y A RK +L  H   KHT 
Sbjct: 346 TSEKSYICDECGYRTACISTLARHMR-THTGEKPYNCDQCDYSAARKAQLDYHHLAKHTS 404

Query: 404 EDSLTTEETEYYKILE 419
           E S   +E  Y   L+
Sbjct: 405 EKSYVCDECGYKTALK 420




Source: Branchiostoma floridae

Species: Branchiostoma floridae

Genus: Branchiostoma

Family: Branchiostomidae

Order:

Class:

Phylum: Chordata

Superkingdom: Eukaryota

>gi|260823062|ref|XP_002604002.1| hypothetical protein BRAFLDRAFT_57770 [Branchiostoma floridae] gi|229289327|gb|EEN60013.1| hypothetical protein BRAFLDRAFT_57770 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260806225|ref|XP_002597985.1| hypothetical protein BRAFLDRAFT_79782 [Branchiostoma floridae] gi|229283255|gb|EEN53997.1| hypothetical protein BRAFLDRAFT_79782 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260823012|ref|XP_002603977.1| hypothetical protein BRAFLDRAFT_71735 [Branchiostoma floridae] gi|229289302|gb|EEN59988.1| hypothetical protein BRAFLDRAFT_71735 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260815008|ref|XP_002602205.1| hypothetical protein BRAFLDRAFT_216782 [Branchiostoma floridae] gi|229287512|gb|EEN58217.1| hypothetical protein BRAFLDRAFT_216782 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260823046|ref|XP_002603994.1| hypothetical protein BRAFLDRAFT_71717 [Branchiostoma floridae] gi|229289319|gb|EEN60005.1| hypothetical protein BRAFLDRAFT_71717 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260804320|ref|XP_002597036.1| hypothetical protein BRAFLDRAFT_96185 [Branchiostoma floridae] gi|229282298|gb|EEN53048.1| hypothetical protein BRAFLDRAFT_96185 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260823018|ref|XP_002603980.1| hypothetical protein BRAFLDRAFT_71732 [Branchiostoma floridae] gi|229289305|gb|EEN59991.1| hypothetical protein BRAFLDRAFT_71732 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260823096|ref|XP_002604019.1| hypothetical protein BRAFLDRAFT_57766 [Branchiostoma floridae] gi|229289344|gb|EEN60030.1| hypothetical protein BRAFLDRAFT_57766 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260813270|ref|XP_002601341.1| hypothetical protein BRAFLDRAFT_82748 [Branchiostoma floridae] gi|229286636|gb|EEN57353.1| hypothetical protein BRAFLDRAFT_82748 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
ZFIN|ZDB-GENE-110914-121541 si:ch211-202h22.10 "si:ch211-2 0.807 0.626 0.270 5.1e-38
ZFIN|ZDB-GENE-120214-31488 si:ch73-367f21.6 "si:ch73-367f 0.528 0.454 0.360 1.2e-37
ZFIN|ZDB-GENE-110913-23 569 si:dkey-122c11.8 "si:dkey-122c 0.792 0.585 0.285 1.7e-37
ZFIN|ZDB-GENE-110913-135 689 si:ch211-207e19.14 "si:ch211-2 0.792 0.483 0.276 6.5e-37
ZFIN|ZDB-GENE-051113-232646 zgc:123008 "zgc:123008" [Danio 0.778 0.506 0.303 7.8e-37
ZFIN|ZDB-GENE-120709-2420 si:dkey-211i20.3 "si:dkey-211i 0.785 0.785 0.276 1e-36
ZFIN|ZDB-GENE-110913-157981 si:ch211-245n8.1 "si:ch211-245 0.778 0.333 0.294 1.5e-36
ZFIN|ZDB-GENE-120214-27493 si:ch73-367f21.4 "si:ch73-367f 0.788 0.671 0.294 1.7e-36
UNIPROTKB|F1NMT1559 ZFP64 "Uncharacterized protein 0.866 0.651 0.289 3.5e-36
ZFIN|ZDB-GENE-070705-205473 si:ch73-138e16.6 "si:ch73-138e 0.785 0.697 0.300 3.5e-36
ZFIN|ZDB-GENE-110914-121 si:ch211-202h22.10 "si:ch211-202h22.10" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 351 (128.6 bits), Expect = 5.1e-38, Sum P(2) = 5.1e-38
 Identities = 101/373 (27%), Positives = 155/373 (41%)

Query:    51 YVCYACSYATYYNGNMKKHLRIHLGDRPFMCT---LLICQYCLICQYCNQYFVRSTQDIL 107
             + C  C  +     ++K H+RIH G++PF C    ++  Q   + ++   +         
Sbjct:    88 FTCPQCDKSVTSKQSLKSHMRIHTGEKPFTCPECGMIFSQLGYLKRHVRTHTGLKPFSCT 147

Query:   108 QHGKVCNFAPRSDANFN-------FVCILCNYHIPCKWCKYCKTKLDNNTEVLLQHCKLC 160
             Q GK        +++         F C  C      K C   K+ +  + E    +C LC
Sbjct:   148 QCGKRYKVKQSLESHMRVHTGEKPFACPQCGKGFTAKQC--LKSHMSVHIEEKPFNCSLC 205

Query:   161 VNVIRPDVSYR-----------YVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRC 209
                     S +           YVC  C         ++ HIR+H GEKP+ C  C    
Sbjct:   206 EMSFTHQQSLKRHMLIHVGEKPYVCRQCGKSFSVKQSLESHIRIHTGEKPFACAECGKGF 265

Query:   210 TQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCELCDLRFF 269
               K +L+ H+R    VK          +   +K+ ++ H+  IH       C +CD  F 
Sbjct:   266 AVKQNLESHMRVHTGVKPFSCPQCGKRF--TVKQSLESHMT-IHTGERPFTCSMCDKTFT 322

Query:   270 DKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQ 329
              K  L+ H MR HTGEKP+ C  C       Y L +H+ R H      EK + C  C K+
Sbjct:   323 VKHKLEYH-MRNHTGEKPYICPQCG----NSYALRNHLER-HVRIHTGEKPFSCSKCAKR 376

Query:   330 FLTSGELKYHQTTVHRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKR 389
             F     LK H    +R + + CS+CG  F ++++L +H+   H  E PF C  C      
Sbjct:   377 FTMKQSLKSHMRVHNRTKPYICSQCGKRFTVKQSLESHM-SLHTGEKPFTCTECGKSYTL 435

Query:   390 KFELKSHMKRKHT 402
             +  L++HM R HT
Sbjct:   436 RQSLETHM-RVHT 447


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-120214-31 si:ch73-367f21.6 "si:ch73-367f21.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-23 si:dkey-122c11.8 "si:dkey-122c11.8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-135 si:ch211-207e19.14 "si:ch211-207e19.14" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051113-232 zgc:123008 "zgc:123008" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120709-2 si:dkey-211i20.3 "si:dkey-211i20.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-157 si:ch211-245n8.1 "si:ch211-245n8.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120214-27 si:ch73-367f21.4 "si:ch73-367f21.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMT1 ZFP64 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070705-205 si:ch73-138e16.6 "si:ch73-138e16.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 420
KOG1074|consensus958 99.95
KOG3608|consensus467 99.94
KOG2462|consensus279 99.92
KOG2462|consensus279 99.91
KOG3608|consensus 467 99.91
KOG1074|consensus 958 99.9
KOG3623|consensus 1007 99.87
KOG3623|consensus1007 99.83
KOG3576|consensus267 99.62
KOG3576|consensus267 99.54
PLN03086567 PRLI-interacting factor K; Provisional 99.16
PLN03086567 PRLI-interacting factor K; Provisional 99.09
PHA00733128 hypothetical protein 99.03
PHA00733128 hypothetical protein 98.89
PHA0276855 hypothetical protein; Provisional 98.66
KOG3993|consensus500 98.65
KOG3993|consensus500 98.64
PHA0276855 hypothetical protein; Provisional 98.58
KOG1146|consensus 1406 98.37
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.34
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.29
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.24
PHA0073279 hypothetical protein 98.12
PHA0061644 hypothetical protein 98.05
PHA0073279 hypothetical protein 97.88
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.87
PHA0061644 hypothetical protein 97.86
KOG1146|consensus 1406 97.68
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.58
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.46
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.38
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.36
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.33
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.28
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.17
COG5189423 SFP1 Putative transcriptional repressor regulating 97.02
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.92
COG5189423 SFP1 Putative transcriptional repressor regulating 96.87
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.22
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.2
COG5236493 Uncharacterized conserved protein, contains RING Z 96.11
smart0035526 ZnF_C2H2 zinc finger. 96.04
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.03
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.02
smart0035526 ZnF_C2H2 zinc finger. 95.95
KOG2231|consensus 669 95.8
KOG2482|consensus423 95.73
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.69
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.68
KOG2482|consensus423 95.57
KOG2785|consensus 390 95.49
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.2
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.95
PRK04860160 hypothetical protein; Provisional 94.55
KOG2231|consensus 669 94.51
PRK04860160 hypothetical protein; Provisional 94.47
KOG4173|consensus253 94.2
KOG2785|consensus390 93.58
KOG2893|consensus341 92.68
COG5048467 FOG: Zn-finger [General function prediction only] 92.59
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.47
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 92.14
COG5236493 Uncharacterized conserved protein, contains RING Z 91.9
KOG4173|consensus253 91.82
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.3
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 90.53
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 89.78
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 89.69
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 89.1
KOG2893|consensus 341 89.06
COG404965 Uncharacterized protein containing archaeal-type C 88.4
COG404965 Uncharacterized protein containing archaeal-type C 87.59
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 86.9
COG5048467 FOG: Zn-finger [General function prediction only] 86.73
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 84.91
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 83.26
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 82.06
PF09986214 DUF2225: Uncharacterized protein conserved in bact 81.71
COG5151421 SSL1 RNA polymerase II transcription initiation/nu 81.39
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 81.11
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 80.6
>KOG1074|consensus Back     alignment and domain information
Probab=99.95  E-value=1.5e-28  Score=233.15  Aligned_cols=206  Identities=27%  Similarity=0.482  Sum_probs=149.8

Q ss_pred             CcceeccccCccccChhHHHHHHHHhcCCCceecccccccccCHHHHHHHHhhccCCCcceeceeecccccChHHHHHHH
Q psy10074        169 SYRYVCFTCDYHSFCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRH  248 (420)
Q Consensus       169 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~c~~c~~~~~~~~~~~l~~h  248 (420)
                      ..+.+|-+|.++..-+..|+.|.++|+|++||+|.+|++.|+++.+|+.||-+|....+                     
T Consensus       603 TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~---------------------  661 (958)
T KOG1074|consen  603 TDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPP---------------------  661 (958)
T ss_pred             CCccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCcc---------------------
Confidence            34678999999999999999999999999999999999999999999999987654332                     


Q ss_pred             HhhhhcCccccccc---ccccccCChHHHHhchhhcCCCC-C------------CccCCccchhccChhHHhhhhhcccC
Q psy10074        249 VERIHLNITKTRCE---LCDLRFFDKVGLKMHVMRKHTGE-K------------PFHCHYCDYICRTKYDLSSHIGRKHT  312 (420)
Q Consensus       249 ~~~~~~~~~~~~C~---~C~~~f~~~~~l~~H~~~~H~~~-~------------~~~C~~C~~~f~~~~~l~~H~~~~H~  312 (420)
                            -...+.|+   +|.+.|.+...|..| .++|.+. .            .-+|..|.+.|.....+..++ ..|.
T Consensus       662 ------~R~q~ScP~~~ic~~kftn~V~lpQh-IriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~-se~~  733 (958)
T KOG1074|consen  662 ------ARVQFSCPSTFICQKKFTNAVTLPQH-IRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQI-SEQP  733 (958)
T ss_pred             ------ccccccCCchhhhcccccccccccce-EEeecCCCCCCCcccccccchhcccchhhhcccccccchhhh-hccC
Confidence                  22456677   788888888778887 5666521 1            135777777777777776663 3332


Q ss_pred             Ccc------------cccC----ceecCCCCCccCChHHHhhhhhhhc-----------------------CC-------
Q psy10074        313 DKE------------VLEK----RYVCQLCPKQFLTSGELKYHQTTVH-----------------------RK-------  346 (420)
Q Consensus       313 ~~~------------~~~~----~~~C~~C~~~f~~~~~l~~H~~~h~-----------------------~~-------  346 (420)
                      ...            ..+.    +..+..|+..+.....+..+-..+.                       ++       
T Consensus       734 ~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~  813 (958)
T KOG1074|consen  734 SPESEPDEQMDERTETEELDVTPPPPENSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASS  813 (958)
T ss_pred             CcccCCcccccccccccccccCCCccccccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCccccc
Confidence            100            0011    3444555555544444333322110                       00       


Q ss_pred             ----------------------------------------------------------------cceecCcCCccccChh
Q psy10074        347 ----------------------------------------------------------------RVHECSECGFTFFLEK  362 (420)
Q Consensus       347 ----------------------------------------------------------------~~~~C~~C~~~f~~~~  362 (420)
                                                                                      ....|..||+.|...+
T Consensus       814 ~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSs  893 (958)
T KOG1074|consen  814 FPGEILAPSVNMDPVLWNQETSMLNEGLATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSA  893 (958)
T ss_pred             CCCcCCccccccCchhhcccccccccccccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchH
Confidence                                                                            1167999999999999


Q ss_pred             hHHHHHHhhcCCCCCcccCcCccccCCHHHHHccccccccCCC
Q psy10074        363 TLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFED  405 (420)
Q Consensus       363 ~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~  405 (420)
                      .|..|++ .|++++||.|..|++.|..+.+|+.||. .|.+..
T Consensus       894 ALqiH~r-THtg~KPF~C~fC~~aFttrgnLKvHMg-tH~w~q  934 (958)
T KOG1074|consen  894 ALEIHMR-THTGPKPFFCHFCEEAFTTRGNLKVHMG-THMWVQ  934 (958)
T ss_pred             HHHHhhh-cCCCCCCccchhhhhhhhhhhhhhhhhc-cccccC
Confidence            9999999 9999999999999999999999999995 665443



>KOG3608|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-15
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-07
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-06
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 5e-05
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-06
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-06
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 8e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-05
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 7e-05
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 2e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-04
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-04
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 3e-04
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-04
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 6e-04
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 6e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 79.3 bits (194), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 68/221 (30%), Positives = 86/221 (38%), Gaps = 39/221 (17%) Query: 182 FCSSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNI 241 F SS + GEKPY C C ++ L +H Sbjct: 4 FGSSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEH----------------------- 40 Query: 242 KKCMKRHVERIHLNITKTRCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKY 301 +R H +C C F DK L H R HTGEKP+ C C + Sbjct: 41 --------QRTHTGEKPYKCPECGKSFSDKKDLTRH-QRTHTGEKPYKCPECGKSFSQRA 91 Query: 302 DLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVHECSECGFTFFLE 361 +L +H R HT EK Y C C K F L+ HQ T ++ ++C ECG +F E Sbjct: 92 NLRAHQ-RTHTG----EKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSRE 146 Query: 362 KTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHT 402 L H R TH E P+ CP C R+ L H R HT Sbjct: 147 DNLHTHQR-THTGEKPYKCPECGKSFSRRDALNVHQ-RTHT 185
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-15
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-12
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-11
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-11
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-07
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-06
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 8e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 1e-05
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 5e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score = 77.1 bits (191), Expect = 9e-17
 Identities = 70/236 (29%), Positives = 87/236 (36%), Gaps = 62/236 (26%)

Query: 181 SFC-SSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGT 239
           S   SS       +  GEKPY C  C    ++   L +H                     
Sbjct: 2   SEFGSSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEH--------------------- 40

Query: 240 NIKKCMKRHVERIHLNITKT-----RCELCDLRFFDKVGLKMHVMRKHTGEKPFHCHYCD 294
                     +R H     T     +C  C   F DK  L  H  R HTGEKP+ C  C 
Sbjct: 41  ----------QRTH-----TGEKPYKCPECGKSFSDKKDLTRH-QRTHTGEKPYKCPECG 84

Query: 295 YICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTVHRKRVH----- 349
                + +L +H  R HT     EK Y C  C K F     L+ HQ      R H     
Sbjct: 85  KSFSQRANLRAH-QRTHTG----EKPYACPECGKSFSQLAHLRAHQ------RTHTGEKP 133

Query: 350 -ECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFE 404
            +C ECG +F  E  L  H R TH  E P+ CP C     R+  L  H +R HT +
Sbjct: 134 YKCPECGKSFSREDNLHTHQR-THTGEKPYKCPECGKSFSRRDALNVH-QRTHTGK 187


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.98
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.91
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.87
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.84
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.84
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.83
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.82
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.82
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.8
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.73
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.73
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.72
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.71
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.71
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.7
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.67
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.67
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.67
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.67
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.66
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.66
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.64
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.63
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.63
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.62
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.61
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.6
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.59
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.59
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.58
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.56
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.55
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.53
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.53
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.52
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.51
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.51
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.48
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.47
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.47
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.47
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.46
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.45
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.43
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.41
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.41
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.4
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.4
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.4
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.4
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.39
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.39
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.36
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.36
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.35
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.35
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.34
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.33
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.33
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.31
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.3
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.3
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.3
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.29
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.28
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.27
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.27
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.27
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.25
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.24
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.16
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.1
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.05
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.03
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.95
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.95
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.94
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.94
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.93
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.93
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.93
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.92
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.92
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.91
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.9
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.9
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.9
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.9
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.89
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.89
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.88
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.87
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.87
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.85
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.84
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.84
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.84
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.83
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.83
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.83
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.82
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.78
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.78
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.77
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.76
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.76
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.75
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.75
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.75
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.74
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.74
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.73
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.73
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.73
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.73
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.73
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.73
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.71
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.69
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.68
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.68
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.67
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.67
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.67
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.66
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.65
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.64
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.64
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.62
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.62
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.62
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.62
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.6
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.6
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.59
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.58
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.57
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.56
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.54
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.54
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.53
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.46
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.45
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.44
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.42
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.4
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.4
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.37
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.27
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.24
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.23
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.22
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.14
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.13
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.12
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.12
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.11
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.1
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.09
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.06
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.05
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.04
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.02
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.01
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.01
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.0
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.99
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.99
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.96
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.94
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.84
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.81
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.81
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.8
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.79
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.79
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.77
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.73
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.73
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.72
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.72
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.71
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.69
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.68
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.68
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.68
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.85
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.67
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.67
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.66
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.66
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.65
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.65
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.64
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.79
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.79
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.61
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.61
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.75
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.59
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.58
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.57
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.72
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.55
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.52
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.67
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.52
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.45
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.42
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.21
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.15
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.18
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.93
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.66
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.31
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.3
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.74
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.67
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.47
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.45
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.04
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.96
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 87.77
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 87.01
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 85.9
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 85.73
2k5c_A95 Uncharacterized protein PF0385; structural genomic 83.3
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 80.86
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 80.45
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=1.8e-34  Score=246.02  Aligned_cols=185  Identities=36%  Similarity=0.621  Sum_probs=125.7

Q ss_pred             hhHHHHHHHHhcCCCceecccccccccCHHHHHHHHhhccCCCcceeceeecccccChHHHHHHHHhhhhcCcccccccc
Q psy10074        184 SSHMKDHIRVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKHEVKHCFVNIVMNSYGTNIKKCMKRHVERIHLNITKTRCEL  263 (420)
Q Consensus       184 ~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~c~~c~~~~~~~~~~~l~~h~~~~~~~~~~~~C~~  263 (420)
                      ...|..|++.|.++++|.|+.|++.|.+...|..|++.+++                               ..+|.|+.
T Consensus         6 ~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-------------------------------~~~~~C~~   54 (190)
T 2i13_A            6 SSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTG-------------------------------EKPYKCPE   54 (190)
T ss_dssp             -------------------------CCSSHHHHHGGGCC----------------------------------CCEECTT
T ss_pred             hccchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCC-------------------------------CCCccCCC
Confidence            34566777777777777888888777777777777755433                               34567777


Q ss_pred             cccccCChHHHHhchhhcCCCCCCccCCccchhccChhHHhhhhhcccCCcccccCceecCCCCCccCChHHHhhhhhhh
Q psy10074        264 CDLRFFDKVGLKMHVMRKHTGEKPFHCHYCDYICRTKYDLSSHIGRKHTDKEVLEKRYVCQLCPKQFLTSGELKYHQTTV  343 (420)
Q Consensus       264 C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h  343 (420)
                      |++.|.+...|..| +..|.++++|.|+.|++.|.+...|..|+ ..|.+    +++|.|++|++.|.+...|..|+++|
T Consensus        55 C~~~f~~~~~l~~H-~~~h~~~~~~~C~~C~~~f~~~~~l~~H~-~~h~~----~~~~~C~~C~~~f~~~~~l~~H~~~h  128 (190)
T 2i13_A           55 CGKSFSDKKDLTRH-QRTHTGEKPYKCPECGKSFSQRANLRAHQ-RTHTG----EKPYACPECGKSFSQLAHLRAHQRTH  128 (190)
T ss_dssp             TCCEESSHHHHHHH-HHHHHCCCCEECTTTCCEESCHHHHHHHH-HHHHT----CCCEECTTTCCEESSHHHHHHHHHHH
T ss_pred             cCchhCCHHHHHHH-HHhcCCCCCccCcccCCccCCHHHHHHHH-HhcCC----CCCCcCCCCCCccCCHHHHHHHHHHh
Confidence            77788888888888 56677778888888888888888888885 44544    77899999999999999999999999


Q ss_pred             cCCcceecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHHHHHccccccccCCCCc
Q psy10074        344 HRKRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHMKRKHTFEDSL  407 (420)
Q Consensus       344 ~~~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~  407 (420)
                      +++++|.|+.|++.|.+...|..|++ .|.++++|.|++|++.|.+...|..|+ +.|+|++||
T Consensus       129 ~~~~~~~C~~C~~~f~~~~~L~~H~~-~H~~~~~~~C~~C~~~f~~~~~L~~H~-~~H~~~k~~  190 (190)
T 2i13_A          129 TGEKPYKCPECGKSFSREDNLHTHQR-THTGEKPYKCPECGKSFSRRDALNVHQ-RTHTGKKTS  190 (190)
T ss_dssp             HCCCCEECTTTCCEESCHHHHHHHHH-HHHCCCCEECTTTCCEESSHHHHHHHH-TTC------
T ss_pred             CCCCCeECCCCCcccCCHHHHHHHHH-hcCCCCCeECCCCCCccCCHHHHHHHH-HhcCCCCCC
Confidence            99999999999999999999999988 788888999999999999999999998 677777765



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 420
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.003
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.001
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.004
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.003
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.003
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.004
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.9 bits (99), Expect = 2e-06
 Identities = 16/32 (50%), Positives = 19/32 (59%)

Query: 192 RVHLGEKPYMCIYCAYRCTQKSDLKKHLRKKH 223
           R H GEKPY C  C  R TQ   +K H+ +KH
Sbjct: 1   RTHSGEKPYECYICHARFTQSGTMKMHILQKH 32


>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.49
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.47
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.2
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.18
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.95
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.9
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.88
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.86
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.86
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.85
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.85
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.81
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.75
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.75
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.71
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.7
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.68
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.67
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.65
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.65
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.61
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.6
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.59
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.57
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.54
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.51
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.34
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.34
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.32
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.31
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.27
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.21
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.21
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.19
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.02
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.02
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.99
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.94
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.89
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.86
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.8
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.74
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.68
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.67
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.59
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.58
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.54
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.53
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.51
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.49
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.48
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.47
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.45
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.42
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.42
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.37
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.28
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.18
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.13
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.06
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.06
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.04
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.02
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.95
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.91
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.91
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.85
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.79
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.75
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.73
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.66
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.64
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.6
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.58
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.43
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.39
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.39
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.26
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.12
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.95
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.71
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.61
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.4
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.37
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.33
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.16
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.08
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.88
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.81
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.76
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.65
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.48
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.94
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.82
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.74
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 93.18
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.15
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.4
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.92
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 90.72
d1y0jb136 U-shaped transcription factor, different fingers { 89.84
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 89.51
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.43
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.4
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.59
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 88.4
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 88.13
d1y0jb136 U-shaped transcription factor, different fingers { 87.78
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.4
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 85.09
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 84.65
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 84.59
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 84.16
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 83.71
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 83.4
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 82.76
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 81.96
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 81.82
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 81.8
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 80.58
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.49  E-value=7.2e-15  Score=93.70  Aligned_cols=50  Identities=30%  Similarity=0.583  Sum_probs=33.3

Q ss_pred             CcceecCcCCccccChhhHHHHHHhhcCCCCCcccCcCccccCCHHHHHccc
Q psy10074        346 KRVHECSECGFTFFLEKTLRAHIRETHRKETPFPCPFCEYKAKRKFELKSHM  397 (420)
Q Consensus       346 ~~~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~  397 (420)
                      ++||.|. ||++|+....|..|++ +|++++||.|++|+++|...+.|..|+
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~-~Ht~ekpy~C~~C~k~F~~~~~L~~H~   50 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMS-MHLGLRPYGCGVCGKKFKMKHHLVGHM   50 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHH-HHSCCCSEECTTTSCEESSSHHHHHHH
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhh-ccccccCCcCCCcCCEecCHHHHHHHH
Confidence            3566663 6666666666666666 666666666666666666666666666



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure