Psyllid ID: psy10090

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----
MRHSIKCRDVYRVTLWWYCYHLVEDKTVYAIQSLFYHYLFAYIVDFCAPLTKSKLRLVPIYQRIDKVMDVLEPFSTNEWSFINENIHTLWDSLSPQEQAKFPFNIRDLDWTKYLETYVKGILVYQLQDKLDPETRKYARRRYKRIQGDKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVGDKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYTPNPPPANKRIITTTRYES
ccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccEEEEcccHHHHHHHccHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEcccccccccccccccccccccccccHHHHHHcccccccccccccccEEEEEcccccccccccccccEEEEEEEEEccEEEEEEEccccccccccccccccccEEEEEEcccccccccccccccccEEEEccccc
ccccEEEEcccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccEcccHHHHHHHHHccHHHHHEEcccHccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccHHcccHHHHcccccHHHHHHcccHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHcccccEEcccccHHHHHccccHHHHcccHHcEEEEEcccccHHHHHHHHHHHcEEEEEEEEcccEEEEEEEcccEcccccccccEcccEEEEEEccccccccccccccccEEEEEEcccc
mrhsikcrdvyRVTLWWYCYHLVEDKTVYAIQSLFYHYLFAYIVDFcapltksklrlvPIYQRIDKVmdvlepfstnewSFINENIHTlwdslspqeqakfpfnirdldwTKYLETYVKGILVYQLQDKLDPETRKYARRRYKRiqgdkskndfsteadrSAETCIISSlaslfpsitiigeegresghthkmcdvppewiisdvdeailaktcppslqtlaekdivgdkskndfsteadrSAETCIISSlaslfpsitiigeegresghthkmcdvppewiisdvdeailaktcppslqtlaekDIVVwvdpldgtreytQGFLDHVTVLIGISAHGKALAGvihqpfynyqnkesgaqLGRTIwgiqdlgvggytpnpppankriitttryes
mrhsikcrdvyrvTLWWYCYHLVEDKTVYAIQSLFYHYLFAYIVDFCAPLTKSKLRLVPIYQRIDKVMDVLEPFSTNEWSFINENIHTLWDSLSPQEQAKFPFNIRDLDWTKYLETYVKGILvyqlqdkldpetRKYARrrykriqgdkskndfsteADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPslqtlaekdivgdkskNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTcppslqtlaekDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLgvggytpnpppankriitttryes
MRHSIKCRDVYRVTLWWYCYHLVEDKTVYAIQSLFYHYLFAYIVDFCAPLTKSKLRLVPIYQRIDKVMDVLEPFSTNEWSFINENIHTLWDSLSPQEQAKFPFNIRDLDWTKYLETYVKGILVYQLQDKLDPETRKYARRRYKRIQGDKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVGDKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYTPNPPPANKRIITTTRYES
****IKCRDVYRVTLWWYCYHLVEDKTVYAIQSLFYHYLFAYIVDFCAPLTKSKLRLVPIYQRIDKVMDVLEPFSTNEWSFINENIHTLWDSLSPQEQAKFPFNIRDLDWTKYLETYVKGILVYQLQDKL*********************************TCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTL**********************ETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYT******************
****IKCRDVYRVTLWWYCYHLVEDKTVYAIQSLFYHYLFAYIVDFCAPLTKSKLRLVPIYQRIDKVMDVLEPFSTNEWSFINENIHTLWDSLSPQEQAKFPFNIRDLDWTKYLETYVKGILVYQLQDKLDPETRKYARRRYKRIQGDKSKNDFSTEADRSAETCIISSLASLFPSITIIG**********KMCDVPPEWIISDVDEAILAKTCP*******************FSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYT***********T******
MRHSIKCRDVYRVTLWWYCYHLVEDKTVYAIQSLFYHYLFAYIVDFCAPLTKSKLRLVPIYQRIDKVMDVLEPFSTNEWSFINENIHTLWDSLSPQEQAKFPFNIRDLDWTKYLETYVKGILVYQLQDKLDPETRKYARRRYKRIQGDKSK**********AETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVGDKSK**********AETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYTPNPPPANKRIITTTRYES
**HSIKCRDVYRVTLWWYCYHLVEDKTVYAIQSLFYHYLFAYIVDFCAPLTKSKLRLVPIYQRIDKVMDVLEPFSTNEWSFINENIHTLWDSLSPQEQAKFPFNIRDLDWTKYLETYVKGILVYQLQDKLDPETRKYARRRYKRIQGDKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVGDKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYTPNPPPANKRIITTTR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRHSIKCRDVYRVTLWWYCYHLVEDKTVYAIQSLFYHYLFAYIVDFCAPLTKSKLRLVPIYQRIDKVMDVLEPFSTNEWSFINENIHTLWDSLSPQEQAKFPFNIRDLDWTKYLETYVKGILVYQLQDKLDPETRKYARRRYKRIQGDKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVGDKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYTPNPPPANKRIITTTRYES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query395 2.2.26 [Sep-21-2011]
Q9Z0S1 308 3'(2'),5'-bisphosphate nu yes N/A 0.427 0.548 0.5 1e-38
Q3ZCK3 308 3'(2'),5'-bisphosphate nu yes N/A 0.402 0.516 0.472 4e-38
Q9Z1N4 308 3'(2'),5'-bisphosphate nu yes N/A 0.427 0.548 0.5 4e-38
O95861 308 3'(2'),5'-bisphosphate nu yes N/A 0.425 0.545 0.502 8e-38
Q869K3 311 3'(2'),5'-bisphosphate nu yes N/A 0.387 0.491 0.369 7e-18
A1ZAI5625 Putative fatty acyl-CoA r no N/A 0.326 0.206 0.312 2e-15
Q9VYF2 355 Putative inositol monopho no N/A 0.283 0.315 0.322 5e-12
Q7TNT2515 Fatty acyl-CoA reductase no N/A 0.263 0.201 0.349 1e-11
Q29JH0 355 Putative inositol monopho no N/A 0.283 0.315 0.314 1e-11
Q0P5J1515 Fatty acyl-CoA reductase no N/A 0.253 0.194 0.333 9e-11
>sp|Q9Z0S1|BPNT1_MOUSE 3'(2'),5'-bisphosphate nucleotidase 1 OS=Mus musculus GN=Bpnt1 PE=1 SV=2 Back     alignment and function desciption
 Score =  160 bits (405), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 109/178 (61%), Gaps = 9/178 (5%)

Query: 220 TLAEKD--IVGDKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDV 277
            +AE D  IV   S  D  T+ADR  +  I SSLA  FP +TIIGEE    G   +    
Sbjct: 29  VIAEGDLGIVQKTSATDLQTKADRLVQMSICSSLARKFPKLTIIGEEDLPPGEVDQELIE 88

Query: 278 PPEWIISDVDEAILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAH 337
             +W      E IL + CP     + E+D+VVWVDPLDGT+EYT+G LD+VTVLIGI+  
Sbjct: 89  DGQW------EEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYE 142

Query: 338 GKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYTPNPPPANKRIITTTRYES 395
           GKA+AG+I+QP+YNYQ     A LGRTIWG+  LG  G+     PA K IITTTR  S
Sbjct: 143 GKAIAGIINQPYYNYQAGPDAA-LGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHS 199
Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 7
>sp|Q3ZCK3|BPNT1_BOVIN 3'(2'),5'-bisphosphate nucleotidase 1 OS=Bos taurus GN=BPNT1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z1N4|BPNT1_RAT 3'(2'),5'-bisphosphate nucleotidase 1 OS=Rattus norvegicus GN=Bpnt1 PE=1 SV=1 Back     alignment and function description
>sp|O95861|BPNT1_HUMAN 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens GN=BPNT1 PE=1 SV=1 Back     alignment and function description
>sp|Q869K3|BPNT1_DICDI 3'(2'),5'-bisphosphate nucleotidase 1 OS=Dictyostelium discoideum GN=bpnt1 PE=3 SV=1 Back     alignment and function description
>sp|A1ZAI5|FACR1_DROME Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1 Back     alignment and function description
>sp|Q9VYF2|IMPA3_DROME Putative inositol monophosphatase 3 OS=Drosophila melanogaster GN=CG15743 PE=2 SV=1 Back     alignment and function description
>sp|Q7TNT2|FACR2_MOUSE Fatty acyl-CoA reductase 2 OS=Mus musculus GN=Far2 PE=2 SV=1 Back     alignment and function description
>sp|Q29JH0|IMPA3_DROPS Putative inositol monophosphatase 3 OS=Drosophila pseudoobscura pseudoobscura GN=GA13929 PE=3 SV=2 Back     alignment and function description
>sp|Q0P5J1|FACR2_BOVIN Fatty acyl-CoA reductase 2 OS=Bos taurus GN=FAR2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
242017257307 inositol monophosphatase family domain c 0.402 0.517 0.586 3e-50
91087101306 PREDICTED: similar to AGAP004654-PA [Tri 0.4 0.516 0.556 9e-49
357612386311 hypothetical protein KGM_11339 [Danaus p 0.407 0.517 0.568 8e-47
195390329306 GJ24097 [Drosophila virilis] gi|19415190 0.397 0.513 0.562 2e-45
195113509308 GI22044 [Drosophila mojavensis] gi|19391 0.397 0.509 0.562 4e-45
156551199306 PREDICTED: 3'(2'),5'-bisphosphate nucleo 0.460 0.594 0.489 8e-45
391339855311 PREDICTED: 3'(2'),5'-bisphosphate nucleo 0.407 0.517 0.550 1e-44
427788171321 Putative bisphosphate 3'-nucleotidase bp 0.415 0.510 0.547 1e-44
307209682306 3'(2'),5'-bisphosphate nucleotidase 1 [H 0.4 0.516 0.550 2e-44
383854340307 PREDICTED: 3'(2'),5'-bisphosphate nucleo 0.4 0.514 0.538 2e-44
>gi|242017257|ref|XP_002429108.1| inositol monophosphatase family domain containing protein [Pediculus humanus corporis] gi|212513972|gb|EEB16370.1| inositol monophosphatase family domain containing protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  205 bits (521), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/167 (58%), Positives = 122/167 (73%), Gaps = 8/167 (4%)

Query: 229 DKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDE 288
           +K KND  TEADRSA+ CII+SL+  FPS+ IIGEEG  +       DVP EWI  + D+
Sbjct: 39  EKGKNDLQTEADRSAQKCIIASLSKQFPSVHIIGEEGAIND------DVPNEWITKEADK 92

Query: 289 AILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALAGVIHQP 348
            +L   CP  L  +++ D+V+WVDPLDGT EYTQG LDHVTVLIGI+   +A+ GVIHQP
Sbjct: 93  NVLELDCPRELSNISDSDVVLWVDPLDGTSEYTQGLLDHVTVLIGIAVGNEAVGGVIHQP 152

Query: 349 FYNYQNKESGAQLGRTIWGIQDLGVGGYTPNPPPANKRIITTTRYES 395
           ++NY  KE   +LGRTIWGI+ +GVGG+TP  PPAN+RIITTTR  S
Sbjct: 153 YFNY--KEDDKELGRTIWGIRGIGVGGFTPKSPPANQRIITTTRSHS 197

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91087101|ref|XP_975068.1| PREDICTED: similar to AGAP004654-PA [Tribolium castaneum] gi|270009600|gb|EFA06048.1| hypothetical protein TcasGA2_TC008880 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357612386|gb|EHJ67956.1| hypothetical protein KGM_11339 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195390329|ref|XP_002053821.1| GJ24097 [Drosophila virilis] gi|194151907|gb|EDW67341.1| GJ24097 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195113509|ref|XP_002001310.1| GI22044 [Drosophila mojavensis] gi|193917904|gb|EDW16771.1| GI22044 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|156551199|ref|XP_001604882.1| PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1-like isoform 1 [Nasonia vitripennis] gi|345489447|ref|XP_003426141.1| PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|391339855|ref|XP_003744262.1| PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|427788171|gb|JAA59537.1| Putative bisphosphate 3'-nucleotidase bpnt1/inositol polyphosphate 1-phosphatase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|307209682|gb|EFN86540.1| 3'(2'),5'-bisphosphate nucleotidase 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383854340|ref|XP_003702679.1| PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
FB|FBgn0039698 306 CG7789 [Drosophila melanogaste 0.443 0.571 0.486 9.3e-43
MGI|MGI:1338800 308 Bpnt1 "bisphosphate 3'-nucleot 0.425 0.545 0.502 5.5e-38
RGD|621833 308 Bpnt1 "3'(2'), 5'-bisphosphate 0.425 0.545 0.502 1.5e-37
UNIPROTKB|Q9Z1N4 308 Bpnt1 "3'(2'),5'-bisphosphate 0.425 0.545 0.502 1.5e-37
UNIPROTKB|O95861 308 BPNT1 "3'(2'),5'-bisphosphate 0.430 0.551 0.491 3e-37
ZFIN|ZDB-GENE-040718-46 309 bpnt1 "bisphosphate nucleotida 0.407 0.521 0.505 3.9e-37
UNIPROTKB|F1S9K3 308 BPNT1 "Uncharacterized protein 0.417 0.535 0.5 6.3e-37
UNIPROTKB|Q3ZCK3 308 BPNT1 "3'(2'),5'-bisphosphate 0.422 0.542 0.505 1e-36
UNIPROTKB|E2R864 308 BPNT1 "Uncharacterized protein 0.422 0.542 0.5 1.3e-36
UNIPROTKB|J9P1R5 364 BPNT1 "Uncharacterized protein 0.422 0.458 0.5 1.3e-36
FB|FBgn0039698 CG7789 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 452 (164.2 bits), Expect = 9.3e-43, P = 9.3e-43
 Identities = 91/187 (48%), Positives = 125/187 (66%)

Query:   211 AKTCPPSLQTLAEKDIVG--DKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRES 268
             AK     ++ + +K  +G  DK KND  TEADRSA+ CII+SLA  FP++ IIGEEG   
Sbjct:    19 AKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIASLAKKFPTVKIIGEEG--- 75

Query:   269 GHTHKMCDVPPEWIISDVDEAILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHV 328
             G    +CD   +W+++++DE  L  +CP   + +  +D V+WVDPLDGT EYTQG ++HV
Sbjct:    76 GSDLNVCD---DWLVNELDEEFLQHSCPAEWKDVKPEDFVIWVDPLDGTAEYTQGHVEHV 132

Query:   329 TVLIGISAHGKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYTPNPPPANKRII 388
             TVLIGI+    A+ G+IHQPFY    ++   ++GRTIWG++ LG GG+T  P PA + II
Sbjct:   133 TVLIGIAVKDAAVGGIIHQPFY----QQPDGEMGRTIWGLKGLGTGGFTAVPAPAGQFII 188

Query:   389 TTTRYES 395
             TTTR  S
Sbjct:   189 TTTRSHS 195
GO:0008441 "3'(2'),5'-bisphosphate nucleotidase activity" evidence=ISS
GO:0046854 "phosphatidylinositol phosphorylation" evidence=IEA
MGI|MGI:1338800 Bpnt1 "bisphosphate 3'-nucleotidase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621833 Bpnt1 "3'(2'), 5'-bisphosphate nucleotidase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Z1N4 Bpnt1 "3'(2'),5'-bisphosphate nucleotidase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O95861 BPNT1 "3'(2'),5'-bisphosphate nucleotidase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-46 bpnt1 "bisphosphate nucleotidase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9K3 BPNT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCK3 BPNT1 "3'(2'),5'-bisphosphate nucleotidase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R864 BPNT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P1R5 BPNT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O95861BPNT1_HUMAN3, ., 1, ., 3, ., 70.50270.42530.5454yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
cd01640293 cd01640, IPPase, IPPase; Inositol polyphosphate-1- 3e-51
cd0907192 cd09071, FAR_C, C-terminal domain of fatty acyl Co 5e-34
pfam0301594 pfam03015, Sterile, Male sterility protein 8e-24
pfam00459 269 pfam00459, Inositol_P, Inositol monophosphatase fa 2e-21
COG0483260 COG0483, SuhB, Archaeal fructose-1,6-bisphosphatas 4e-17
cd01637238 cd01637, IMPase_like, Inositol-monophosphatase-lik 7e-15
cd01639244 cd01639, IMPase, IMPase, inositol monophosphatase 1e-14
cd01641248 cd01641, Bacterial_IMPase_like_1, Predominantly ba 5e-13
cd01638242 cd01638, CysQ, CysQ, a 3'-Phosphoadenosine-5'-phos 5e-12
cd01636184 cd01636, FIG, FIG, FBPase/IMPase/glpX-like domain 1e-11
cd01640293 cd01640, IPPase, IPPase; Inositol polyphosphate-1- 2e-11
cd01517 274 cd01517, PAP_phosphatase, PAP-phosphatase_like dom 2e-11
COG1218 276 COG1218, CysQ, 3'-Phosphoadenosine 5'-phosphosulfa 2e-10
pfam00459269 pfam00459, Inositol_P, Inositol monophosphatase fa 6e-10
TIGR01331249 TIGR01331, bisphos_cysQ, 3'(2'),5'-bisphosphate nu 8e-10
cd01639244 cd01639, IMPase, IMPase, inositol monophosphatase 4e-09
TIGR02067 251 TIGR02067, his_9_HisN, histidinol-phosphatase, ino 4e-09
cd01641248 cd01641, Bacterial_IMPase_like_1, Predominantly ba 5e-08
PRK10757267 PRK10757, PRK10757, inositol monophosphatase; Prov 5e-08
PLN02553270 PLN02553, PLN02553, inositol-phosphate phosphatase 5e-07
cd01517274 cd01517, PAP_phosphatase, PAP-phosphatase_like dom 2e-06
cd01643242 cd01643, Bacterial_IMPase_like_2, Bacterial family 2e-06
cd01637238 cd01637, IMPase_like, Inositol-monophosphatase-lik 4e-06
COG0483260 COG0483, SuhB, Archaeal fructose-1,6-bisphosphatas 6e-06
TIGR01330 353 TIGR01330, bisphos_HAL2, 3'(2'),5'-bisphosphate nu 6e-06
cd01636184 cd01636, FIG, FIG, FBPase/IMPase/glpX-like domain 1e-05
PRK10757267 PRK10757, PRK10757, inositol monophosphatase; Prov 1e-04
PRK10931246 PRK10931, PRK10931, adenosine-3'(2'),5'-bisphospha 2e-04
PLN02911296 PLN02911, PLN02911, inositol-phosphate phosphatase 6e-04
cd01638242 cd01638, CysQ, CysQ, a 3'-Phosphoadenosine-5'-phos 7e-04
COG1218276 COG1218, CysQ, 3'-Phosphoadenosine 5'-phosphosulfa 7e-04
PLN02503605 PLN02503, PLN02503, fatty acyl-CoA reductase 2 9e-04
TIGR01331249 TIGR01331, bisphos_cysQ, 3'(2'),5'-bisphosphate nu 0.001
PLN02911296 PLN02911, PLN02911, inositol-phosphate phosphatase 0.002
TIGR02067251 TIGR02067, his_9_HisN, histidinol-phosphatase, ino 0.003
PLN02553270 PLN02553, PLN02553, inositol-phosphate phosphatase 0.004
cd01643242 cd01643, Bacterial_IMPase_like_2, Bacterial family 0.004
>gnl|CDD|238818 cd01640, IPPase, IPPase; Inositol polyphosphate-1-phosphatase, a member of the Mg++ dependent family of inositol monophosphatase-like domains, hydrolyzes the 1' position phosphate from inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate Back     alignment and domain information 
 Score =  172 bits (439), Expect = 3e-51
 Identities = 74/165 (44%), Positives = 97/165 (58%), Gaps = 8/165 (4%)

Query: 229 DKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDE 288
            +  NDF T ADR ++  I  SL   FP + IIGEE  E        +   E    D+DE
Sbjct: 35  KEGANDFKTLADRLSQRVIKHSLQKQFPKLKIIGEEDNEF------ENQEDESRDVDLDE 88

Query: 289 AILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALAGVIHQP 348
            IL ++CP   + L E+D+ VWVDPLD T+EYT+G L++VTVLIG++  GK +AGVIHQP
Sbjct: 89  EILEESCPSPSKDLPEEDLGVWVDPLDATQEYTEGLLEYVTVLIGVAVKGKPIAGVIHQP 148

Query: 349 FYNYQNKESGAQLGRTIWGIQDLGVGG-YTPNPPPANKRIITTTR 392
           FY      +GA LGRTIWG+  LG           A K I++T+ 
Sbjct: 149 FYEKTA-GAGAWLGRTIWGLSGLGAHSSDFKEREDAGKIIVSTSH 192

Members in this group may also exhibit 3'-phosphoadenosine 5'-phosphate phosphatase activity, and they all appear to be inhibited by lithium. IPPase is one of the proposed targets of Li+ therapy in manic-depressive illness. Length = 293
>gnl|CDD|176924 cd09071, FAR_C, C-terminal domain of fatty acyl CoA reductases Back     alignment and domain information
>gnl|CDD|111859 pfam03015, Sterile, Male sterility protein Back     alignment and domain information
>gnl|CDD|215930 pfam00459, Inositol_P, Inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|223559 COG0483, SuhB, Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|238815 cd01637, IMPase_like, Inositol-monophosphatase-like domains Back     alignment and domain information
>gnl|CDD|238817 cd01639, IMPase, IMPase, inositol monophosphatase and related domains Back     alignment and domain information
>gnl|CDD|238819 cd01641, Bacterial_IMPase_like_1, Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases Back     alignment and domain information
>gnl|CDD|238816 cd01638, CysQ, CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|238814 cd01636, FIG, FIG, FBPase/IMPase/glpX-like domain Back     alignment and domain information
>gnl|CDD|238818 cd01640, IPPase, IPPase; Inositol polyphosphate-1-phosphatase, a member of the Mg++ dependent family of inositol monophosphatase-like domains, hydrolyzes the 1' position phosphate from inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate Back     alignment and domain information
>gnl|CDD|238775 cd01517, PAP_phosphatase, PAP-phosphatase_like domains Back     alignment and domain information
>gnl|CDD|224139 COG1218, CysQ, 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215930 pfam00459, Inositol_P, Inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|130398 TIGR01331, bisphos_cysQ, 3'(2'),5'-bisphosphate nucleotidase, bacterial Back     alignment and domain information
>gnl|CDD|238817 cd01639, IMPase, IMPase, inositol monophosphatase and related domains Back     alignment and domain information
>gnl|CDD|213680 TIGR02067, his_9_HisN, histidinol-phosphatase, inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|238819 cd01641, Bacterial_IMPase_like_1, Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases Back     alignment and domain information
>gnl|CDD|236753 PRK10757, PRK10757, inositol monophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|178168 PLN02553, PLN02553, inositol-phosphate phosphatase Back     alignment and domain information
>gnl|CDD|238775 cd01517, PAP_phosphatase, PAP-phosphatase_like domains Back     alignment and domain information
>gnl|CDD|238821 cd01643, Bacterial_IMPase_like_2, Bacterial family of Mg++ dependent phosphatases, related to inositol monophosphatases Back     alignment and domain information
>gnl|CDD|238815 cd01637, IMPase_like, Inositol-monophosphatase-like domains Back     alignment and domain information
>gnl|CDD|223559 COG0483, SuhB, Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233360 TIGR01330, bisphos_HAL2, 3'(2'),5'-bisphosphate nucleotidase, HAL2 family Back     alignment and domain information
>gnl|CDD|238814 cd01636, FIG, FIG, FBPase/IMPase/glpX-like domain Back     alignment and domain information
>gnl|CDD|236753 PRK10757, PRK10757, inositol monophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|182848 PRK10931, PRK10931, adenosine-3'(2'),5'-bisphosphate nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|178499 PLN02911, PLN02911, inositol-phosphate phosphatase Back     alignment and domain information
>gnl|CDD|238816 cd01638, CysQ, CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|224139 COG1218, CysQ, 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215279 PLN02503, PLN02503, fatty acyl-CoA reductase 2 Back     alignment and domain information
>gnl|CDD|130398 TIGR01331, bisphos_cysQ, 3'(2'),5'-bisphosphate nucleotidase, bacterial Back     alignment and domain information
>gnl|CDD|178499 PLN02911, PLN02911, inositol-phosphate phosphatase Back     alignment and domain information
>gnl|CDD|213680 TIGR02067, his_9_HisN, histidinol-phosphatase, inositol monophosphatase family Back     alignment and domain information
>gnl|CDD|178168 PLN02553, PLN02553, inositol-phosphate phosphatase Back     alignment and domain information
>gnl|CDD|238821 cd01643, Bacterial_IMPase_like_2, Bacterial family of Mg++ dependent phosphatases, related to inositol monophosphatases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 395
KOG1221|consensus467 99.96
PF0301594 Sterile: Male sterility protein; InterPro: IPR0042 99.96
COG0483 260 SuhB Archaeal fructose-1,6-bisphosphatase and rela 99.95
TIGR01331249 bisphos_cysQ 3'(2'),5'-bisphosphate nucleotidase, 99.95
KOG2951|consensus 279 99.95
COG1218 276 CysQ 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 99.95
cd01641248 Bacterial_IMPase_like_1 Predominantly bacterial fa 99.95
cd01643242 Bacterial_IMPase_like_2 Bacterial family of Mg++ d 99.95
PRK10757 267 inositol monophosphatase; Provisional 99.95
PLN02911 296 inositol-phosphate phosphatase 99.94
cd01638242 CysQ CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate 99.94
cd01640293 IPPase IPPase; Inositol polyphosphate-1-phosphatas 99.94
cd01639244 IMPase IMPase, inositol monophosphatase and relate 99.94
TIGR02067251 his_9_proposed histidinol-phosphate phosphatase Hi 99.94
PLN02553 270 inositol-phosphate phosphatase 99.94
PRK10931246 adenosine-3'(2'),5'-bisphosphate nucleotidase; Pro 99.94
cd01517 274 PAP_phosphatase PAP-phosphatase_like domains. PAP- 99.93
cd01637238 IMPase_like Inositol-monophosphatase-like domains. 99.93
PRK12676 263 bifunctional inositol-1 monophosphatase/fructose-1 99.93
PLN02737 363 inositol monophosphatase family protein 99.93
TIGR01330 353 bisphos_HAL2 3'(2'),5'-bisphosphate nucleotidase, 99.93
cd0907192 FAR_C C-terminal domain of fatty acyl CoA reductas 99.92
PF00459 270 Inositol_P: Inositol monophosphatase family; Inter 99.92
cd01515 257 Arch_FBPase_1 Archaeal fructose-1,6-bisphosphatase 99.92
cd01642244 Arch_FBPase_2 Putative fructose-1,6-bisphosphatase 99.9
KOG1528|consensus 351 99.89
PLN02996491 fatty acyl-CoA reductase 99.89
KOG3099|consensus 340 99.88
KOG3853|consensus 350 99.86
PRK14076 569 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 99.86
PLN02503605 fatty acyl-CoA reductase 2 99.77
cd01636184 FIG FIG, FBPase/IMPase/glpX-like domain. A superfa 99.75
KOG2951|consensus279 99.47
PRK09293 327 fructose-1,6-bisphosphatase; Provisional 99.14
PRK12415 322 fructose 1,6-bisphosphatase II; Reviewed 99.12
COG0483260 SuhB Archaeal fructose-1,6-bisphosphatase and rela 99.09
PLN02911296 inositol-phosphate phosphatase 99.06
PLN02737363 inositol monophosphatase family protein 99.04
cd00354 315 FBPase Fructose-1,6-bisphosphatase, an enzyme that 99.01
PRK10757267 inositol monophosphatase; Provisional 99.0
PLN02553270 inositol-phosphate phosphatase 98.99
TIGR02067251 his_9_proposed histidinol-phosphate phosphatase Hi 98.95
cd01517274 PAP_phosphatase PAP-phosphatase_like domains. PAP- 98.92
TIGR01331249 bisphos_cysQ 3'(2'),5'-bisphosphate nucleotidase, 98.91
PRK10931246 adenosine-3'(2'),5'-bisphosphate nucleotidase; Pro 98.91
cd01636184 FIG FIG, FBPase/IMPase/glpX-like domain. A superfa 98.89
cd01641248 Bacterial_IMPase_like_1 Predominantly bacterial fa 98.89
cd01643242 Bacterial_IMPase_like_2 Bacterial family of Mg++ d 98.86
cd01639244 IMPase IMPase, inositol monophosphatase and relate 98.86
cd01642244 Arch_FBPase_2 Putative fructose-1,6-bisphosphatase 98.83
TIGR01330353 bisphos_HAL2 3'(2'),5'-bisphosphate nucleotidase, 98.81
cd01637238 IMPase_like Inositol-monophosphatase-like domains. 98.81
PF00459270 Inositol_P: Inositol monophosphatase family; Inter 98.8
PRK12676263 bifunctional inositol-1 monophosphatase/fructose-1 98.8
cd01638242 CysQ CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate 98.8
cd01640293 IPPase IPPase; Inositol polyphosphate-1-phosphatas 98.69
cd01515257 Arch_FBPase_1 Archaeal fructose-1,6-bisphosphatase 98.48
COG1218276 CysQ 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 98.35
PLN02262 340 fructose-1,6-bisphosphatase 98.3
PRK14076 569 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 98.3
PLN02628 351 fructose-1,6-bisphosphatase family protein 97.55
PRK09293327 fructose-1,6-bisphosphatase; Provisional 97.48
PLN02462304 sedoheptulose-1,7-bisphosphatase 97.41
cd00354315 FBPase Fructose-1,6-bisphosphatase, an enzyme that 96.83
PLN02542 412 fructose-1,6-bisphosphatase 96.8
KOG1458|consensus 343 96.77
PF00316 324 FBPase: Fructose-1-6-bisphosphatase; InterPro: IPR 96.73
COG0158 326 Fbp Fructose-1,6-bisphosphatase [Carbohydrate tran 96.36
KOG3099|consensus340 95.98
PLN02262340 fructose-1,6-bisphosphatase 94.97
KOG3853|consensus350 90.34
KOG1528|consensus351 89.78
PRK09479 319 glpX fructose 1,6-bisphosphatase II; Reviewed 81.86
PRK12388 321 fructose-1,6-bisphosphatase II-like protein; Revie 81.49
cd01516 309 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, 80.65
>KOG1221|consensus Back     alignment and domain information 
Probab=99.96  E-value=2.3e-29  Score=252.24  Aligned_cols=133  Identities=32%  Similarity=0.636  Sum_probs=128.7

Q ss_pred             ccccceeeeeeeeeecCHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCccccHHHHHHHHHhcccCcccceEEEecccHHH
Q psy10090          9 DVYRVTLWWYCYHLVEDKTVYAIQSLFYHYLFAYIVDFCAPLTKSKLRLVPIYQRIDKVMDVLEPFSTNEWSFINENIHT   88 (395)
Q Consensus         9 ~~~~~~~~~p~~~~~~~~~~~~~~~~~~h~lPA~~~D~~~~l~g~kp~l~k~~~k~~~~~~~~~~Ft~~eW~F~~~n~~~   88 (395)
                      .++++++|||.+.+++|.+.|.++++++|+|||+++|+++++.|+||+++|+|+|+++++++++||++++|+|+++|+.+
T Consensus       334 ~Pl~~~iw~P~~~~~sn~~~f~~~~~~~h~lPa~~~d~~~~i~g~k~~~~k~~~ki~~~~~~l~~f~~~~w~Fd~~n~~~  413 (467)
T KOG1221|consen  334 IPLEKMIWYPFGTLTSNPWLFNLAAFLYHTLPAYILDLLLRLLGKKPRLVKLYRKIHKLVKLLEPFSLFKWIFDNKNTEK  413 (467)
T ss_pred             CCcccceeccCceeeecHhHHHHHHHHHHHhhHHHHHHHHHHhCCChhhhHHHHHHHHHHHhhhhheeceEEecCccHHH
Confidence            46678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhCCccccCceeeecCCCcHHHHHHHHHHHHHHHHhccCCChhhhhhhhhhhh
Q psy10090         89 LWDSLSPQEQAKFPFNIRDLDWTKYLETYVKGILVYQLQDKLDPETRKYARRRYK  143 (395)
Q Consensus        89 L~~~l~~~Dr~~F~fD~~~idW~~Y~~~~l~Girk~llke~~~~~tI~~ark~~r  143 (395)
                      |+++||++||++|+||+..+||++|+..|+.|+|+|++||  .+++++++|++++
T Consensus       414 L~~~~~~~d~~~f~fd~~~ldW~ey~~~~i~G~r~~llKe--~~e~l~~~r~~~k  466 (467)
T KOG1221|consen  414 LREKMSEEDKRLFNFDMKQLDWEEYFNRHLLGLRKYLLKE--SPESLPQARKRLK  466 (467)
T ss_pred             HHHhCCHHHHhhcCCCcccCCHHHHHHHHHHHHHHHHhcC--ChhhhHHHHHhhc
Confidence            9999999999999999999999999999999999999999  4799999998765

>PF03015 Sterile: Male sterility protein; InterPro: IPR004262 This family represents the C-terminal region of the male sterility protein in a number of organisms Back     alignment and domain information
>COG0483 SuhB Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01331 bisphos_cysQ 3'(2'),5'-bisphosphate nucleotidase, bacterial Back     alignment and domain information
>KOG2951|consensus Back     alignment and domain information
>COG1218 CysQ 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01641 Bacterial_IMPase_like_1 Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases Back     alignment and domain information
>cd01643 Bacterial_IMPase_like_2 Bacterial family of Mg++ dependent phosphatases, related to inositol monophosphatases Back     alignment and domain information
>PRK10757 inositol monophosphatase; Provisional Back     alignment and domain information
>PLN02911 inositol-phosphate phosphatase Back     alignment and domain information
>cd01638 CysQ CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family Back     alignment and domain information
>cd01640 IPPase IPPase; Inositol polyphosphate-1-phosphatase, a member of the Mg++ dependent family of inositol monophosphatase-like domains, hydrolyzes the 1' position phosphate from inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate Back     alignment and domain information
>cd01639 IMPase IMPase, inositol monophosphatase and related domains Back     alignment and domain information
>TIGR02067 his_9_proposed histidinol-phosphate phosphatase HisN, inositol monophosphatase family Back     alignment and domain information
>PLN02553 inositol-phosphate phosphatase Back     alignment and domain information
>PRK10931 adenosine-3'(2'),5'-bisphosphate nucleotidase; Provisional Back     alignment and domain information
>cd01517 PAP_phosphatase PAP-phosphatase_like domains Back     alignment and domain information
>cd01637 IMPase_like Inositol-monophosphatase-like domains Back     alignment and domain information
>PRK12676 bifunctional inositol-1 monophosphatase/fructose-1,6-bisphosphatase; Reviewed Back     alignment and domain information
>PLN02737 inositol monophosphatase family protein Back     alignment and domain information
>TIGR01330 bisphos_HAL2 3'(2'),5'-bisphosphate nucleotidase, HAL2 family Back     alignment and domain information
>cd09071 FAR_C C-terminal domain of fatty acyl CoA reductases Back     alignment and domain information
>PF00459 Inositol_P: Inositol monophosphatase family; InterPro: IPR000760 It has been shown that several proteins share two sequence motifs [] Back     alignment and domain information
>cd01515 Arch_FBPase_1 Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family (FBPase class IV) Back     alignment and domain information
>cd01642 Arch_FBPase_2 Putative fructose-1,6-bisphosphatase or related enzymes of inositol monophosphatase family Back     alignment and domain information
>KOG1528|consensus Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>KOG3099|consensus Back     alignment and domain information
>KOG3853|consensus Back     alignment and domain information
>PRK14076 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>cd01636 FIG FIG, FBPase/IMPase/glpX-like domain Back     alignment and domain information
>KOG2951|consensus Back     alignment and domain information
>PRK09293 fructose-1,6-bisphosphatase; Provisional Back     alignment and domain information
>PRK12415 fructose 1,6-bisphosphatase II; Reviewed Back     alignment and domain information
>COG0483 SuhB Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02911 inositol-phosphate phosphatase Back     alignment and domain information
>PLN02737 inositol monophosphatase family protein Back     alignment and domain information
>cd00354 FBPase Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway Back     alignment and domain information
>PRK10757 inositol monophosphatase; Provisional Back     alignment and domain information
>PLN02553 inositol-phosphate phosphatase Back     alignment and domain information
>TIGR02067 his_9_proposed histidinol-phosphate phosphatase HisN, inositol monophosphatase family Back     alignment and domain information
>cd01517 PAP_phosphatase PAP-phosphatase_like domains Back     alignment and domain information
>TIGR01331 bisphos_cysQ 3'(2'),5'-bisphosphate nucleotidase, bacterial Back     alignment and domain information
>PRK10931 adenosine-3'(2'),5'-bisphosphate nucleotidase; Provisional Back     alignment and domain information
>cd01636 FIG FIG, FBPase/IMPase/glpX-like domain Back     alignment and domain information
>cd01641 Bacterial_IMPase_like_1 Predominantly bacterial family of Mg++ dependend phosphatases, related to inositol monophosphatases Back     alignment and domain information
>cd01643 Bacterial_IMPase_like_2 Bacterial family of Mg++ dependent phosphatases, related to inositol monophosphatases Back     alignment and domain information
>cd01639 IMPase IMPase, inositol monophosphatase and related domains Back     alignment and domain information
>cd01642 Arch_FBPase_2 Putative fructose-1,6-bisphosphatase or related enzymes of inositol monophosphatase family Back     alignment and domain information
>TIGR01330 bisphos_HAL2 3'(2'),5'-bisphosphate nucleotidase, HAL2 family Back     alignment and domain information
>cd01637 IMPase_like Inositol-monophosphatase-like domains Back     alignment and domain information
>PF00459 Inositol_P: Inositol monophosphatase family; InterPro: IPR000760 It has been shown that several proteins share two sequence motifs [] Back     alignment and domain information
>PRK12676 bifunctional inositol-1 monophosphatase/fructose-1,6-bisphosphatase; Reviewed Back     alignment and domain information
>cd01638 CysQ CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family Back     alignment and domain information
>cd01640 IPPase IPPase; Inositol polyphosphate-1-phosphatase, a member of the Mg++ dependent family of inositol monophosphatase-like domains, hydrolyzes the 1' position phosphate from inositol 1,3,4-trisphosphate and inositol 1,4-bisphosphate Back     alignment and domain information
>cd01515 Arch_FBPase_1 Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family (FBPase class IV) Back     alignment and domain information
>COG1218 CysQ 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02262 fructose-1,6-bisphosphatase Back     alignment and domain information
>PRK14076 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PLN02628 fructose-1,6-bisphosphatase family protein Back     alignment and domain information
>PRK09293 fructose-1,6-bisphosphatase; Provisional Back     alignment and domain information
>PLN02462 sedoheptulose-1,7-bisphosphatase Back     alignment and domain information
>cd00354 FBPase Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate into fructose-6-phosphate and is critical in gluconeogenesis pathway Back     alignment and domain information
>PLN02542 fructose-1,6-bisphosphatase Back     alignment and domain information
>KOG1458|consensus Back     alignment and domain information
>PF00316 FBPase: Fructose-1-6-bisphosphatase; InterPro: IPR000146 This entry represents the fructose-1,6-bisphosphatase (FBPase) class 1 family Back     alignment and domain information
>COG0158 Fbp Fructose-1,6-bisphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3099|consensus Back     alignment and domain information
>PLN02262 fructose-1,6-bisphosphatase Back     alignment and domain information
>KOG3853|consensus Back     alignment and domain information
>KOG1528|consensus Back     alignment and domain information
>PRK09479 glpX fructose 1,6-bisphosphatase II; Reviewed Back     alignment and domain information
>PRK12388 fructose-1,6-bisphosphatase II-like protein; Reviewed Back     alignment and domain information
>cd01516 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
1jp4_A 308 Crystal Structure Of An Enzyme Displaying Both Inos 3e-39
2wef_A 311 Human 3'(2'), 5'-Bisphosphate Nucleotidase 1 (Bpnt1 6e-39
2qfl_A267 Structure Of Suhb: Inositol Monophosphatase And Ext 2e-05
1inp_A 400 Crystal Structure Of Inositol Polyphosphate 1-phosp 8e-05
2bji_A 277 High Resolution Structure Of Myo-Inositol Monophosp 3e-04
>pdb|1JP4|A Chain A, Crystal Structure Of An Enzyme Displaying Both Inositol- Polyphosphate 1-Phosphatase And 3'-Phosphoadenosine-5'- Phosphate Phosphatase Activities Length = 308 Back     alignment and structure 
Iteration: 1

 Score =  159 bits (401), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 110/178 (61%), Gaps = 9/178 (5%)
Query: 220 TLAEKD--IVGDKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDV 277
            +AE D  IV   S  D  T+ADR  +  I SSL+  FP +TIIGEE    G      +V
Sbjct: 29  VIAEGDLGIVQKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPPG------EV 82
Query: 278 PPEWIISDVDEAILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAH 337
             E I     E IL + CP     + E+D+VVWVDP+DGT+EYT+G LD+VTVLIGI+  
Sbjct: 83  DQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLDNVTVLIGIAYE 142
Query: 338 GKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYTPNPPPANKRIITTTRYES 395
           GKA+AG+I+QP+YNYQ     A LGRTIWG+  LG  G+     PA K IITTTR  S
Sbjct: 143 GKAIAGIINQPYYNYQAGPD-AVLGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHS 199
>pdb|2WEF|A Chain A, Human 3'(2'), 5'-Bisphosphate Nucleotidase 1 (Bpnt1) In Complex With Amp, Po4 And Magnesium Length = 311 Back     alignment and structure
>pdb|2QFL|A Chain A, Structure Of Suhb: Inositol Monophosphatase And Extragenic Suppressor From E. Coli Length = 267 Back     alignment and structure
>pdb|1INP|A Chain A, Crystal Structure Of Inositol Polyphosphate 1-phosphatase At 2.3 Angstroms Resolution Length = 400 Back     alignment and structure
>pdb|2BJI|A Chain A, High Resolution Structure Of Myo-Inositol Monophosphatase, The Target Of Lithium Therapy Length = 277 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
1jp4_A 308 3'(2'),5'-bisphosphate nucleotidase; protein-produ 3e-46
1jp4_A308 3'(2'),5'-bisphosphate nucleotidase; protein-produ 4e-12
1inp_A 400 Inositol polyphosphate 1-phosphatase; hydrolase(ph 4e-29
2q74_A 299 Inositol-1-monophosphatase; alpha-beta-alpha-beta- 4e-18
2q74_A299 Inositol-1-monophosphatase; alpha-beta-alpha-beta- 3e-11
3ryd_A273 Inositol monophosphatase family protein; impase fo 3e-16
3ryd_A273 Inositol monophosphatase family protein; impase fo 4e-09
2bji_A 277 Inositol-1(OR 4)-monophosphatase; hydrolase, aspar 4e-16
2bji_A277 Inositol-1(OR 4)-monophosphatase; hydrolase, aspar 1e-10
2pcr_A264 Inositol-1-monophosphatase; bipolar disorder, stru 6e-16
2pcr_A264 Inositol-1-monophosphatase; bipolar disorder, stru 5e-09
2fvz_A 273 Inositol monophosphatase 2; inositol metabolism, s 8e-16
2fvz_A273 Inositol monophosphatase 2; inositol metabolism, s 9e-11
2qfl_A267 Inositol-1-monophosphatase; impase extragenic supp 1e-15
2qfl_A267 Inositol-1-monophosphatase; impase extragenic supp 1e-08
1vdw_A254 Hypothetical protein PH1897; homodimer, riken stru 6e-15
1vdw_A254 Hypothetical protein PH1897; homodimer, riken stru 2e-07
2p3n_A256 Inositol-1-monophosphatase; tetramer, hydrolase; 2 1e-14
2p3n_A256 Inositol-1-monophosphatase; tetramer, hydrolase; 2 2e-08
3t0j_A 283 Impase II, inositol monophosphatase family protein 2e-14
3t0j_A283 Impase II, inositol monophosphatase family protein 2e-08
3lv0_A267 Extragenic suppressor protein SUHB; niaid, seattle 2e-14
3lv0_A267 Extragenic suppressor protein SUHB; niaid, seattle 2e-08
1xi6_A262 Extragenic suppressor; structural genomics, southe 3e-13
1xi6_A262 Extragenic suppressor; structural genomics, southe 7e-07
1ka1_A 357 Halotolerance protein HAL2; nucleotidase, salt tol 1e-12
1lbv_A252 Fbpase/impase, fructose 1,6-bisphosphatase/inosito 8e-12
1lbv_A252 Fbpase/impase, fructose 1,6-bisphosphatase/inosito 8e-06
1g0h_A252 Inositol monophosphatase; homodimer, complexed wit 3e-11
1g0h_A252 Inositol monophosphatase; homodimer, complexed wit 2e-05
3b8b_A292 CYSQ, sulfite synthesis pathway protein; 3'-phosph 5e-10
>1jp4_A 3'(2'),5'-bisphosphate nucleotidase; protein-product complex, sugar nucleotidase fold, hydrolase; HET: AMP; 1.69A {Rattus norvegicus} SCOP: e.7.1.1 PDB: 2wef_A* Length = 308 Back     alignment and structure
 Score =  159 bits (405), Expect = 3e-46
 Identities = 83/163 (50%), Positives = 103/163 (63%), Gaps = 7/163 (4%)

Query: 230 KSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEA 289
            S  D  T+ADR  +  I SSL+  FP +TIIGEE    G      +V  E I     E 
Sbjct: 41  TSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPPG------EVDQELIEDGQSEE 94

Query: 290 ILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALAGVIHQPF 349
           IL + CP     + E+D+VVWVDP+DGT+EYT+G LD+VTVLIGI+  GKA+AG+I+QP+
Sbjct: 95  ILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPY 154

Query: 350 YNYQNKESGAQLGRTIWGIQDLGVGGYTPNPPPANKRIITTTR 392
           YNYQ     A LGRTIWG+  LG  G+     PA K IITTTR
Sbjct: 155 YNYQAG-PDAVLGRTIWGVLGLGAFGFQLKEAPAGKHIITTTR 196
>1jp4_A 3'(2'),5'-bisphosphate nucleotidase; protein-product complex, sugar nucleotidase fold, hydrolase; HET: AMP; 1.69A {Rattus norvegicus} SCOP: e.7.1.1 PDB: 2wef_A* Length = 308 Back     alignment and structure
>1inp_A Inositol polyphosphate 1-phosphatase; hydrolase(phosphoric monoester); 2.30A {Bos taurus} SCOP: e.7.1.1 Length = 400 Back     alignment and structure
>2q74_A Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha sandwich, hydrolase; 2.60A {Mycobacterium tuberculosis} Length = 299 Back     alignment and structure
>2q74_A Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha sandwich, hydrolase; 2.60A {Mycobacterium tuberculosis} Length = 299 Back     alignment and structure
>3ryd_A Inositol monophosphatase family protein; impase fold, FIG superfamily protein, hydrolase; HET: SRT; 2.37A {Staphylococcus aureus} PDB: 3qmf_A Length = 273 Back     alignment and structure
>3ryd_A Inositol monophosphatase family protein; impase fold, FIG superfamily protein, hydrolase; HET: SRT; 2.37A {Staphylococcus aureus} PDB: 3qmf_A Length = 273 Back     alignment and structure
>2bji_A Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic proteinase mechanism, aspartyl protease, succinimide, zymogen; 1.30A {Bos taurus} PDB: 1imb_A* 1ima_A* 1imc_A 1imd_A 1ime_A 1imf_A 2hhm_A 1awb_A Length = 277 Back     alignment and structure
>2bji_A Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic proteinase mechanism, aspartyl protease, succinimide, zymogen; 1.30A {Bos taurus} PDB: 1imb_A* 1ima_A* 1imc_A 1imd_A 1ime_A 1imf_A 2hhm_A 1awb_A Length = 277 Back     alignment and structure
>2pcr_A Inositol-1-monophosphatase; bipolar disorder, struct genomics, NPPSFA, national project on protein structural AN functional analyses; 2.60A {Aquifex aeolicus} Length = 264 Back     alignment and structure
>2pcr_A Inositol-1-monophosphatase; bipolar disorder, struct genomics, NPPSFA, national project on protein structural AN functional analyses; 2.60A {Aquifex aeolicus} Length = 264 Back     alignment and structure
>2fvz_A Inositol monophosphatase 2; inositol metabolism, structural genomics, structural genomics consortium, SGC, hydrolase; 2.40A {Homo sapiens} PDB: 2czh_A 2czi_A 2czk_A 2ddk_A Length = 273 Back     alignment and structure
>2fvz_A Inositol monophosphatase 2; inositol metabolism, structural genomics, structural genomics consortium, SGC, hydrolase; 2.40A {Homo sapiens} PDB: 2czh_A 2czi_A 2czk_A 2ddk_A Length = 273 Back     alignment and structure
>2qfl_A Inositol-1-monophosphatase; impase extragenic suppressor, dimerization, hydrolase; 1.90A {Escherichia coli} Length = 267 Back     alignment and structure
>2qfl_A Inositol-1-monophosphatase; impase extragenic suppressor, dimerization, hydrolase; 1.90A {Escherichia coli} Length = 267 Back     alignment and structure
>1vdw_A Hypothetical protein PH1897; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; 1.30A {Pyrococcus horikoshii} SCOP: e.7.1.1 Length = 254 Back     alignment and structure
>1vdw_A Hypothetical protein PH1897; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; 1.30A {Pyrococcus horikoshii} SCOP: e.7.1.1 Length = 254 Back     alignment and structure
>2p3n_A Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A {Thermotoga maritima} PDB: 2p3v_A* Length = 256 Back     alignment and structure
>2p3n_A Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A {Thermotoga maritima} PDB: 2p3v_A* Length = 256 Back     alignment and structure
>3t0j_A Impase II, inositol monophosphatase family protein; FIG superfamily, hydrolase; HET: PG4; 2.59A {Staphylococcus aureus} Length = 283 Back     alignment and structure
>3t0j_A Impase II, inositol monophosphatase family protein; FIG superfamily, hydrolase; HET: PG4; 2.59A {Staphylococcus aureus} Length = 283 Back     alignment and structure
>3lv0_A Extragenic suppressor protein SUHB; niaid, seattle structural genomics center for infectious disease, ssgcid, CAT scratch disease; 1.85A {Bartonella henselae} PDB: 3luz_A Length = 267 Back     alignment and structure
>3lv0_A Extragenic suppressor protein SUHB; niaid, seattle structural genomics center for infectious disease, ssgcid, CAT scratch disease; 1.85A {Bartonella henselae} PDB: 3luz_A Length = 267 Back     alignment and structure
>1xi6_A Extragenic suppressor; structural genomics, southeast collaboratory for structural genomics hyperthermophIle, PSI; 2.80A {Pyrococcus furiosus} SCOP: e.7.1.1 Length = 262 Back     alignment and structure
>1xi6_A Extragenic suppressor; structural genomics, southeast collaboratory for structural genomics hyperthermophIle, PSI; 2.80A {Pyrococcus furiosus} SCOP: e.7.1.1 Length = 262 Back     alignment and structure
>1ka1_A Halotolerance protein HAL2; nucleotidase, salt tolerance, inositol, hydrolase; HET: A3P; 1.30A {Saccharomyces cerevisiae} SCOP: e.7.1.1 PDB: 1k9y_A 1ka0_A* 1k9z_A* 1qgx_A* Length = 357 Back     alignment and structure
>1lbv_A Fbpase/impase, fructose 1,6-bisphosphatase/inositol monophosphatase; dual activity, archaeal phosphatase, APO- form, hydrolase; 1.80A {Archaeoglobus fulgidus} SCOP: e.7.1.1 PDB: 1lbw_A 1lbx_A* 1lby_A* 1lbz_A* Length = 252 Back     alignment and structure
>1lbv_A Fbpase/impase, fructose 1,6-bisphosphatase/inositol monophosphatase; dual activity, archaeal phosphatase, APO- form, hydrolase; 1.80A {Archaeoglobus fulgidus} SCOP: e.7.1.1 PDB: 1lbw_A 1lbx_A* 1lby_A* 1lbz_A* Length = 252 Back     alignment and structure
>1g0h_A Inositol monophosphatase; homodimer, complexed with Ca2+ and I-1-P, hydrolase; HET: IPD; 2.30A {Methanocaldococcus jannaschii} SCOP: e.7.1.1 PDB: 1dk4_A* 1g0i_A* Length = 252 Back     alignment and structure
>1g0h_A Inositol monophosphatase; homodimer, complexed with Ca2+ and I-1-P, hydrolase; HET: IPD; 2.30A {Methanocaldococcus jannaschii} SCOP: e.7.1.1 PDB: 1dk4_A* 1g0i_A* Length = 252 Back     alignment and structure
>3b8b_A CYSQ, sulfite synthesis pathway protein; 3'-phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Length = 292 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
1jp4_A 308 3'(2'),5'-bisphosphate nucleotidase; protein-produ 99.96
3lv0_A 267 Extragenic suppressor protein SUHB; niaid, seattle 99.96
2pcr_A 264 Inositol-1-monophosphatase; bipolar disorder, stru 99.95
3ryd_A 273 Inositol monophosphatase family protein; impase fo 99.95
3b8b_A 292 CYSQ, sulfite synthesis pathway protein; 3'-phosph 99.95
3t0j_A 283 Impase II, inositol monophosphatase family protein 99.94
2p3n_A 256 Inositol-1-monophosphatase; tetramer, hydrolase; 2 99.94
2q74_A 299 Inositol-1-monophosphatase; alpha-beta-alpha-beta- 99.94
2qfl_A 267 Inositol-1-monophosphatase; impase extragenic supp 99.94
2bji_A 277 Inositol-1(OR 4)-monophosphatase; hydrolase, aspar 99.94
2fvz_A 273 Inositol monophosphatase 2; inositol metabolism, s 99.94
1g0h_A252 Inositol monophosphatase; homodimer, complexed wit 99.94
1vdw_A254 Hypothetical protein PH1897; homodimer, riken stru 99.93
1xi6_A262 Extragenic suppressor; structural genomics, southe 99.93
1ka1_A 357 Halotolerance protein HAL2; nucleotidase, salt tol 99.92
1inp_A 400 Inositol polyphosphate 1-phosphatase; hydrolase(ph 99.92
1lbv_A252 Fbpase/impase, fructose 1,6-bisphosphatase/inosito 99.9
1nuw_A 337 Fructose-1,6-bisphosphatase; allosteric enzymes, g 99.78
2gq1_A 332 Fructose-1,6-bisphosphatase; allosteric activator 99.68
2fhy_A 374 Fructose-1,6-bisphosphatase 1; allosteric inhibito 99.16
3ryd_A273 Inositol monophosphatase family protein; impase fo 99.15
3lv0_A267 Extragenic suppressor protein SUHB; niaid, seattle 99.11
2q74_A299 Inositol-1-monophosphatase; alpha-beta-alpha-beta- 99.03
3t0j_A283 Impase II, inositol monophosphatase family protein 99.02
3b8b_A292 CYSQ, sulfite synthesis pathway protein; 3'-phosph 99.02
2pcr_A264 Inositol-1-monophosphatase; bipolar disorder, stru 99.01
2bji_A277 Inositol-1(OR 4)-monophosphatase; hydrolase, aspar 99.01
2p3n_A256 Inositol-1-monophosphatase; tetramer, hydrolase; 2 99.0
2fvz_A273 Inositol monophosphatase 2; inositol metabolism, s 98.99
2qfl_A267 Inositol-1-monophosphatase; impase extragenic supp 98.89
1dcu_A 357 Fructose-1,6-bisphosphatase; chloroplast, photosyn 98.89
1ka1_A357 Halotolerance protein HAL2; nucleotidase, salt tol 98.88
1xi6_A262 Extragenic suppressor; structural genomics, southe 98.73
1jp4_A308 3'(2'),5'-bisphosphate nucleotidase; protein-produ 98.67
1vdw_A254 Hypothetical protein PH1897; homodimer, riken stru 98.67
1g0h_A252 Inositol monophosphatase; homodimer, complexed wit 98.65
1lbv_A252 Fbpase/impase, fructose 1,6-bisphosphatase/inosito 98.57
1inp_A 400 Inositol polyphosphate 1-phosphatase; hydrolase(ph 98.54
1nuw_A337 Fructose-1,6-bisphosphatase; allosteric enzymes, g 98.41
2gq1_A332 Fructose-1,6-bisphosphatase; allosteric activator 98.19
3uks_A 347 Sedoheptulose-1,7 bisphosphatase, putative; struct 97.89
2fhy_A374 Fructose-1,6-bisphosphatase 1; allosteric inhibito 96.49
1dcu_A357 Fructose-1,6-bisphosphatase; chloroplast, photosyn 95.07
3uks_A347 Sedoheptulose-1,7 bisphosphatase, putative; struct 85.39
>1jp4_A 3'(2'),5'-bisphosphate nucleotidase; protein-product complex, sugar nucleotidase fold, hydrolase; HET: AMP; 1.69A {Rattus norvegicus} SCOP: e.7.1.1 PDB: 2wef_A* Back     alignment and structure
Probab=99.96  E-value=5.1e-30  Score=248.73  Aligned_cols=164  Identities=51%  Similarity=0.848  Sum_probs=119.1

Q ss_pred             ccceeecCCCC-CCchhhHHHHHHHHHHHHHhhCCCCcEEecCCCCCCCCCCCCCCCcccccccchHHHHhhcCCccccc
Q psy10090        223 EKDIVGDKSKN-DFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQT  301 (395)
Q Consensus       223 ~~~~~~~K~~~-d~vT~aD~~~q~~I~~~L~~~~P~~~iigEE~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~  301 (395)
                      ...+. .|++. |+||.||+++|++|.+.|++.||++.|+|||.+...      .....|.....+++++...+|..+..
T Consensus        34 ~~~~~-~K~~~~d~VT~aD~~ae~~i~~~L~~~~P~~~ilgEE~~~~~------~~~~~~~~~~~~~~~l~~~~~~~~~~  106 (308)
T 1jp4_A           34 DLGIV-QKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPPG------EVDQELIEDGQSEEILKQPCPSQYSA  106 (308)
T ss_dssp             CCCCE-EEEETTEEECHHHHHHHHHHHHHHHHHCTTSEEEESSCCC--------CCCGGGCCCCCCHHHHTSCCCGGGTT
T ss_pred             Cccee-ecCCCCCCccHHHHHHHHHHHHHHHHHCCCCcEEccCCCccc------ccchhhhhhhhhHHHhhhccchhhhh
Confidence            45666 78765 999999999999999999999999999999986431      00112222334456665555544333


Q ss_pred             cCCCCceEEEeCCCchhhhhcCC-CccEEEEEEEEECCeEEEEEeccCCCCCCCCCCCCCCCcEEEEEecCCccccCCCC
Q psy10090        302 LAEKDIVVWVDPLDGTREYTQGF-LDHVTVLIGISAHGKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYTPNP  380 (395)
Q Consensus       302 ~~~~~~~~wiDPIDGT~nfv~g~-p~~~~v~ial~~~g~pv~gvv~~P~~~~~~~~~~~~~g~~~~a~~G~Ga~~~~~~~  380 (395)
                      +..++.+|||||||||+||++|. | +|||+|||+++|+|++||||+|+.+.... .+...|++|||.+|.|+|......
T Consensus       107 ~~~~~~~~wIDPIDGT~nFv~g~~p-~~~vsIal~~~g~pv~GvV~~P~~~~~~~-~~~~~~~~~~A~~G~Ga~~~~~~~  184 (308)
T 1jp4_A          107 IKEEDLVVWVDPVDGTKEYTEGLLD-NVTVLIGIAYEGKAIAGIINQPYYNYQAG-PDAVLGRTIWGVLGLGAFGFQLKE  184 (308)
T ss_dssp             CCGGGEEEEEEEEECHHHHHTTCGG-GCEEEEEEEETTEEEEEEEEETTTTTTSC-TTSCCCEEEEEETTTEEESSCCCC
T ss_pred             cCCCcceEEEcCCcchhHHhcCCCC-ceEEEEEEEECCEEEEEEEECCCCCCccC-ccCCCCeEEEEecCCCcccccCCC
Confidence            33345578899999999999999 7 89999999999999999999999532110 011248999999999999644333


Q ss_pred             CCCCCcEEEEccCCC
Q psy10090        381 PPANKRIITTTRYES  395 (395)
Q Consensus       381 ~~~~~~~~~~s~~~~  395 (395)
                      .+....+++++++|+
T Consensus       185 ~~~~~~~v~~~~~~~  199 (308)
T 1jp4_A          185 APAGKHIITTTRSHS  199 (308)
T ss_dssp             CCTTCCEEEEESSSC
T ss_pred             CCCCCeEEEEeCCCC
Confidence            333556777788773
>3lv0_A Extragenic suppressor protein SUHB; niaid, seattle structural genomics center for infectious disease, ssgcid, CAT scratch disease; 1.85A {Bartonella henselae} SCOP: e.7.1.0 PDB: 3luz_A Back     alignment and structure
>2pcr_A Inositol-1-monophosphatase; bipolar disorder, struct genomics, NPPSFA, national project on protein structural AN functional analyses; 2.60A {Aquifex aeolicus} Back     alignment and structure
>3ryd_A Inositol monophosphatase family protein; impase fold, FIG superfamily protein, hydrolase; HET: SRT; 2.37A {Staphylococcus aureus} PDB: 3qmf_A Back     alignment and structure
>3b8b_A CYSQ, sulfite synthesis pathway protein; 3'-phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3t0j_A Impase II, inositol monophosphatase family protein; FIG superfamily, hydrolase; HET: PG4; 2.59A {Staphylococcus aureus} Back     alignment and structure
>2p3n_A Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A {Thermotoga maritima} PDB: 2p3v_A* Back     alignment and structure
>2q74_A Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha sandwich, hydrolase; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfl_A Inositol-1-monophosphatase; impase extragenic suppressor, dimerization, hydrolase; 1.90A {Escherichia coli} Back     alignment and structure
>2bji_A Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic proteinase mechanism, aspartyl protease, succinimide, zymogen; 1.30A {Bos taurus} PDB: 1imb_A* 1ima_A* 1imc_A 1imd_A 1ime_A 1imf_A 2hhm_A 1awb_A Back     alignment and structure
>2fvz_A Inositol monophosphatase 2; inositol metabolism, structural genomics, structural genomics consortium, SGC, hydrolase; 2.40A {Homo sapiens} PDB: 2czh_A 2czi_A 2czk_A 2ddk_A Back     alignment and structure
>1g0h_A Inositol monophosphatase; homodimer, complexed with Ca2+ and I-1-P, hydrolase; HET: IPD; 2.30A {Methanocaldococcus jannaschii} SCOP: e.7.1.1 PDB: 1dk4_A* 1g0i_A* Back     alignment and structure
>1vdw_A Hypothetical protein PH1897; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; 1.30A {Pyrococcus horikoshii} SCOP: e.7.1.1 Back     alignment and structure
>1xi6_A Extragenic suppressor; structural genomics, southeast collaboratory for structural genomics hyperthermophIle, PSI; 2.80A {Pyrococcus furiosus} SCOP: e.7.1.1 Back     alignment and structure
>1ka1_A Halotolerance protein HAL2; nucleotidase, salt tolerance, inositol, hydrolase; HET: A3P; 1.30A {Saccharomyces cerevisiae} SCOP: e.7.1.1 PDB: 1k9y_A 1ka0_A* 1k9z_A* 1qgx_A* Back     alignment and structure
>1inp_A Inositol polyphosphate 1-phosphatase; hydrolase(phosphoric monoester); 2.30A {Bos taurus} SCOP: e.7.1.1 Back     alignment and structure
>1lbv_A Fbpase/impase, fructose 1,6-bisphosphatase/inositol monophosphatase; dual activity, archaeal phosphatase, APO- form, hydrolase; 1.80A {Archaeoglobus fulgidus} SCOP: e.7.1.1 PDB: 1lbw_A 1lbx_A* 1lby_A* 1lbz_A* Back     alignment and structure
>1nuw_A Fructose-1,6-bisphosphatase; allosteric enzymes, gluconeogenesis, hydrola; HET: F6P; 1.30A {Sus scrofa} SCOP: e.7.1.1 PDB: 1eyi_A* 1eyj_A* 1cnq_A* 1eyk_A* 1nux_A* 1nuy_A* 1nuz_A* 1nv0_A* 1nv1_A* 1nv2_A* 1nv3_A* 1nv4_A* 1nv5_A* 1nv6_A* 1nv7_A* 1q9d_A* 2qvu_A* 2qvv_A* 1fj6_A* 1fj9_A* ... Back     alignment and structure
>2gq1_A Fructose-1,6-bisphosphatase; allosteric activator site, quaternary conformation, hydrolas; 1.45A {Escherichia coli} PDB: 2owz_A* 2ox3_A* 2q8m_A* 2qvr_A* Back     alignment and structure
>2fhy_A Fructose-1,6-bisphosphatase 1; allosteric inhibitors human fbpase, benzoxazole, intersubunit allosteric inhibition of human fpbase, hydrolase; HET: A37; 2.95A {Homo sapiens} Back     alignment and structure
>3ryd_A Inositol monophosphatase family protein; impase fold, FIG superfamily protein, hydrolase; HET: SRT; 2.37A {Staphylococcus aureus} PDB: 3qmf_A Back     alignment and structure
>3lv0_A Extragenic suppressor protein SUHB; niaid, seattle structural genomics center for infectious disease, ssgcid, CAT scratch disease; 1.85A {Bartonella henselae} SCOP: e.7.1.0 PDB: 3luz_A Back     alignment and structure
>2q74_A Inositol-1-monophosphatase; alpha-beta-alpha-beta-alpha sandwich, hydrolase; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3t0j_A Impase II, inositol monophosphatase family protein; FIG superfamily, hydrolase; HET: PG4; 2.59A {Staphylococcus aureus} Back     alignment and structure
>3b8b_A CYSQ, sulfite synthesis pathway protein; 3'-phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2pcr_A Inositol-1-monophosphatase; bipolar disorder, struct genomics, NPPSFA, national project on protein structural AN functional analyses; 2.60A {Aquifex aeolicus} Back     alignment and structure
>2bji_A Inositol-1(OR 4)-monophosphatase; hydrolase, aspartic proteinase mechanism, aspartyl protease, succinimide, zymogen; 1.30A {Bos taurus} PDB: 1imb_A* 1ima_A* 1imc_A 1imd_A 1ime_A 1imf_A 2hhm_A 1awb_A Back     alignment and structure
>2p3n_A Inositol-1-monophosphatase; tetramer, hydrolase; 2.20A {Thermotoga maritima} PDB: 2p3v_A* Back     alignment and structure
>2fvz_A Inositol monophosphatase 2; inositol metabolism, structural genomics, structural genomics consortium, SGC, hydrolase; 2.40A {Homo sapiens} PDB: 2czh_A 2czi_A 2czk_A 2ddk_A Back     alignment and structure
>2qfl_A Inositol-1-monophosphatase; impase extragenic suppressor, dimerization, hydrolase; 1.90A {Escherichia coli} Back     alignment and structure
>1dcu_A Fructose-1,6-bisphosphatase; chloroplast, photosynthesis, redox regulation, thioredoxin, allostery, hydrolase; 2.20A {Pisum sativum} SCOP: e.7.1.1 PDB: 1d9q_A 1dbz_A 1spi_A Back     alignment and structure
>1ka1_A Halotolerance protein HAL2; nucleotidase, salt tolerance, inositol, hydrolase; HET: A3P; 1.30A {Saccharomyces cerevisiae} SCOP: e.7.1.1 PDB: 1k9y_A 1ka0_A* 1k9z_A* 1qgx_A* Back     alignment and structure
>1xi6_A Extragenic suppressor; structural genomics, southeast collaboratory for structural genomics hyperthermophIle, PSI; 2.80A {Pyrococcus furiosus} SCOP: e.7.1.1 Back     alignment and structure
>1jp4_A 3'(2'),5'-bisphosphate nucleotidase; protein-product complex, sugar nucleotidase fold, hydrolase; HET: AMP; 1.69A {Rattus norvegicus} SCOP: e.7.1.1 PDB: 2wef_A* Back     alignment and structure
>1vdw_A Hypothetical protein PH1897; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; 1.30A {Pyrococcus horikoshii} SCOP: e.7.1.1 Back     alignment and structure
>1g0h_A Inositol monophosphatase; homodimer, complexed with Ca2+ and I-1-P, hydrolase; HET: IPD; 2.30A {Methanocaldococcus jannaschii} SCOP: e.7.1.1 PDB: 1dk4_A* 1g0i_A* Back     alignment and structure
>1lbv_A Fbpase/impase, fructose 1,6-bisphosphatase/inositol monophosphatase; dual activity, archaeal phosphatase, APO- form, hydrolase; 1.80A {Archaeoglobus fulgidus} SCOP: e.7.1.1 PDB: 1lbw_A 1lbx_A* 1lby_A* 1lbz_A* Back     alignment and structure
>1inp_A Inositol polyphosphate 1-phosphatase; hydrolase(phosphoric monoester); 2.30A {Bos taurus} SCOP: e.7.1.1 Back     alignment and structure
>1nuw_A Fructose-1,6-bisphosphatase; allosteric enzymes, gluconeogenesis, hydrola; HET: F6P; 1.30A {Sus scrofa} SCOP: e.7.1.1 PDB: 1eyi_A* 1eyj_A* 1cnq_A* 1eyk_A* 1nux_A* 1nuy_A* 1nuz_A* 1nv0_A* 1nv1_A* 1nv2_A* 1nv3_A* 1nv4_A* 1nv5_A* 1nv6_A* 1nv7_A* 1q9d_A* 2qvu_A* 2qvv_A* 1fj6_A* 1fj9_A* ... Back     alignment and structure
>2gq1_A Fructose-1,6-bisphosphatase; allosteric activator site, quaternary conformation, hydrolas; 1.45A {Escherichia coli} PDB: 2owz_A* 2ox3_A* 2q8m_A* 2qvr_A* Back     alignment and structure
>2fhy_A Fructose-1,6-bisphosphatase 1; allosteric inhibitors human fbpase, benzoxazole, intersubunit allosteric inhibition of human fpbase, hydrolase; HET: A37; 2.95A {Homo sapiens} Back     alignment and structure
>1dcu_A Fructose-1,6-bisphosphatase; chloroplast, photosynthesis, redox regulation, thioredoxin, allostery, hydrolase; 2.20A {Pisum sativum} SCOP: e.7.1.1 PDB: 1d9q_A 1dbz_A 1spi_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 395
d1jp4a_ 304 e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxI 5e-21
d1jp4a_304 e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxI 1e-08
d1inpa_ 400 e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase 1e-18
d1ka1a_ 354 e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP p 1e-11
d2hhma_272 e.7.1.1 (A:) Inositol monophosphatase {Human (Homo 7e-04
d2hhma_272 e.7.1.1 (A:) Inositol monophosphatase {Human (Homo 0.001
d1vdwa_253 e.7.1.1 (A:) Archaeal inositol monophosphatase/fru 0.001
d1g0ha_252 e.7.1.1 (A:) Archaeal inositol monophosphatase/fru 0.001
>d1jp4a_ e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 304 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Carbohydrate phosphatase
superfamily: Carbohydrate phosphatase
family: Inositol monophosphatase/fructose-1,6-bisphosphatase-like
domain: PIPase
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 90.1 bits (222), Expect = 5e-21
 Identities = 86/173 (49%), Positives = 107/173 (61%), Gaps = 7/173 (4%)

Query: 223 EKDIVGDKSKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWI 282
           +  IV   S  D  T+ADR  +  I SSL+  FP +TIIGEE    G      +V  E I
Sbjct: 30  DLGIVQKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPPG------EVDQELI 83

Query: 283 ISDVDEAILAKTCPPSLQTLAEKDIVVWVDPLDGTREYTQGFLDHVTVLIGISAHGKALA 342
                E IL + CP     + E+D+VVWVDP+DGT+EYT+G LD+VTVLIGI+  GKA+A
Sbjct: 84  EDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLDNVTVLIGIAYEGKAIA 143

Query: 343 GVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYTPNPPPANKRIITTTRYES 395
           G+I+QP+YNYQ     A LGRTIWG+  LG  G+     PA K IITTTR  S
Sbjct: 144 GIINQPYYNYQ-AGPDAVLGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHS 195
>d1jp4a_ e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 304 Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Length = 400 Back     information, alignment and structure
>d1ka1a_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 354 Back     information, alignment and structure
>d2hhma_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d2hhma_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1vdwa_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 253 Back     information, alignment and structure
>d1g0ha_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 252 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
d1jp4a_ 304 PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} 99.94
d1ka1a_ 354 3';5'-adenosine bisphosphatase, PAP phosphatase {B 99.92
d1xi6a_249 Archaeal inositol monophosphatase/fructose-1,6-bis 99.92
d1g0ha_252 Archaeal inositol monophosphatase/fructose-1,6-bis 99.91
d2hhma_ 272 Inositol monophosphatase {Human (Homo sapiens) [Ta 99.91
d1vdwa_253 Archaeal inositol monophosphatase/fructose-1,6-bis 99.91
d1inpa_ 400 Inositol polyphosphate 1-phosphatase {Cow (Bos tau 99.89
d1lbva_252 Archaeal inositol monophosphatase/fructose-1,6-bis 99.87
d2hhma_272 Inositol monophosphatase {Human (Homo sapiens) [Ta 99.07
d1jp4a_304 PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} 98.91
d1g0ha_252 Archaeal inositol monophosphatase/fructose-1,6-bis 98.65
d1xi6a_249 Archaeal inositol monophosphatase/fructose-1,6-bis 98.65
d1ka1a_354 3';5'-adenosine bisphosphatase, PAP phosphatase {B 98.62
d1vdwa_253 Archaeal inositol monophosphatase/fructose-1,6-bis 98.58
d1inpa_ 400 Inositol polyphosphate 1-phosphatase {Cow (Bos tau 98.41
d1lbva_252 Archaeal inositol monophosphatase/fructose-1,6-bis 98.23
d1d9qa_ 340 Fructose-1,6-bisphosphatase {Garden pea (Pisum sat 96.91
d1nuwa_ 328 Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [Tax 96.32
d1ni9a_ 328 Glycerol metabolism protein GlpX {Escherichia coli 80.19
>d1jp4a_ e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Carbohydrate phosphatase
superfamily: Carbohydrate phosphatase
family: Inositol monophosphatase/fructose-1,6-bisphosphatase-like
domain: PIPase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.94  E-value=2.8e-27  Score=226.74  Aligned_cols=165  Identities=50%  Similarity=0.831  Sum_probs=126.4

Q ss_pred             cccceeecC-CCCCCchhhHHHHHHHHHHHHHhhCCCCcEEecCCCCCCCCCCCCCCCcccccccchHHHHhhcCCcccc
Q psy10090        222 AEKDIVGDK-SKNDFSTEADRSAETCIISSLASLFPSITIIGEEGRESGHTHKMCDVPPEWIISDVDEAILAKTCPPSLQ  300 (395)
Q Consensus       222 ~~~~~~~~K-~~~d~vT~aD~~~q~~I~~~L~~~~P~~~iigEE~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  300 (395)
                      +++.++ +| +..|+||.||+++|++|...|++.||++.|+|||+.....+      +.........++..+..++....
T Consensus        29 ~~~~~~-~K~~~~D~VT~aD~~~e~~I~~~L~~~~P~~~ivgEE~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~  101 (304)
T d1jp4a_          29 GDLGIV-QKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPPGEV------DQELIEDGQSEEILKQPCPSQYS  101 (304)
T ss_dssp             CCCCCE-EEEETTEEECHHHHHHHHHHHHHHHHHCTTSEEEESSCCC--CC------CGGGCCCCCCHHHHTSCCCGGGT
T ss_pred             CCccEE-ecCCCCCcccHHHHHHHHHHHHHHHHHCCCCEEEeccccccccc------chhhhccccchhhhccccccccc
Confidence            457777 76 67899999999999999999999999999999998765311      11111122234555555555444


Q ss_pred             ccCCCCceEEEeCCCchhhhhcCC-CccEEEEEEEEECCeEEEEEeccCCCCCCCCCCCCCCCcEEEEEecCCccccCCC
Q psy10090        301 TLAEKDIVVWVDPLDGTREYTQGF-LDHVTVLIGISAHGKALAGVIHQPFYNYQNKESGAQLGRTIWGIQDLGVGGYTPN  379 (395)
Q Consensus       301 ~~~~~~~~~wiDPIDGT~nfv~g~-p~~~~v~ial~~~g~pv~gvv~~P~~~~~~~~~~~~~g~~~~a~~G~Ga~~~~~~  379 (395)
                      ....++.+|||||||||+||++|. | +|||+|||+.+|+|++||||+|+++. ....+...|..|++.+|.|++.....
T Consensus       102 ~~~~~~~~WiIDPIDGT~nF~~g~~~-~~~v~IaL~~~g~pv~gvi~~P~~~~-~~~~~~~~g~~~~~~~~~~~~~~~~~  179 (304)
T d1jp4a_         102 AIKEEDLVVWVDPVDGTKEYTEGLLD-NVTVLIGIAYEGKAIAGIINQPYYNY-QAGPDAVLGRTIWGVLGLGAFGFQLK  179 (304)
T ss_dssp             TCCGGGEEEEEEEEECHHHHHTTCGG-GCEEEEEEEETTEEEEEEEEETTTTT-TSCTTSCCCEEEEEETTTEEESSCCC
T ss_pred             cccCCCceEEEcCccCchhhhcCCCC-ceeeeeeeeecccccceeeecccccc-eeccccccceeeccccccccceeeec
Confidence            556678788899999999999996 6 89999999999999999999998842 22223456899999999999987666


Q ss_pred             CCCCCCcEEEEccCCC
Q psy10090        380 PPPANKRIITTTRYES  395 (395)
Q Consensus       380 ~~~~~~~~~~~s~~~~  395 (395)
                      ..+....+++.+++|.
T Consensus       180 ~~~~~~~~~~~~~~~~  195 (304)
T d1jp4a_         180 EAPAGKHIITTTRSHS  195 (304)
T ss_dssp             CCCTTCCEEEEESSSC
T ss_pred             cCccccccccccccch
Confidence            5666777888888874
>d1ka1a_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xi6a_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g0ha_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hhma_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdwa_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Back     information, alignment and structure
>d1lbva_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hhma_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jp4a_ e.7.1.1 (A:) PIPase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g0ha_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xi6a_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ka1a_ e.7.1.1 (A:) 3';5'-adenosine bisphosphatase, PAP phosphatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vdwa_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Back     information, alignment and structure
>d1lbva_ e.7.1.1 (A:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1d9qa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nuwa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ni9a_ e.7.1.2 (A:) Glycerol metabolism protein GlpX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure