Psyllid ID: psy10173

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450------
MESTTGGKSIESLGPGPQKTSTVLSTTEGSTSTPLEKTTVTDLTSEGFSELPSSTGSTTEVSTITTSYDTSSLSTIDADLTSEGFSELPSSTGSTTEVSTITTSYDTSSLSTIDSTTTLNPLQTAIVKEVTLKKCKTKKPKKPKCDTTEFGCCFDGITAAKGPFSAALSPDFSKGCKPECAESPHGCCDDNVTAAHGPYKEGCCLNTPYGCCPDNILPARDSTTDASTLTPPTTDTPTTITETTPTETTITGIPSVITTETTTDASTTEISTTEAATSTTEAVSSTTAGSTTETSTVASSTAESTLISSTAASSTTLITTESTMESTTGGKSIESLGPGPQKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVEPSGKETSTILLTCDSIMNAVILDDLAVLVPKHLRDRIAVYITRNGNVRSNSKHLGLQGI
ccccccccccccccccccEEEEEEEEccccccEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccEEEEccccccccccccHHHHHHHcccccccccccccccccccccccccEEEEEEccccccEEEEEEccccccccccccHHHHccc
cccccccccEEEcccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccEEEEEcccccccEEEEEccccccccccccHHHHHHHccccccccccccccHHccccccccEccccEEEEEEEccccccEEEEEEccEccccccEccHHHHHHHccccccccccccccccccccccccHccEEEEEcccccccEEEEEEEcccccccccccccccc
mesttggksieslgpgpqktstvlsttegststplekttvtdltsegfselpsstgsttevstittsydtsslstidadltsegfselpsstgsttevstittsydtsslstidstttlnpLQTAIVKEVTlkkcktkkpkkpkcdttefgccfdgitaakgpfsaalspdfskgckpecaesphgccddnvtaahgpykegcclntpygccpdnilpardsttdastltppttdtpttitettptettitgipsvittetttdastteistteaatstteavssttagsttetstvasstAESTLIsstaassttlittestmesttggksieslgpgpqkacslpkdngpcrdftvkwfydgvdyggcnrfwyggcegngnrfksqeecravcvepsgketsTILLTCDSIMNAVILDDLAVLVPKHLRDRIAVYITRngnvrsnskhlglqgi
mesttggksieslgpgpqktstvlsttegststplekttvtdltsegfselpsstgsttevstITTSYDTSSLSTIDADLTsegfselpsstgsttevstittsydtsslstidstttlnplqTAIVkevtlkkcktkkpkkpkcdttEFGCCFDGITAAKGPFSAALSPDFSKGCKPECAESPHGCCDDNVTAAHGPYKEGCCLNTPYGCCPDNILPARdsttdastltppttdtpttitettptettitgipsvittetttdastteistteaatstteavssttagsttetstvasstaestlisstaassttlittestmesttggkSIESLGPGPQKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVEPSGKETSTILLTCDSIMNAVILDDLAVLVPKHLRDRIAVYitrngnvrsnskhlglqgi
MESTTGGKSIESLGPGPQKTSTVLSTTEGSTSTPLEKTTVTDLTSEGFSELPsstgsttevstittsydtSSLSTIDADLTSEGFSELPsstgsttevstittsydtsslstidstttlNPLQTAIvkevtlkkcktkkpkkpkcdtteFGCCFDGITAAKGPFSAALSPDFSKGCKPECAESPHGCCDDNVTAAHGPYKEGCCLNTPYGCCPDNILPARDsttdastltppttdtpttitettptettitGIPsvittetttdastteistteaatstteavssttagsttetstvasstaestlisstaassttlittestmesttGGKSIESLGPGPQKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVEPSGKETSTILLTCDSIMNAVILDDLAVLVPKHLRDRIAVYITRNGNVRSNSKHLGLQGI
*********************************************************************************************************************TLNPLQTAIVKEVTLKKCK*******KCDTTEFGCCFDGITAAKGPFSAALSPDFSKGCKPECAESPHGCCDDNVTAAHGPYKEGCCLNTPYGCCPDNIL**************************************************************************************************************************************PCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVEPSGKETSTILLTCDSIMNAVILDDLAVLVPKHLRDRIAVYITRNG**************
******G********************************************************************************************************TID*TTTLNPLQTA*V**********KKPKKPKCDTTEFGCCFDGITAAKGPFSAALSPDFSKGCKPECAESPHGCCDDNVTAAHGPYKEGCCLNTPYGCCPDNILPARDSTTDASTLTPPTTDTPTTITETTPTETTITGIPSVITTETTTDASTTEISTTEAATSTTEAVSSTTAGSTTETSTVASSTAESTLISSTAASST********************LGPGPQKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVEPSG*E****LLTCDSIMNAVILDDLAVLVPKHLRDRIAVYITRNGNVRSNSKHLGLQGI
***********************************EKTT******************************TSSLSTIDADLTSEGF***************************IDSTTTLNPLQTAIVKEVTLK************DTTEFGCCFDGITAAKGPFSAALSPDFSKGCKPECAESPHGCCDDNVTAAHGPYKEGCCLNTPYGCCPDNILPARDSTTDASTLTPPTTDTPTTITETTPTETTITGIPSVITTET***********************************************STAASSTTLIT*************IESLGPGPQKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVEPSGKETSTILLTCDSIMNAVILDDLAVLVPKHLRDRIAVYITRNGNVRSN*********
**********************************************************************************************TTEVSTITTSYDTSS***********PLQTAI****TLKKCKTKKPKKPKCDTTEFGCCFDGITAAKGPFSAALSPDFSKGCKPECAESPHGCCDDNVTAAHGPYKEGCCLNTPYGCCPDNILPARDSTTDASTLTPPTTDTPTTITETTPTETTITGIPSVITTE***DASTTEISTTEAATSTTEAVSSTTAGSTTETSTVASSTAESTLISSTAASSTTLITTESTMESTTGGKSIESLGPGPQKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVEPSGKETSTILLTCDSIMNAVILDDLAVLVPKHLRDRIAVYITRNGNVR*********G*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESTTGGKSIESLGPGPQKTSTVLSTTEGSTSTPLEKTTVTDLTSEGFSELPSSTGSTTEVSTITTSYDTSSLSTIDADLTSEGFSELPSSTGSTTEVSTITTSYDTSSLSTIDSTTTLNPLQTAIVKEVTLKKCKTKKPKKPKCDTTEFGCCFDGITAAKGPFSAALSPDFSKGCKPECAESPHGCCDDNVTAAHGPYKEGCCLNTPYGCCPDNILPARDSTTDASTLTPPTTDTPTTITETTPTETTITGIPSVITTETTTDASTTEISTTEAATSTTEAVSSTTAGSTTETSTVASSTAESTLISSTAASSTTLITTESTMESTTGGKSIESLGPGPQKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVEPSGKETSTILLTCDSIMNAVILDDLAVLVPKHLRDRIAVYITRNGNVRSNSKHLGLQGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query456 2.2.26 [Sep-21-2011]
Q868Z9 2898 Papilin OS=Drosophila mel no N/A 0.572 0.090 0.337 3e-31
O76840 2167 Papilin OS=Caenorhabditis yes N/A 0.530 0.111 0.287 8e-15
P121113177 Collagen alpha-3(VI) chai yes N/A 0.293 0.042 0.319 1e-14
O95428 1278 Papilin OS=Homo sapiens G no N/A 0.421 0.150 0.256 1e-13
Q9EPX2 1280 Papilin OS=Mus musculus G yes N/A 0.377 0.134 0.260 7e-13
P159893137 Collagen alpha-3(VI) chai no N/A 0.122 0.017 0.516 1e-11
Q8TEU8576 WAP, Kazal, immunoglobuli no N/A 0.188 0.149 0.379 4e-11
Q6T269151 Protease inhibitor bitisi N/A N/A 0.129 0.390 0.5 5e-11
P04366337 Protein AMBP (Fragment) O no N/A 0.140 0.189 0.5 1e-10
P00978352 Protein AMBP OS=Bos tauru no N/A 0.122 0.159 0.508 2e-10
>sp|Q868Z9|PPN_DROME Papilin OS=Drosophila melanogaster GN=Ppn PE=1 SV=2 Back     alignment and function desciption
 Score =  136 bits (343), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 105/311 (33%), Positives = 138/311 (44%), Gaps = 50/311 (16%)

Query: 142  KPKCDTTEFGCCFDGITAAKGP-FSA-ALSPDFSKGCK-------PE------------- 179
            K  C  +EFGCC D  T+AKGP F    L+   +KGC        P+             
Sbjct: 1367 KKSCSFSEFGCCPDAETSAKGPDFEGCGLASPVAKGCAESENGCCPDGQTPASGPNGEGC 1426

Query: 180  --CAESPHGCCDDNVTAAHGPYKEGCCLNTPYGCCPDNILPARDSTTDAS--TLTP---- 231
              C     GCC D+ T AHGP KEGCCL+T +GCCPDNIL AR    +      TP    
Sbjct: 1427 SGCTRERFGCCPDSQTPAHGPNKEGCCLDTQFGCCPDNILAARGPNNEGCECHYTPYGCC 1486

Query: 232  PTTDTPTT--ITETTPTETTITGI-PSVITTETTTDASTTEISTTEAAT---STTEAVSS 285
            P   +  T    E    ETT  G  P  IT             TT+        T A   
Sbjct: 1487 PDNKSAATGYNQEGCACETTQYGCCPDKITAAKGPKHEGCPCETTQFGCCPDGLTFAKGP 1546

Query: 286  TTAGSTTETSTVASSTAESTLISSTAASSTTLI----------TTESTMESTTGGKSIES 335
               G     +       E T          T +           T++T E   G ++++ 
Sbjct: 1547 HHHGCHCTQTEFKCCDDEKTPAKGPNGDGCTCVESKFGCCPDGVTKATDEKFGGCENVQE 1606

Query: 336  LGPGPQKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVC 395
                PQKAC LPK+ G C +++VK+++D   YGGC RFWYGGC+GN NRF+S+ EC+  C
Sbjct: 1607 P---PQKACGLPKETGTCNNYSVKYYFD-TSYGGCARFWYGGCDGNDNRFESEAECKDTC 1662

Query: 396  VEPSGKETSTI 406
             + +GK    +
Sbjct: 1663 QDYTGKHVCLL 1673
Essential extracellular matrix (ECM) protein that influences cell rearrangements. May act by modulating metalloproteinases action during organogenesis. Able to non-competitively inhibit procollagen N-proteinase, an ADAMTS metalloproteinase.
Drosophila melanogaster (taxid: 7227)
>sp|O76840|PPN1_CAEEL Papilin OS=Caenorhabditis elegans GN=mig-6 PE=1 SV=1 Back     alignment and function description
>sp|P12111|CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens GN=COL6A3 PE=1 SV=5 Back     alignment and function description
>sp|O95428|PPN_HUMAN Papilin OS=Homo sapiens GN=PAPLN PE=2 SV=4 Back     alignment and function description
>sp|Q9EPX2|PPN_MOUSE Papilin OS=Mus musculus GN=Papln PE=2 SV=2 Back     alignment and function description
>sp|P15989|CO6A3_CHICK Collagen alpha-3(VI) chain OS=Gallus gallus GN=COL6A3 PE=2 SV=2 Back     alignment and function description
>sp|Q8TEU8|WFKN2_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Homo sapiens GN=WFIKKN2 PE=1 SV=1 Back     alignment and function description
>sp|Q6T269|IVBI3_BITGA Protease inhibitor bitisilin-3 (Fragment) OS=Bitis gabonica PE=2 SV=1 Back     alignment and function description
>sp|P04366|AMBP_PIG Protein AMBP (Fragment) OS=Sus scrofa GN=AMBP PE=1 SV=2 Back     alignment and function description
>sp|P00978|AMBP_BOVIN Protein AMBP OS=Bos taurus GN=AMBP PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query456
328724572 2553 PREDICTED: papilin-like isoform 1 [Acyrt 0.583 0.104 0.373 2e-39
328724570 2494 PREDICTED: papilin-like isoform 2 [Acyrt 0.583 0.106 0.373 2e-39
307185838 2944 Papilin [Camponotus floridanus] 0.515 0.079 0.381 6e-37
270010741 2771 hypothetical protein TcasGA2_TC010195 [T 0.532 0.087 0.365 7e-37
242022723 2838 papilin, putative [Pediculus humanus cor 0.567 0.091 0.318 2e-36
383852694 2894 PREDICTED: papilin-like [Megachile rotun 0.633 0.099 0.338 3e-36
332020126 2748 Papilin [Acromyrmex echinatior] 0.504 0.083 0.370 6e-36
350422357 2962 PREDICTED: LOW QUALITY PROTEIN: papilin- 0.618 0.095 0.337 9e-36
340713638 3067 PREDICTED: papilin-like [Bombus terrestr 0.517 0.076 0.363 8e-35
345489863 2588 PREDICTED: papilin-like [Nasonia vitripe 0.515 0.090 0.364 1e-34
>gi|328724572|ref|XP_001951980.2| PREDICTED: papilin-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  170 bits (430), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 112/300 (37%), Positives = 140/300 (46%), Gaps = 34/300 (11%)

Query: 137  TKKPKKPKCDTTEFGCCFDGITAAKG-PFSAALSPDFSK--------GCKPECAESPHGC 187
            T +P    C  +EFGCC DG+T+A G      +  DF           C   CA+   GC
Sbjct: 1243 TSEPPTDSCQLSEFGCCPDGVTSASGYNLEGCIGVDFDNCTYNENDTECLSACAKEQFGC 1302

Query: 188  CDDNVTAAHGPYKEGCCLNTPYGCCPDNILPARDSTTDAS--TLTPPTTDTPTTITETTP 245
            CDDN TAAHGP KEGCCL + YGCCPDNI+PA            TP       T T   P
Sbjct: 1303 CDDNTTAAHGPNKEGCCLYSQYGCCPDNIVPANGPNLQGCGCIYTPFGCCPDNTTTARGP 1362

Query: 246  TE-------TTITGIPSVITTETTTDASTTEISTTEAAT---STTEAVSSTTAGSTTETS 295
                     T     P   T  +          T +        T+A+   + G   E +
Sbjct: 1363 NNSGCSCQYTEHKCCPDNFTPASGPQYQGCACHTYQFGCCPDGITKAIGPNSQGCGCEYT 1422

Query: 296  TVASSTA-------ESTLISSTAASSTTLI--TTESTMESTTGGKSIESLGPGPQKACSL 346
                 +        ES   S  A+     +   TES  E+  G +S   L   P   C  
Sbjct: 1423 QYGCCSDKNTPAPDESKNCSCEASKYGCCLDGITESKGENFEGCQSKPIL---PGDRCKE 1479

Query: 347  PKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVEPSGKETSTI 406
            PKD G C DFTVKWF+D  +YGGC+RFWYGGC GN NRFK+QEEC+ +CVEPSG++   +
Sbjct: 1480 PKDRGSCSDFTVKWFFD-TEYGGCSRFWYGGCNGNNNRFKTQEECKDICVEPSGRDVCYL 1538

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328724570|ref|XP_003248188.1| PREDICTED: papilin-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307185838|gb|EFN71679.1| Papilin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|270010741|gb|EFA07189.1| hypothetical protein TcasGA2_TC010195 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242022723|ref|XP_002431788.1| papilin, putative [Pediculus humanus corporis] gi|212517113|gb|EEB19050.1| papilin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383852694|ref|XP_003701860.1| PREDICTED: papilin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332020126|gb|EGI60570.1| Papilin [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350422357|ref|XP_003493139.1| PREDICTED: LOW QUALITY PROTEIN: papilin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713638|ref|XP_003395347.1| PREDICTED: papilin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|345489863|ref|XP_001601735.2| PREDICTED: papilin-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query456
FB|FBgn0003137 2898 Ppn "Papilin" [Drosophila mela 0.146 0.023 0.529 4.3e-38
WB|WBGene00003242 2167 mig-6 [Caenorhabditis elegans 0.122 0.025 0.491 2.8e-22
UNIPROTKB|F1P2U7 1275 F1P2U7 "Uncharacterized protei 0.111 0.04 0.557 9.7e-20
UNIPROTKB|H0YJA1214 PAPLN "Papilin" [Homo sapiens 0.111 0.238 0.480 4.5e-19
UNIPROTKB|G3V5P6929 PAPLN "Papilin" [Homo sapiens 0.111 0.054 0.480 1.1e-18
UNIPROTKB|O95428 1278 PAPLN "Papilin" [Homo sapiens 0.111 0.039 0.480 2.4e-18
RGD|1311176 1296 Papln "papilin, proteoglycan-l 0.111 0.039 0.480 3.2e-18
UNIPROTKB|J9NW02 975 J9NW02 "Uncharacterized protei 0.118 0.055 0.509 9.6e-18
MGI|MGI:2386139 1280 Papln "papilin, proteoglycan-l 0.111 0.039 0.480 1.2e-17
UNIPROTKB|E2QTA2 1227 E2QTA2 "Uncharacterized protei 0.118 0.044 0.509 1.7e-17
FB|FBgn0003137 Ppn "Papilin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 227 (85.0 bits), Expect = 4.3e-38, Sum P(3) = 4.3e-38
 Identities = 36/68 (52%), Positives = 51/68 (75%)

Query:   334 ESLGPGPQKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRA 393
             E++   PQKAC LPK+ G C +++VK+++D   YGGC RFWYGGC+GN NRF+S+ EC+ 
Sbjct:  1602 ENVQEPPQKACGLPKETGTCNNYSVKYYFD-TSYGGCARFWYGGCDGNDNRFESEAECKD 1660

Query:   394 VCVEPSGK 401
              C + +GK
Sbjct:  1661 TCQDYTGK 1668
GO:0005604 "basement membrane" evidence=IDA
GO:0005578 "proteinaceous extracellular matrix" evidence=NAS
GO:0030198 "extracellular matrix organization" evidence=IMP
GO:0005201 "extracellular matrix structural constituent" evidence=IMP
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004222 "metalloendopeptidase activity" evidence=IEA
GO:0004867 "serine-type endopeptidase inhibitor activity" evidence=IEA
WB|WBGene00003242 mig-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2U7 F1P2U7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H0YJA1 PAPLN "Papilin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V5P6 PAPLN "Papilin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O95428 PAPLN "Papilin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1311176 Papln "papilin, proteoglycan-like sulfated glycoprotein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NW02 J9NW02 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2386139 Papln "papilin, proteoglycan-like sulfated glycoprotein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTA2 E2QTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
pfam0001453 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic t 1e-21
cd0010954 cd00109, KU, BPTI/Kunitz family of serine protease 2e-21
smart0013153 smart00131, KU, BPTI/Kunitz family of serine prote 4e-20
COG3889872 COG3889, COG3889, Predicted solute binding protein 2e-05
COG3889872 COG3889, COG3889, Predicted solute binding protein 3e-05
PRK11907 814 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucl 5e-05
PRK11907 814 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucl 5e-04
PRK11907 814 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucl 0.002
pfam05109 830 pfam05109, Herpes_BLLF1, Herpes virus major outer 0.002
PRK11907 814 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucl 0.003
>gnl|CDD|200929 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic trypsin inhibitor domain Back     alignment and domain information 
 Score = 87.4 bits (217), Expect = 1e-21
 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 343 ACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCV 396
            C LP D GPCR    +W+Y+    G C  F YGGC GN N F+S EEC   C 
Sbjct: 1   FCLLPPDPGPCRGSIPRWYYNPST-GQCEPFIYGGCGGNANNFESLEECEKACR 53

Indicative of a protease inhibitor, usually a serine protease inhibitor. Structure is a disulfide rich alpha+beta fold. BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure. Certain family members are similar to the tick anticoagulant peptide (TAP). This is a highly selective inhibitor of factor Xa in the blood coagulation pathways. TAP molecules are highly dipolar, and are arranged to form a twisted two- stranded antiparallel beta-sheet followed by an alpha helix. Length = 53
>gnl|CDD|238057 cd00109, KU, BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold Back     alignment and domain information
>gnl|CDD|197529 smart00131, KU, BPTI/Kunitz family of serine protease inhibitors Back     alignment and domain information
>gnl|CDD|226406 COG3889, COG3889, Predicted solute binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|226406 COG3889, COG3889, Predicted solute binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|237019 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>gnl|CDD|237019 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>gnl|CDD|237019 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) Back     alignment and domain information
>gnl|CDD|237019 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 456
cd0010954 KU BPTI/Kunitz family of serine protease inhibitor 99.43
smart0013153 KU BPTI/Kunitz family of serine protease inhibitor 99.42
PF0001453 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi 99.42
KOG4295|consensus 295 99.24
KOG4295|consensus 295 98.59
smart0013153 KU BPTI/Kunitz family of serine protease inhibitor 98.43
cd0010954 KU BPTI/Kunitz family of serine protease inhibitor 98.4
PF0001453 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi 98.35
KOG4597|consensus 560 98.05
KOG4597|consensus560 97.73
KOG3540|consensus 615 89.9
>cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold Back     alignment and domain information 
Probab=99.43  E-value=1.7e-13  Score=104.06  Aligned_cols=54  Identities=44%  Similarity=1.109  Sum_probs=51.6

Q ss_pred             CCCCCCCCCCCCCCCeeeEEEeccCCCCeeEEeeccccCCCCcccChHHHhcccC
Q psy10173        342 KACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCV  396 (456)
Q Consensus       342 ~~C~LP~d~G~C~~~~~RWYYD~~~tg~C~~F~YgGCgGN~NnF~T~eeC~~~C~  396 (456)
                      ++|.+|++.|.|....+||||| +.+++|+.|+|+||++|.|+|.|+++|++.|.
T Consensus         1 ~~C~~~~~~g~C~~~~~~~~yd-~~~~~C~~f~~~gc~~~~N~F~s~~~C~~~C~   54 (54)
T cd00109           1 DVCSLPPDTGPCKAYIPRYYYD-ATTKQCEPFTYGGCGGNANNFATKEECERTCG   54 (54)
T ss_pred             CcccCCCCCCCCCCCccEEEEe-CCCCccceeECCCccCCccCcCCHHHHHhhcc
Confidence            4799999999999999999999 99999999999999999999999999999985

BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure.
>smart00131 KU BPTI/Kunitz family of serine protease inhibitors Back     alignment and domain information
>PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus Back     alignment and domain information
>KOG4295|consensus Back     alignment and domain information
>KOG4295|consensus Back     alignment and domain information
>smart00131 KU BPTI/Kunitz family of serine protease inhibitors Back     alignment and domain information
>cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold Back     alignment and domain information
>PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>KOG3540|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
1kth_A58 The Anisotropic Refinement Of Kunitz Type Domain C5 1e-12
1bik_A147 X-Ray Structure Of Bikunin From The Human Inter-Alp 8e-10
1brc_I56 Relocating A Negative Charge In The Binding Pocket 1e-07
1zr0_B63 Crystal Structure Of Kunitz Domain 1 Of Tissue Fact 2e-07
1aap_A58 X-Ray Crystal Structure Of The Protease Inhibitor D 2e-07
2ddi_A70 Nmr Structure Of The Second Kunitz Domain Of Human 3e-07
1zjd_B57 Crystal Structure Of The Catalytic Domain Of Coagul 3e-07
1ca0_D54 Bovine Chymotrypsin Complexed To Appi Length = 54 5e-07
3d65_I57 Crystal Structure Of Textilinin-1, A Kunitz-Type Se 7e-07
3byb_A59 Crystal Structure Of Textilinin-1, A Kunitz-Type Se 7e-07
3l33_E52 Human Mesotrypsin Complexed With Amyloid Precursor 7e-07
3l3t_E57 Human Mesotrypsin Complexed With Amyloid Precursor 8e-07
1adz_A71 The Solution Structure Of The Second Kunitz Domain 1e-06
4dtg_K66 Hemostatic Effect Of A Monoclonal Antibody Mab 2021 2e-06
1tfx_C58 Complex Of The Second Kunitz Domain Of Tissue Facto 2e-06
2jot_A55 Nuclear Magnetic Resonance Studies On Huwentoxin-Xi 2e-06
2ody_E127 Thrombin-bound Boophilin Displays A Functional And 2e-05
1fak_I55 Human Tissue Factor Complexed With Coagulation Fact 5e-05
1uub_A56 Solution Structure Of A Truncated Bovine Pancreatic 6e-05
1dtk_A57 The Nmr Solution Structure Of Dendrotoxin K From Th 6e-05
1co7_I99 R117h Mutant Rat Anionic Trypsin Complexed With Bov 6e-05
1dtx_A59 Crystal Structure Of Alpha-Dendrotoxin From The Gre 9e-05
4tpi_I58 The Refined 2.2-angstroms (0.22-nm) X-ray Crystal S 1e-04
3p92_E58 Human Mesotrypsin Complexed With Bovine Pancreatic 2e-04
3p95_E58 Human Mesotrypsin Complexed With Bovine Pancreatic 2e-04
1ld5_A58 Structure Of Bpti Mutant A16v Length = 58 2e-04
1ejm_B58 Crystal Structure Of The Bpti Ala16leu Mutant In Co 2e-04
1bun_B61 Structure Of Beta2-Bungarotoxin: Potassium Channel 2e-04
1pit_A58 Determination Of A High-Quality Nuclear Magnetic Re 3e-04
1tpa_I58 The Geometry Of The Reactive Site And Of The Peptid 3e-04
1ykt_B56 TrypsinBPTI COMPLEX MUTANT Length = 56 3e-04
1uua_A56 Solution Structure Of A Truncated Bovine Pancreatic 3e-04
9pti_A58 Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized 3e-04
1t8l_B59 Crystal Structure Of The P1 Met Bpti Mutant- Bovine 4e-04
3btq_I58 The Crystal Structures Of The Complexes Between Bov 5e-04
1dem_A60 Proteinase Inhibitor Homologues As Potassium Channe 5e-04
3tgi_I65 Wild-Type Rat Anionic Trypsin Complexed With Bovine 5e-04
3bth_I58 The Crystal Structures Of The Complexes Between Bov 5e-04
1qlq_A58 Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant W 7e-04
3btm_I58 The Crystal Structures Of The Complexes Between Bov 7e-04
1jc6_A65 Solution Structure Of Bungarus Faciatus Ix, A Kunit 7e-04
3bte_I58 The Crystal Structures Of The Complexes Between Bov 7e-04
2kcr_A61 Solution Structure Of Anntoxin Length = 61 8e-04
1jv8_A58 Nmr Structure Of Bpti Mutant G37a Length = 58 8e-04
3btt_I58 The Crystal Structures Of The Complexes Between Bov 8e-04
1p2j_I58 Structural Consequences Of Accommodation Of Four No 9e-04
>pdb|1KTH|A Chain A, The Anisotropic Refinement Of Kunitz Type Domain C5 At 0.95 Angstrom Length = 58 Back     alignment and structure 
Iteration: 1

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 37/53 (69%), Gaps = 1/53 (1%)
Query: 344 CSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCV 396
           C LPKD G CRDF +KW+YD  +   C RFWYGGC GN N+F SQ+EC  VC 
Sbjct: 5   CKLPKDEGTCRDFILKWYYD-PNTKSCARFWYGGCGGNENKFGSQKECEKVCA 56
>pdb|1BIK|A Chain A, X-Ray Structure Of Bikunin From The Human Inter-Alpha-Inhibitor Complex Length = 147 Back     alignment and structure
>pdb|1BRC|I Chain I, Relocating A Negative Charge In The Binding Pocket Of Trypsin Length = 56 Back     alignment and structure
>pdb|1ZR0|B Chain B, Crystal Structure Of Kunitz Domain 1 Of Tissue Factor Pathway Inhibitor-2 With Bovine Trypsin Length = 63 Back     alignment and structure
>pdb|1AAP|A Chain A, X-Ray Crystal Structure Of The Protease Inhibitor Domain Of Alzheimer's Amyloid Beta-Protein Precursor Length = 58 Back     alignment and structure
>pdb|2DDI|A Chain A, Nmr Structure Of The Second Kunitz Domain Of Human Wfikkn1 Length = 70 Back     alignment and structure
>pdb|1ZJD|B Chain B, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 57 Back     alignment and structure
>pdb|1CA0|D Chain D, Bovine Chymotrypsin Complexed To Appi Length = 54 Back     alignment and structure
>pdb|3D65|I Chain I, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom, In Complex With Trypsin Length = 57 Back     alignment and structure
>pdb|3BYB|A Chain A, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom Length = 59 Back     alignment and structure
>pdb|3L33|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor(Appi) Length = 52 Back     alignment and structure
>pdb|3L3T|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor Variant (Appir15k) Length = 57 Back     alignment and structure
>pdb|1ADZ|A Chain A, The Solution Structure Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor, Nmr, 30 Structures Length = 71 Back     alignment and structure
>pdb|4DTG|K Chain K, Hemostatic Effect Of A Monoclonal Antibody Mab 2021 Blocking The Interaction Between Fxa And Tfpi In A Rabbit Hemophilia Model Length = 66 Back     alignment and structure
>pdb|1TFX|C Chain C, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 58 Back     alignment and structure
>pdb|2JOT|A Chain A, Nuclear Magnetic Resonance Studies On Huwentoxin-Xi From The Chinese Bird Spider Ornithoctonus Huwena Length = 55 Back     alignment and structure
>pdb|2ODY|E Chain E, Thrombin-bound Boophilin Displays A Functional And Accessible Reactive-site Loop Length = 127 Back     alignment and structure
>pdb|1FAK|I Chain I, Human Tissue Factor Complexed With Coagulation Factor Viia Inhibited With A Bpti-Mutant Length = 55 Back     alignment and structure
>pdb|1UUB|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor Mutant, 3-58 Bpti (K15r, R17a, R42s) Length = 56 Back     alignment and structure
>pdb|1DTK|A Chain A, The Nmr Solution Structure Of Dendrotoxin K From The Venom Of Dendroaspis Polylepis Polylepis Length = 57 Back     alignment and structure
>pdb|1CO7|I Chain I, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 99 Back     alignment and structure
>pdb|1DTX|A Chain A, Crystal Structure Of Alpha-Dendrotoxin From The Green Mamba Venom And Its Comparison With The Structure Of Bovine Pancreatic Trypsin Inhibitor Length = 59 Back     alignment and structure
>pdb|4TPI|I Chain I, The Refined 2.2-angstroms (0.22-nm) X-ray Crystal Structure Of The Ternary Complex Formed By Bovine Trypsinogen, Valine-valine And The Arg15 Analogue Of Bovine Pancreatic Trypsin Inhibitor Length = 58 Back     alignment and structure
>pdb|3P92|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17G) Length = 58 Back     alignment and structure
>pdb|3P95|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17D) Length = 58 Back     alignment and structure
>pdb|1LD5|A Chain A, Structure Of Bpti Mutant A16v Length = 58 Back     alignment and structure
>pdb|1EJM|B Chain B, Crystal Structure Of The Bpti Ala16leu Mutant In Complex With Bovine Trypsin Length = 58 Back     alignment and structure
>pdb|1BUN|B Chain B, Structure Of Beta2-Bungarotoxin: Potassium Channel Binding By Kunitz Modules And Targeted Phospholipase Action Length = 61 Back     alignment and structure
>pdb|1PIT|A Chain A, Determination Of A High-Quality Nuclear Magnetic Resonance Solution Structure Of The Bovine Pancreatic Trypsin Inhibitor And Comparison With Three Crystal Structures Length = 58 Back     alignment and structure
>pdb|1TPA|I Chain I, The Geometry Of The Reactive Site And Of The Peptide Groups In Trypsin, Trypsinogen And Its Complexes With Inhibitors Length = 58 Back     alignment and structure
>pdb|1YKT|B Chain B, TrypsinBPTI COMPLEX MUTANT Length = 56 Back     alignment and structure
>pdb|1UUA|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor, 3-58 Bpti Length = 56 Back     alignment and structure
>pdb|9PTI|A Chain A, Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized) Length = 58 Back     alignment and structure
>pdb|1T8L|B Chain B, Crystal Structure Of The P1 Met Bpti Mutant- Bovine Chymotrypsin Complex Length = 59 Back     alignment and structure
>pdb|3BTQ|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|1DEM|A Chain A, Proteinase Inhibitor Homologues As Potassium Channel Blockers Length = 60 Back     alignment and structure
>pdb|3TGI|I Chain I, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 65 Back     alignment and structure
>pdb|3BTH|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|1QLQ|A Chain A, Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant With Altered Binding Loop Sequence Length = 58 Back     alignment and structure
>pdb|3BTM|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|1JC6|A Chain A, Solution Structure Of Bungarus Faciatus Ix, A Kunitz-Type Chymotrypsin Inhibitor Length = 65 Back     alignment and structure
>pdb|3BTE|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta-Trypsin And Ten P1 Variants Of Bpti. Length = 58 Back     alignment and structure
>pdb|2KCR|A Chain A, Solution Structure Of Anntoxin Length = 61 Back     alignment and structure
>pdb|1JV8|A Chain A, Nmr Structure Of Bpti Mutant G37a Length = 58 Back     alignment and structure
>pdb|3BTT|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 Back     alignment and structure
>pdb|1P2J|I Chain I, Structural Consequences Of Accommodation Of Four Non- Cognate Amino-Acid Residues In The S1 Pocket Of Bovine Trypsin And Chymotrypsin Length = 58 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query456
1bun_B61 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 2e-24
4dtg_K66 Tissue factor pathway inhibitor; antibody, blood c 2e-24
1bf0_A60 Calcicludine; calcium channel blocker; NMR {Dendro 5e-24
2kcr_A61 Anntoxin; protein; NMR {Hyla annectans} Length = 6 7e-24
1jc6_A65 Venom basic protease inhibitors IX and VIIIB; snak 1e-23
1dtk_A57 Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro 1e-23
1dtx_A59 Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { 3e-23
3m7q_B61 Kunitz-type proteinase inhibitor SHPI-1; trypsin-i 4e-23
1adz_A71 TFPI, EPI, LACI, tissue factor pathway inhibitor; 4e-23
2ddi_A70 WAP, follistatin/kazal, immunoglobulin, kunitz and 5e-23
1kth_A58 Collagen alpha 3(VI) chain; anisotropic refinement 7e-23
1irh_A61 Tissue factor pathway inhibitor; non-protease inhi 9e-23
1yc0_I75 Kunitz-type protease inhibitor 1; hydrolase/inhibi 1e-22
1y62_A60 Conkunitzin-S1; alpha helix, beta sheet, 310 helix 1e-22
1aap_A58 Alzheimer'S disease amyloid A4 protein; proteinase 1e-22
1g6x_A58 Pancreatic trypsin inhibitor; serine protease inhi 1e-22
1zr0_B63 TFPI-2, tissue factor pathway inhibitor 2, PP5; se 2e-22
3byb_A59 Textilinin, textilinin-1; BPTI-like, beta hairpin, 3e-22
3aug_A65 BPTI, bovine pancreatic trypsin inhibitor; serine 3e-22
1co7_I99 BPTI, bovine pancreatic trypsin inhibitor; complex 5e-22
3aub_A58 BPTI, bovine pancreatic trypsin inhibitor; serine 1e-21
2jot_A55 Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc 2e-21
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 2e-20
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 2e-19
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 5e-20
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 6e-15
>1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Length = 61 Back     alignment and structure
 Score = 94.7 bits (236), Expect = 2e-24
 Identities = 22/57 (38%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 341 QKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVE 397
              C  P D   C+     ++Y       C +F YGGC GNGN FKS   CR  C+E
Sbjct: 4   HPDCDKPPDTKICQTVVRAFYYK-PSAKRCVQFRYGGCNGNGNHFKSDHLCRCECLE 59
>4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Length = 66 Back     alignment and structure
>1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Length = 60 Back     alignment and structure
>2kcr_A Anntoxin; protein; NMR {Hyla annectans} Length = 61 Back     alignment and structure
>1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Length = 65 Back     alignment and structure
>1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Length = 57 Back     alignment and structure
>1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Length = 59 Back     alignment and structure
>3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} PDB: 3ofw_A 1shp_A Length = 61 Back     alignment and structure
>1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 71 Back     alignment and structure
>2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Length = 70 Back     alignment and structure
>1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Length = 58 Back     alignment and structure
>1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 61 Back     alignment and structure
>1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Length = 75 Back     alignment and structure
>1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Length = 60 Back     alignment and structure
>1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Length = 58 Back     alignment and structure
>1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Length = 58 Back     alignment and structure
>1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Length = 63 Back     alignment and structure
>3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Length = 59 Back     alignment and structure
>3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Length = 65 Back     alignment and structure
>1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Length = 99 Back     alignment and structure
>3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Length = 58 Back     alignment and structure
>2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Length = 55 Back     alignment and structure
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 Back     alignment and structure
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 Back     alignment and structure
>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 Back     alignment and structure
>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query456
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 99.94
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 99.93
2ody_E127 Boophilin; kunitz-type thrombin inhibitor, blood c 99.88
1bik_A147 Bikunin; glycoprotein, trypstatin, urinary trypsin 99.86
1toc_R120 Ornithodorin; vitamin K, zymogen, gamma-carboxyglu 99.7
1toc_R120 Ornithodorin; vitamin K, zymogen, gamma-carboxyglu 99.67
3aub_A58 BPTI, bovine pancreatic trypsin inhibitor; serine 99.66
1dtk_A57 Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro 99.66
1y62_A60 Conkunitzin-S1; alpha helix, beta sheet, 310 helix 99.65
2ddi_A70 WAP, follistatin/kazal, immunoglobulin, kunitz and 99.65
1bun_B61 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 99.65
1kth_A58 Collagen alpha 3(VI) chain; anisotropic refinement 99.65
1g6x_A58 Pancreatic trypsin inhibitor; serine protease inhi 99.65
3aug_A65 BPTI, bovine pancreatic trypsin inhibitor; serine 99.65
1dtx_A59 Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { 99.65
3byb_A59 Textilinin, textilinin-1; BPTI-like, beta hairpin, 99.65
1irh_A61 Tissue factor pathway inhibitor; non-protease inhi 99.64
1bf0_A60 Calcicludine; calcium channel blocker; NMR {Dendro 99.64
4dtg_K66 Tissue factor pathway inhibitor; antibody, blood c 99.64
1aap_A58 Alzheimer'S disease amyloid A4 protein; proteinase 99.63
3m7q_B61 Kunitz-type proteinase inhibitor SHPI-1; trypsin-i 99.63
1jc6_A65 Venom basic protease inhibitors IX and VIIIB; snak 99.63
2kcr_A61 Anntoxin; protein; NMR {Hyla annectans} 99.63
1adz_A71 TFPI, EPI, LACI, tissue factor pathway inhibitor; 99.63
1zr0_B63 TFPI-2, tissue factor pathway inhibitor 2, PP5; se 99.62
1yc0_I75 Kunitz-type protease inhibitor 1; hydrolase/inhibi 99.59
2jot_A55 Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc 99.59
1co7_I99 BPTI, bovine pancreatic trypsin inhibitor; complex 99.55
2uuy_B52 Tryptase inhibitor; calcium, zymogen, protease, hy 99.39
1dtk_A57 Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro 99.0
3aub_A58 BPTI, bovine pancreatic trypsin inhibitor; serine 99.0
2ddi_A70 WAP, follistatin/kazal, immunoglobulin, kunitz and 98.99
1kth_A58 Collagen alpha 3(VI) chain; anisotropic refinement 98.99
1y62_A60 Conkunitzin-S1; alpha helix, beta sheet, 310 helix 98.98
1dtx_A59 Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { 98.97
3aug_A65 BPTI, bovine pancreatic trypsin inhibitor; serine 98.97
1g6x_A58 Pancreatic trypsin inhibitor; serine protease inhi 98.97
3byb_A59 Textilinin, textilinin-1; BPTI-like, beta hairpin, 98.97
1aap_A58 Alzheimer'S disease amyloid A4 protein; proteinase 98.96
1irh_A61 Tissue factor pathway inhibitor; non-protease inhi 98.96
2kcr_A61 Anntoxin; protein; NMR {Hyla annectans} 98.96
1bf0_A60 Calcicludine; calcium channel blocker; NMR {Dendro 98.96
4dtg_K66 Tissue factor pathway inhibitor; antibody, blood c 98.95
1bun_B61 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 98.93
1adz_A71 TFPI, EPI, LACI, tissue factor pathway inhibitor; 98.92
1jc6_A65 Venom basic protease inhibitors IX and VIIIB; snak 98.91
3m7q_B61 Kunitz-type proteinase inhibitor SHPI-1; trypsin-i 98.91
1zr0_B63 TFPI-2, tissue factor pathway inhibitor 2, PP5; se 98.89
1yc0_I75 Kunitz-type protease inhibitor 1; hydrolase/inhibi 98.87
2jot_A55 Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc 98.82
1co7_I99 BPTI, bovine pancreatic trypsin inhibitor; complex 98.77
2uuy_B52 Tryptase inhibitor; calcium, zymogen, protease, hy 98.22
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Back     alignment and structure
Probab=99.94  E-value=6.8e-27  Score=205.86  Aligned_cols=104  Identities=27%  Similarity=0.563  Sum_probs=96.0

Q ss_pred             CCCCCCCCCCCCCCCCCeeeEEEeccCCCCeeEEeeccccCCCCcccChHHHhcccCCCCC---------Ccccc---cc
Q psy10173        340 PQKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVEPSG---------KETST---IL  407 (456)
Q Consensus       340 ~~~~C~LP~d~G~C~~~~~RWYYD~~~tg~C~~F~YgGCgGN~NnF~T~eeC~~~C~~~~~---------k~~C~---~~  407 (456)
                      .+++|.||++.|.|++.++||||| ..+++|+.|+|+||+||.|||.|+++|+++|.....         +.+|.   +.
T Consensus         2 ~~~~C~~p~~~G~C~~~~~r~~yn-~~t~~C~~F~y~GC~gN~N~F~t~~~C~~~C~~~~~~~~~~~~~~~~~C~~p~~~   80 (127)
T 2ody_E            2 RNGFCRLPADEGICKALIPRFYFN-TETGKCTMFSYGGCGGNENNFETIEECQKACGAPERVNDFESADFKTGCEPAADS   80 (127)
T ss_dssp             CBGGGGSCCCCCSSCCCEEEEEEE-TTTTEEEEEEECSSCCCSSCBSSHHHHHHHHSSCCCCCCCCCCCHHHHTSSCCCC
T ss_pred             CCCcccCCCCCccCcCceeeEEEE-CCCCeeeEeecCCcCCCccccCcHHHHHHhccccccccccccCCcCCcCCCcCCC
Confidence            356899999999999999999999 999999999999999999999999999999997532         35798   78


Q ss_pred             ccCCCCCceEEecCCCCcccccccceEEEecCCCCCCCCCccc
Q psy10173        408 LTCDSIMNAVILDDLAVLVPKHLRDRIAVYITRNGNVRSNSKH  450 (456)
Q Consensus       408 G~C~~~~~RwYYD~tt~tC~~~~~C~~F~Y~GCgGN~Nrfsk~  450 (456)
                      |+|.+..+|||||+.+++|      ++|+|+||+||.|||..+
T Consensus        81 G~C~~~~~r~~yd~~~~~C------~~F~Y~GC~GN~N~F~t~  117 (127)
T 2ody_E           81 GSCAGQLERWFYNVQSGEC------ETFVYGGCGGNDNNYESE  117 (127)
T ss_dssp             CSSCCCEEEEEEETTTTEE------EEEEECSSCCCSCCBSSH
T ss_pred             CcccCcceeEEECCCCCce------eEEEECCcCCCCcCcCCH
Confidence            9999999999999999998      999999999999999754
>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Back     alignment and structure
>2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Back     alignment and structure
>1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Back     alignment and structure
>1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 Back     alignment and structure
>1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 Back     alignment and structure
>3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Back     alignment and structure
>1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Back     alignment and structure
>1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Back     alignment and structure
>2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Back     alignment and structure
>1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Back     alignment and structure
>1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Back     alignment and structure
>1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Back     alignment and structure
>3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Back     alignment and structure
>1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Back     alignment and structure
>3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Back     alignment and structure
>1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Back     alignment and structure
>4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Back     alignment and structure
>1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Back     alignment and structure
>3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B Back     alignment and structure
>1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Back     alignment and structure
>2kcr_A Anntoxin; protein; NMR {Hyla annectans} Back     alignment and structure
>1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Back     alignment and structure
>2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Back     alignment and structure
>1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Back     alignment and structure
>2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A Back     alignment and structure
>1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Back     alignment and structure
>3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Back     alignment and structure
>2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Back     alignment and structure
>1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Back     alignment and structure
>1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Back     alignment and structure
>1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Back     alignment and structure
>3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Back     alignment and structure
>1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Back     alignment and structure
>3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Back     alignment and structure
>1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Back     alignment and structure
>1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>2kcr_A Anntoxin; protein; NMR {Hyla annectans} Back     alignment and structure
>1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Back     alignment and structure
>4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Back     alignment and structure
>1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Back     alignment and structure
>1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Back     alignment and structure
>3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B Back     alignment and structure
>1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Back     alignment and structure
>1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Back     alignment and structure
>2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Back     alignment and structure
>1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Back     alignment and structure
>2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 456
d1bunb_61 g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain 2e-21
d1bika256 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibi 4e-21
d1dtxa_59 g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendr 6e-21
d1dtka_57 g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroasp 6e-21
d1bf0a_60 g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dend 6e-21
d1jc6a_65 g.8.1.1 (A:) Venom basic protease inhibitor IX (VI 7e-21
d1aapa_56 g.8.1.1 (A:) Alzheimer's amyloid B-protein precurs 2e-20
d1tfxc_58 g.8.1.1 (C:) Tissue factor pathway inhibitor {Huma 4e-20
d1irha_61 g.8.1.1 (A:) Tissue factor pathway inhibitor {Huma 5e-20
d1zr0b163 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor 8e-20
d1ktha_58 g.8.1.1 (A:) Collagen type VI (domain C5 from alph 9e-20
d1g6xa_58 g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {C 1e-19
d1shpa_55 g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stich 1e-19
d1bika154 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibit 2e-19
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Length = 61 Back     information, alignment and structure

class: Small proteins
fold: BPTI-like
superfamily: BPTI-like
family: Small Kunitz-type inhibitors & BPTI-like toxins
domain: beta2-bungarotoxin, neurotoxin chain
species: Many-banded krait (Bungarus multicinctus) [TaxId: 8616]

 Score = 85.3 bits (211), Expect = 2e-21
 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 344 CSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCVE 397
           C  P D   C+     ++Y       C +F YGGC GNGN FKS   CR  C+E
Sbjct: 7   CDKPPDTKICQTVVRAFYYK-PSAKRCVQFRYGGCNGNGNHFKSDHLCRCECLE 59
>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 59 Back     information, alignment and structure
>d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Length = 57 Back     information, alignment and structure
>d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 60 Back     information, alignment and structure
>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Length = 65 Back     information, alignment and structure
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Length = 58 Back     information, alignment and structure
>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Length = 55 Back     information, alignment and structure
>d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 54 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query456
d1aapa_56 Alzheimer's amyloid B-protein precursor, APPI {Hum 99.69
d1dtxa_59 alpha-Dendrotoxin {Green mamba (Dendroaspis angust 99.69
d1bika154 Bikunin from inter-alpha-inhibitor complex {Human 99.67
d1shpa_55 Trypsin inhibitor {Sea anemone (Stichodactyla heli 99.67
d1bika256 Bikunin from inter-alpha-inhibitor complex {Human 99.67
d1ktha_58 Collagen type VI (domain C5 from alpha 3 chain) {H 99.67
d1dtka_57 Dendrotoxin K {Black mamba (Dendroaspis polylepis 99.67
d1zr0b163 Tissue factor pathway inhibitor {Human (Homo sapie 99.65
d1bunb_61 beta2-bungarotoxin, neurotoxin chain {Many-banded 99.65
d1g6xa_58 Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru 99.65
d1irha_61 Tissue factor pathway inhibitor {Human (Homo sapie 99.64
d1tfxc_58 Tissue factor pathway inhibitor {Human (Homo sapie 99.64
d1bf0a_60 Calcicludine (cac) {Green mamba (Dendroaspis angus 99.64
d1jc6a_65 Venom basic protease inhibitor IX (VIIIb) {Banded 99.63
d1aapa_56 Alzheimer's amyloid B-protein precursor, APPI {Hum 99.09
d1ktha_58 Collagen type VI (domain C5 from alpha 3 chain) {H 99.05
d1dtxa_59 alpha-Dendrotoxin {Green mamba (Dendroaspis angust 99.04
d1shpa_55 Trypsin inhibitor {Sea anemone (Stichodactyla heli 99.03
d1bika154 Bikunin from inter-alpha-inhibitor complex {Human 99.03
d1bika256 Bikunin from inter-alpha-inhibitor complex {Human 99.02
d1dtka_57 Dendrotoxin K {Black mamba (Dendroaspis polylepis 99.01
d1zr0b163 Tissue factor pathway inhibitor {Human (Homo sapie 98.99
d1g6xa_58 Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru 98.97
d1irha_61 Tissue factor pathway inhibitor {Human (Homo sapie 98.97
d1bf0a_60 Calcicludine (cac) {Green mamba (Dendroaspis angus 98.93
d1bunb_61 beta2-bungarotoxin, neurotoxin chain {Many-banded 98.93
d1tfxc_58 Tissue factor pathway inhibitor {Human (Homo sapie 98.92
d1jc6a_65 Venom basic protease inhibitor IX (VIIIb) {Banded 98.87
d1tocr263 Ornithodorin {Soft tick (Ornithodoros moubata) [Ta 93.27
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: BPTI-like
superfamily: BPTI-like
family: Small Kunitz-type inhibitors & BPTI-like toxins
domain: Alzheimer's amyloid B-protein precursor, APPI
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.69  E-value=6.5e-18  Score=128.23  Aligned_cols=55  Identities=45%  Similarity=1.125  Sum_probs=53.1

Q ss_pred             CCCCCCCCCCCCCCCCeeeEEEeccCCCCeeEEeeccccCCCCcccChHHHhcccC
Q psy10173        341 QKACSLPKDNGPCRDFTVKWFYDGVDYGGCNRFWYGGCEGNGNRFKSQEECRAVCV  396 (456)
Q Consensus       341 ~~~C~LP~d~G~C~~~~~RWYYD~~~tg~C~~F~YgGCgGN~NnF~T~eeC~~~C~  396 (456)
                      +++|.||++.|+|...++||||| +.+++|++|+|+||+||.|||.|+++|++.|.
T Consensus         2 ~d~C~~p~~~G~C~~~~~rwyyd-~~~~~C~~F~y~GCgGN~NnF~t~~~C~~~CG   56 (56)
T d1aapa_           2 REVCSEQAETGPCRAMISRWYFD-VTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG   56 (56)
T ss_dssp             GGGGGBCCCCCSSSCCEEEEEEE-TTTTEEEEEEECSSSCCSCCBSSHHHHHHHHC
T ss_pred             CcccCCCCCCcCCCCceeEEEEE-CCCCcEeeeEcCCccCCccCcCCHHHHHHhhC
Confidence            57899999999999999999999 99999999999999999999999999999984
>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Back     information, alignment and structure
>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Back     information, alignment and structure
>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Back     information, alignment and structure
>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Back     information, alignment and structure
>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Back     information, alignment and structure
>d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Back     information, alignment and structure
>d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Back     information, alignment and structure
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Back     information, alignment and structure
>d1tocr2 g.8.1.2 (R:57-119) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]} Back     information, alignment and structure