Psyllid ID: psy10181

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MKGMKPDSILKTDYIPVEYADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSNLNVHSPASGFTPTFLQFLDAVHQLISL
cccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHcc
ccccccccccccccccccccHHHHccccccEEEEEEccHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHcHHHHcHHHHHHHHHHHcccccccHHHHcccccccccccccHHHHHHHHHHHHHHcc
mkgmkpdsilktdyipveyaDIRHTKAAFKKLMRAcipsrtnaepdqTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLaqlcldpyyrtlEGFRVLVEKEWIAFghrfshrsnlnvhspasgftptFLQFLDAVHQLISL
mkgmkpdsilktdyipveyADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSNLNVHSPASGFTPTFLQFLDAVHQLISL
MKGMKPDSILKTDYIPVEYADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSNLNVHSPASGFTPTFLQFLDAVHQLISL
********ILKTDYIPVEYADIRHTKAAFKKLMRACIPSRT*****QTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSNLNVHSPASGFTPTFLQFLDAVHQL***
********ILKTDYIPVEYAD*************ACIPSRTNAEPDQTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRS*********GFTPTFLQFLDAVHQLISL
MKGMKPDSILKTDYIPVEYADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSNLNVHSPASGFTPTFLQFLDAVHQLISL
**********KTDYIPVEYADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSNLNVHSPASGFTPTFLQFLDAVHQLISL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGMKPDSILKTDYIPVEYADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSNLNVHSPASGFTPTFLQFLDAVHQLISL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q6NTN5 1873 Myotubularin-related prot N/A N/A 0.797 0.084 0.461 3e-45
Q6ZPE2 1867 Myotubularin-related prot yes N/A 0.803 0.085 0.451 2e-43
O95248 1867 Myotubularin-related prot yes N/A 0.803 0.085 0.451 1e-42
Q86WG5 1849 Myotubularin-related prot no N/A 0.797 0.085 0.441 3e-42
Q91XS1 1190 Myotubularin-related prot no N/A 0.681 0.113 0.402 4e-23
Q9NYA4 1195 Myotubularin-related prot no N/A 0.676 0.112 0.414 4e-23
Q9Z2C9 660 Myotubularin-related prot no N/A 0.671 0.201 0.398 1e-22
Q9Z2C5 603 Myotubularin OS=Mus muscu no N/A 0.878 0.288 0.362 1e-22
Q6TEL0 632 Myotubularin-related prot no N/A 0.686 0.215 0.404 1e-22
Q5R6F6 660 Myotubularin-related prot no N/A 0.676 0.203 0.388 3e-22
>sp|Q6NTN5|MTMRD_XENLA Myotubularin-related protein 13 OS=Xenopus laevis GN=sbf2 PE=2 SV=1 Back     alignment and function desciption
 Score =  181 bits (459), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 119/195 (61%), Gaps = 37/195 (18%)

Query: 1    MKGMKPDSILKTDYIPVEYADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQ 60
            ++G K D  L  +++PVE+ DIR  K +FKKLMRAC+PS    + +              
Sbjct: 1354 LRGFKFDFALNCEFVPVEFGDIRQVKTSFKKLMRACVPSSNPTDSE-------------- 1399

Query: 61   QIQNIMQLSGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVM 120
                                  STFLK +  S+W  QI  I+QLS  + +L++  GSSVM
Sbjct: 1400 ----------------------STFLKAMGESEWFLQIHRIIQLSVIISELME-SGSSVM 1436

Query: 121  LCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSNLNVHSPASG 180
            +CLEDGWDIT Q+ SL Q+  DP+YRTLEGFR+L+EKEW++FGH+FS RSNL+  S  +G
Sbjct: 1437 ICLEDGWDITTQVVSLVQILGDPFYRTLEGFRMLIEKEWLSFGHKFSQRSNLSPSSQGTG 1496

Query: 181  FTPTFLQFLDAVHQL 195
            F P FLQFLD VHQ+
Sbjct: 1497 FVPIFLQFLDCVHQI 1511

Xenopus laevis (taxid: 8355)
>sp|Q6ZPE2|MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus GN=Sbf1 PE=1 SV=2 Back     alignment and function description
>sp|O95248|MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens GN=SBF1 PE=1 SV=3 Back     alignment and function description
>sp|Q86WG5|MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens GN=SBF2 PE=1 SV=1 Back     alignment and function description
>sp|Q91XS1|MTMR4_MOUSE Myotubularin-related protein 4 OS=Mus musculus GN=Mtmr4 PE=1 SV=1 Back     alignment and function description
>sp|Q9NYA4|MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens GN=MTMR4 PE=2 SV=2 Back     alignment and function description
>sp|Q9Z2C9|MTMR7_MOUSE Myotubularin-related protein 7 OS=Mus musculus GN=Mtmr7 PE=2 SV=2 Back     alignment and function description
>sp|Q9Z2C5|MTM1_MOUSE Myotubularin OS=Mus musculus GN=Mtm1 PE=1 SV=2 Back     alignment and function description
>sp|Q6TEL0|MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio GN=mtmr8 PE=2 SV=1 Back     alignment and function description
>sp|Q5R6F6|MTMR7_PONAB Myotubularin-related protein 7 OS=Pongo abelii GN=MTMR7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
328714925 2052 PREDICTED: myotubularin-related protein 0.803 0.077 0.641 9e-68
91080183 1982 PREDICTED: similar to AGAP003366-PA isof 0.803 0.080 0.641 1e-64
270005687 2031 hypothetical protein TcasGA2_TC007785 [T 0.803 0.078 0.641 1e-64
242003313 1980 SET-binding factor, putative [Pediculus 0.797 0.079 0.597 2e-61
443733785 1913 hypothetical protein CAPTEDRAFT_211961 [ 0.818 0.084 0.548 2e-55
241998812 2064 conserved hypothetical protein [Ixodes s 0.808 0.077 0.545 2e-55
328780506 2045 PREDICTED: myotubularin-related protein 0.803 0.077 0.579 3e-55
380014708 2046 PREDICTED: myotubularin-related protein 0.803 0.077 0.574 1e-54
340710336 2044 PREDICTED: myotubularin-related protein 0.803 0.077 0.574 1e-54
350415868 2044 PREDICTED: myotubularin-related protein 0.803 0.077 0.574 1e-54
>gi|328714925|ref|XP_003245494.1| PREDICTED: myotubularin-related protein 13-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  261 bits (668), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 144/195 (73%), Gaps = 36/195 (18%)

Query: 1    MKGMKPDSILKTDYIPVEYADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQ 60
            MKGMK DSI+K D+IP+EYADIRH+K +FKKLMRAC+PS T+ EP+ +F K I       
Sbjct: 1415 MKGMKGDSIMKIDFIPIEYADIRHSKTSFKKLMRACVPSSTSNEPEHSFYKMI------- 1467

Query: 61   QIQNIMQLSGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVM 120
                                         ESS WLQQ++NIMQLSGA+VDL+DVQGSSVM
Sbjct: 1468 -----------------------------ESSDWLQQLRNIMQLSGAIVDLIDVQGSSVM 1498

Query: 121  LCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSNLNVHSPASG 180
            LCLE+GWDITCQLSS+AQLC+DPYYRT+EGFRVLVEKEW+AFGHRFSHRSNL   S ASG
Sbjct: 1499 LCLEEGWDITCQLSSIAQLCMDPYYRTIEGFRVLVEKEWLAFGHRFSHRSNLATASQASG 1558

Query: 181  FTPTFLQFLDAVHQL 195
            F PTFLQFLD VHQ+
Sbjct: 1559 FAPTFLQFLDIVHQI 1573

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91080183|ref|XP_966320.1| PREDICTED: similar to AGAP003366-PA isoform 1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270005687|gb|EFA02135.1| hypothetical protein TcasGA2_TC007785 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242003313|ref|XP_002422691.1| SET-binding factor, putative [Pediculus humanus corporis] gi|212505513|gb|EEB09953.1| SET-binding factor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|443733785|gb|ELU18006.1| hypothetical protein CAPTEDRAFT_211961 [Capitella teleta] Back     alignment and taxonomy information
>gi|241998812|ref|XP_002434049.1| conserved hypothetical protein [Ixodes scapularis] gi|215495808|gb|EEC05449.1| conserved hypothetical protein [Ixodes scapularis] Back     alignment and taxonomy information
>gi|328780506|ref|XP_394363.4| PREDICTED: myotubularin-related protein 13 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380014708|ref|XP_003691362.1| PREDICTED: myotubularin-related protein 13-like [Apis florea] Back     alignment and taxonomy information
>gi|340710336|ref|XP_003393748.1| PREDICTED: myotubularin-related protein 5-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350415868|ref|XP_003490773.1| PREDICTED: myotubularin-related protein 5-like isoform 1 [Bombus impatiens] gi|350415871|ref|XP_003490774.1| PREDICTED: myotubularin-related protein 5-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
FB|FBgn0025802 1993 Sbf "SET domain binding factor 0.565 0.056 0.719 1.8e-38
UNIPROTKB|E1C7M2 1844 SBF2 "Uncharacterized protein" 0.565 0.060 0.619 2e-33
RGD|1559442 1087 RGD1559442 "similar to SET bin 0.560 0.102 0.607 4.9e-33
RGD|13070901573 Sbf1 "SET binding factor 1" [R 0.565 0.071 0.619 5.5e-33
UNIPROTKB|F1NE84 1793 F1NE84 "Uncharacterized protei 0.555 0.061 0.630 6.6e-33
UNIPROTKB|G5E5Q8 1840 Bt.76501 "Uncharacterized prot 0.565 0.060 0.619 6.9e-33
MGI|MGI:1925230 1867 Sbf1 "SET binding factor 1" [M 0.565 0.059 0.619 7e-33
RGD|1588657 1826 Sbf2 "SET binding factor 2" [R 0.560 0.060 0.607 1.1e-32
UNIPROTKB|F1ML65 829 SBF2 "Uncharacterized protein" 0.560 0.133 0.589 1.2e-32
UNIPROTKB|F1PZ30 1849 SBF2 "Uncharacterized protein" 0.560 0.060 0.598 1.4e-32
FB|FBgn0025802 Sbf "SET domain binding factor" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 427 (155.4 bits), Expect = 1.8e-38, P = 1.8e-38
 Identities = 82/114 (71%), Positives = 96/114 (84%)

Query:    84 TFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDP 143
             +F K +E S WLQQI ++MQLSGAVVDL+D+Q SSVML LEDG D+T QLSS+AQLCLDP
Sbjct:  1415 SFAKMVEQSDWLQQISSLMQLSGAVVDLIDLQESSVMLSLEDGSDVTAQLSSIAQLCLDP 1474

Query:   144 YYRTLEGFRVLVEKEWIAFGHRFSHRSNLNV-HSPAS-GFTPTFLQFLDAVHQL 195
             YYR+L+GFRVLVEKEW+AFGHRF+HRSNL   H+  +  F PTFLQFLD VHQL
Sbjct:  1475 YYRSLDGFRVLVEKEWLAFGHRFAHRSNLKPSHANTNIAFAPTFLQFLDVVHQL 1528
GO:0019992 "diacylglycerol binding" evidence=ISS
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=ISS
GO:0016311 "dephosphorylation" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0000278 "mitotic cell cycle" evidence=IMP
GO:0032968 "positive regulation of transcription elongation from RNA polymerase II promoter" evidence=IDA;IMP
GO:0005634 "nucleus" evidence=IDA
GO:0003682 "chromatin binding" evidence=IDA
GO:0008023 "transcription elongation factor complex" evidence=IPI
GO:0036313 "phosphatidylinositol 3-kinase catalytic subunit binding" evidence=IPI
GO:0030866 "cortical actin cytoskeleton organization" evidence=IMP
GO:0032456 "endocytic recycling" evidence=IMP
GO:0005938 "cell cortex" evidence=IDA
GO:0017137 "Rab GTPase binding" evidence=IPI
GO:0055037 "recycling endosome" evidence=IDA
GO:0030674 "protein binding, bridging" evidence=IPI
GO:0017112 "Rab guanyl-nucleotide exchange factor activity" evidence=ISS;IPI
GO:0019902 "phosphatase binding" evidence=IPI
UNIPROTKB|E1C7M2 SBF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1559442 RGD1559442 "similar to SET binding factor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1307090 Sbf1 "SET binding factor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NE84 F1NE84 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G5E5Q8 Bt.76501 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1925230 Sbf1 "SET binding factor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1588657 Sbf2 "SET binding factor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1ML65 SBF2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PZ30 SBF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
pfam1384955 pfam13849, Y_phosphatase_m, Myotubularin Y_phospha 2e-32
>gnl|CDD|206020 pfam13849, Y_phosphatase_m, Myotubularin Y_phosphatase-like Back     alignment and domain information 
 Score =  111 bits (279), Expect = 2e-32
 Identities = 38/55 (69%), Positives = 45/55 (81%)

Query: 117 SSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSN 171
           SSV++   DGWD T QLSSLAQL LDPYYRT+EGF+VL+EKEW++FGH FS R  
Sbjct: 1   SSVLVHCSDGWDRTSQLSSLAQLLLDPYYRTIEGFQVLIEKEWLSFGHPFSDRCG 55

This short region is highly conserved and seems to be common to many myotubularin proteins with protein tyrosine pyrophosphate activity. As the family has a number of highly conserved residues such as histidine, cysteine, glutamine and aspartate, it is possible that this represents a catalytic core of the active enzymatic part of the proteins. Length = 55

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
KOG4471|consensus 717 100.0
KOG1089|consensus 573 100.0
PF06602353 Myotub-related: Myotubularin-like phosphatase doma 100.0
KOG1090|consensus 1732 100.0
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 96.67
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 96.67
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 96.26
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 95.75
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 95.63
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 95.12
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 94.61
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 94.04
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 92.09
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 91.26
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 91.26
PTZ00242166 protein tyrosine phosphatase; Provisional 90.75
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 88.95
PTZ00393241 protein tyrosine phosphatase; Provisional 88.88
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 88.78
PHA02740298 protein tyrosine phosphatase; Provisional 87.48
PHA02742303 protein tyrosine phosphatase; Provisional 86.96
PHA02746323 protein tyrosine phosphatase; Provisional 86.78
PHA02738320 hypothetical protein; Provisional 86.0
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 85.26
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 84.98
PHA02747312 protein tyrosine phosphatase; Provisional 84.68
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 82.82
PRK12361 547 hypothetical protein; Provisional 81.97
>KOG4471|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.6e-65  Score=481.65  Aligned_cols=156  Identities=39%  Similarity=0.748  Sum_probs=144.0

Q ss_pred             CCCCCCC-CCCceeEeeccCChHHHHHHHHHHHHHhcCCCCCCCchhHHHhhhhhhhHHHHHHHHHHHhHhHHhhhccch
Q psy10181          2 KGMKPDS-ILKTDYIPVEYADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPK   80 (198)
Q Consensus         2 kg~~~~~-~~~~~~~~l~i~nih~~r~S~~kL~~~c~~~~~~~~~~~~~l~~le~s~Wl~~i~~~~~~~~~~~~~~~~~~   80 (198)
                      .|+|.++ |||||++|+||+|||+||+||.|+.+.|.|..             +.+.|++                    
T Consensus       299 GG~Es~~~Y~naEi~Fl~i~NIH~mR~s~~~~k~~~~~~~-------------d~s~wlS--------------------  345 (717)
T KOG4471|consen  299 GGYESEEAYPNAEIVFLGIHNIHVMRESLRKLKEICYPSP-------------DESNWLS--------------------  345 (717)
T ss_pred             CCccChhccccceEEEeecchhHHHHHHHHhHHHhhcCCC-------------CchhHHH--------------------
Confidence            4788877 69999999999999999999999999998752             3444555                    


Q ss_pred             hhhHHHHhhhhccHHHHHHHHHHHHHHHHHHhhhCCceEEEecCCccchhhhhHHHHHHhhcccchhHHHHHHHHHHHhh
Q psy10181         81 RLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWI  160 (198)
Q Consensus        81 ~~~~~l~~le~s~Wl~~v~~~L~~a~~va~~l~~~~~sVlvhcsdGwDrT~qlsSLaqLlLDPyyRTi~GF~~LIeKEWi  160 (198)
                             .||+|+||+||+.+|.+|..||+.++.+++|||||||||||||+|++||||||||||||||+|||+||||||+
T Consensus       346 -------~Le~T~WL~Hi~~lLaga~~Ia~kVe~~~~sVlVHCSDGWDRT~QlvsLA~LlLDpYYRTieGFqvLVEkeWL  418 (717)
T KOG4471|consen  346 -------ALESTHWLEHISSLLAGAVRIADKVESESRSVLVHCSDGWDRTAQLVSLAMLLLDPYYRTIEGFQVLVEKEWL  418 (717)
T ss_pred             -------hhccchHHHHHHHHHHHHHHHHHHHhcCCceEEEEcCCCccchHHHHHHHHHHhchhhhhhhhhHHHHHHHHH
Confidence                   7778888889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcccccccccCCCCCCC-CCCCChHHHHHHHHHHHHHc
Q psy10181        161 AFGHRFSHRSNLNVHSP-ASGFTPTFLQFLDAVHQLIS  197 (198)
Q Consensus       161 ~fGH~F~~R~~~~~~~~-~~~~sPiFlqFLDcV~Ql~~  197 (198)
                      +|||||++|+||+..+. +.++||||||||||||||++
T Consensus       419 sFGHkFadRvGhg~ns~~~ndrsPVFLQwlDcV~Ql~r  456 (717)
T KOG4471|consen  419 SFGHKFADRVGHGNNSHGDNDRSPVFLQWLDCVWQLMR  456 (717)
T ss_pred             hcCChhhhhcCCCCCcccccccCchhHHHHHHHHHHHH
Confidence            99999999999998764 48899999999999999986

>KOG1089|consensus Back     alignment and domain information
>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO Back     alignment and domain information
>KOG1090|consensus Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1lw3_A 657 Crystal Structure Of Myotubularin-Related Protein 2 3e-22
1zsq_A 528 Crystal Structure Of Mtmr2 In Complex With Phosphat 3e-22
2yf0_A 512 Human Myotubularin Related Protein 6 (Mtmr6) Length 2e-21
>pdb|1LW3|A Chain A, Crystal Structure Of Myotubularin-Related Protein 2 Complexed With Phosphate Length = 657 Back     alignment and structure 
Iteration: 1

 Score =  101 bits (252), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 77/123 (62%), Gaps = 1/123 (0%)
Query: 74  DLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQL 133
           +++Y     + +L  +ES+ WL+ I+ I+  +  + D ++   +SV++   DGWD T QL
Sbjct: 371 EIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHSSDGWDRTAQL 430
Query: 134 SSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSNLNVHSPASG-FTPTFLQFLDAV 192
           +SLA L LD YYRT+ GF VLVEKEW++FGHRF  R      + A    +P FLQF+D V
Sbjct: 431 TSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCV 490
Query: 193 HQL 195
            Q+
Sbjct: 491 WQM 493
>pdb|1ZSQ|A Chain A, Crystal Structure Of Mtmr2 In Complex With Phosphatidylinositol 3-Phosphate Length = 528 Back     alignment and structure
>pdb|2YF0|A Chain A, Human Myotubularin Related Protein 6 (Mtmr6) Length = 512 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1zsq_A 528 Myotubularin-related protein 2; protein-phospholip 9e-41
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 3e-39
2yf0_A 512 Myotubularin-related protein 6; hydrolase; 2.65A { 1e-34
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Length = 528 Back     alignment and structure
 Score =  143 bits (362), Expect = 9e-41
 Identities = 61/189 (32%), Positives = 93/189 (49%), Gaps = 11/189 (5%)

Query: 19  YADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQQ----------IQNIMQL 68
              I  + A   K+         NA  ++      ES    Q           I  + + 
Sbjct: 234 LQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMRES 293

Query: 69  SGAVVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWD 128
              + +++Y     + +L  +ES+ WL+ I+ I+  +  + D ++   +SV++   DGWD
Sbjct: 294 LRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHSSDGWD 353

Query: 129 ITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSNLNVHSPASG-FTPTFLQ 187
            T QL+SLA L LD YYRT+ GF VLVEKEW++FGHRF  R      + A    +P FLQ
Sbjct: 354 RTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQ 413

Query: 188 FLDAVHQLI 196
           F+D V Q+ 
Sbjct: 414 FIDCVWQMT 422
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Length = 657 Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Length = 512 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
2yf0_A 512 Myotubularin-related protein 6; hydrolase; 2.65A { 100.0
1zsq_A 528 Myotubularin-related protein 2; protein-phospholip 100.0
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 100.0
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 96.18
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 96.09
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 95.76
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 95.71
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 95.56
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 95.27
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 95.11
1xri_A151 AT1G05000; structural genomics, protein structure 95.1
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 94.86
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 94.69
2hxp_A155 Dual specificity protein phosphatase 9; human phos 94.67
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 94.65
2q05_A195 Late protein H1, dual specificity protein phosphat 94.63
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 94.59
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 94.59
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 94.55
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 94.54
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 94.52
2hcm_A164 Dual specificity protein phosphatase; structural g 94.34
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 94.3
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 94.17
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 94.06
3cm3_A176 Late protein H1, dual specificity protein phosphat 94.03
2oud_A177 Dual specificity protein phosphatase 10; A central 93.87
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 93.49
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 93.39
3emu_A161 Leucine rich repeat and phosphatase domain contain 93.38
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 93.19
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 93.07
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 92.99
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 92.87
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 92.83
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 92.81
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 92.34
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 91.99
2f46_A156 Hypothetical protein; structural genomics, joint c 91.87
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 91.56
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 91.44
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 91.42
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 91.37
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 91.34
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 91.01
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 90.96
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 90.96
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 90.77
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 90.76
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 90.48
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 90.26
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 90.19
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 90.01
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 89.99
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 89.81
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 89.79
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 89.5
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 89.5
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 89.26
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 89.21
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 89.15
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 88.86
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 88.81
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 88.81
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 88.57
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 88.45
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 88.44
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 88.37
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 88.03
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 87.14
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 86.89
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 86.42
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 84.8
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 83.05
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 82.97
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 82.62
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 81.89
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 81.55
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 81.18
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 80.41
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.1e-64  Score=476.01  Aligned_cols=156  Identities=33%  Similarity=0.606  Sum_probs=141.5

Q ss_pred             CCCCCCC-CCCceeEeeccCChHHHHHHHHHHHHHhcCCCCCCCchhHHHhhhhhhhHHHHHHHHHHHhHhHHhhhccch
Q psy10181          2 KGMKPDS-ILKTDYIPVEYADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPK   80 (198)
Q Consensus         2 kg~~~~~-~~~~~~~~l~i~nih~~r~S~~kL~~~c~~~~~~~~~~~~~l~~le~s~Wl~~i~~~~~~~~~~~~~~~~~~   80 (198)
                      ||+|++. |+||+++|+||+|||+||+||+||+++|.+.+++   +.+         |+                     
T Consensus       253 ~G~E~~~~Y~~~~~~f~~i~nIh~~r~S~~kL~~~~~~~~~~---~~~---------~l---------------------  299 (512)
T 2yf0_A          253 KGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGTKGLS---VND---------FY---------------------  299 (512)
T ss_dssp             CSCCCTTTSTTEEEEECCCCCHHHHHHHHHHHHHHHSCCSCC---HHH---------HH---------------------
T ss_pred             CCcccccccCCceeEecChhhHHHHHHHHHHHHHHhcCCCCC---HHH---------HH---------------------
Confidence            7999988 6999999999999999999999999999865432   223         33                     


Q ss_pred             hhhHHHHhhhhccHHHHHHHHHHHHHHHHHHhhhCCceEEEecCCccchhhhhHHHHHHhhcccchhHHHHHHHHHHHhh
Q psy10181         81 RLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWI  160 (198)
Q Consensus        81 ~~~~~l~~le~s~Wl~~v~~~L~~a~~va~~l~~~~~sVlvhcsdGwDrT~qlsSLaqLlLDPyyRTi~GF~~LIeKEWi  160 (198)
                            +.||+|+||+||+.+|++|..||++++.+|.|||||||||||||+|+|||||||||||||||+||++||||||+
T Consensus       300 ------s~Le~s~WL~~i~~iL~~a~~ia~~v~~~g~sVLVhcsDGwDrT~ql~SLaqllLDPyyRTi~GF~~LIEKEWl  373 (512)
T 2yf0_A          300 ------SGLESSGWLRHIKAVMDAAVFLAKAITVENASVLVHCSDGWDRTSQVCSLGSLLLDSYYRTIKGFMVLIEKDWI  373 (512)
T ss_dssp             ------HHHHHTTHHHHHHHHHHHHHHHHHHHHTTCCCEEECTTTSSSHHHHHHHHHHHHHCSGGGSHHHHHHHHHHHTT
T ss_pred             ------HHHHhCccHHHHHHHHHHHHHHHHHHHhCCCeEEEECCCCccccHHHHHHHHHHhCccccHHHHHHHHHhhHHh
Confidence                  36667777779999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcccccccccCCCCCCCCCCCChHHHHHHHHHHHHHc
Q psy10181        161 AFGHRFSHRSNLNVHSPASGFTPTFLQFLDAVHQLIS  197 (198)
Q Consensus       161 ~fGH~F~~R~~~~~~~~~~~~sPiFlqFLDcV~Ql~~  197 (198)
                      +|||||.+||||.... .+|+||||+|||||||||++
T Consensus       374 sfGH~F~~R~gh~~~~-~~e~SPvFlqFLDcV~Ql~~  409 (512)
T 2yf0_A          374 SFGHKFSERCGQLDGD-PKEVSPVFTQFLECVWHLTE  409 (512)
T ss_dssp             TTTCCHHHHHTSSSCC-GGGCCCHHHHHHHHHHHHHH
T ss_pred             hcCCchhhhcCCCCCC-cCCCCCchHHHHHHHHHHHh
Confidence            9999999999998643 48899999999999999985
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d1zsqa2387 c.45.1.3 (A:199-585) Myotubularin-related protein 6e-48
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 387 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Myotubularin-like phosphatases
domain: Myotubularin-related protein 2, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  158 bits (402), Expect = 6e-48
 Identities = 51/126 (40%), Positives = 79/126 (62%), Gaps = 1/126 (0%)

Query: 72  VVDLLYLPKRLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITC 131
           + +++Y     + +L  +ES+ WL+ I+ I+  +  + D ++   +SV++   DGWD T 
Sbjct: 168 LKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHSSDGWDRTA 227

Query: 132 QLSSLAQLCLDPYYRTLEGFRVLVEKEWIAFGHRFSHRSN-LNVHSPASGFTPTFLQFLD 190
           QL+SLA L LD YYRT+ GF VLVEKEW++FGHRF  R    + +   +  +P FLQF+D
Sbjct: 228 QLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFID 287

Query: 191 AVHQLI 196
            V Q+ 
Sbjct: 288 CVWQMT 293

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1zsqa2387 Myotubularin-related protein 2, C-terminal domain 100.0
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 95.93
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 95.51
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 94.08
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 93.94
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 93.85
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 93.84
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 93.23
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 93.17
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 92.73
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 92.59
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 92.38
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 92.24
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 91.69
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 91.33
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 91.28
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 91.04
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 90.75
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 90.59
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 90.51
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 90.12
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 89.81
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 89.59
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 89.41
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 84.66
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Myotubularin-like phosphatases
domain: Myotubularin-related protein 2, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9.2e-61  Score=434.49  Aligned_cols=156  Identities=35%  Similarity=0.653  Sum_probs=140.3

Q ss_pred             CCCCCCC-CCCceeEeeccCChHHHHHHHHHHHHHhcCCCCCCCchhHHHhhhhhhhHHHHHHHHHHHhHhHHhhhccch
Q psy10181          2 KGMKPDS-ILKTDYIPVEYADIRHTKAAFKKLMRACIPSRTNAEPDQTFLKQIESSQWLQQIQNIMQLSGAVVDLLYLPK   80 (198)
Q Consensus         2 kg~~~~~-~~~~~~~~l~i~nih~~r~S~~kL~~~c~~~~~~~~~~~~~l~~le~s~Wl~~i~~~~~~~~~~~~~~~~~~   80 (198)
                      +|+|+.. |++|+++|++|+|||+||+||.||+++|.+..    ++..|++                             
T Consensus       137 gG~E~~~~Y~~~~~~f~~i~nih~vr~s~~kl~~~~~~~~----~~~~~~s-----------------------------  183 (387)
T d1zsqa2         137 GGYESEDAYQNAELVFLDIHNIHVMRESLRKLKEIVYPNI----EETHWLS-----------------------------  183 (387)
T ss_dssp             CCCCCTTTCTTEEEEECCCCCHHHHHHHHHHHHHHHSSCC----CGGGHHH-----------------------------
T ss_pred             CCccchhcccCceeeeecccchHHHHHHHHHHHHHhcCCC----chhhHHh-----------------------------
Confidence            7999988 69999999999999999999999999998642    1233333                             


Q ss_pred             hhhHHHHhhhhccHHHHHHHHHHHHHHHHHHhhhCCceEEEecCCccchhhhhHHHHHHhhcccchhHHHHHHHHHHHhh
Q psy10181         81 RLSTFLKQIESSQWLQQIQNIMQLSGAVVDLLDVQGSSVMLCLEDGWDITCQLSSLAQLCLDPYYRTLEGFRVLVEKEWI  160 (198)
Q Consensus        81 ~~~~~l~~le~s~Wl~~v~~~L~~a~~va~~l~~~~~sVlvhcsdGwDrT~qlsSLaqLlLDPyyRTi~GF~~LIeKEWi  160 (198)
                             .||+|+||+||+.+|++|..||++|+.++++|||||+||||||+|||||||||||||||||+||++||||||+
T Consensus       184 -------~le~s~WL~~i~~~L~~A~~ia~~l~~~~~sVlVh~sdGwD~T~qvsSL~ql~lDpyyRTi~GF~~LIekewi  256 (387)
T d1zsqa2         184 -------NLESTHWLEHIKLILAGALRIADKVESGKTSVVVHSSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWL  256 (387)
T ss_dssp             -------HHHHHCHHHHHHHHHHHHHHHHHHHHTTCCCEEEECSSSSSHHHHHHHHHHHHHCGGGGSHHHHHHHHHHHTT
T ss_pred             -------hccccchHHHHHHHHHHHHHHHHHHHhCCCeEEEeCCCCCchhHHHHHHHHHHhCcccccHHHHHHHHHHHHH
Confidence                   5666666669999999999999999988899999999999999999999999999999999999999999999


Q ss_pred             hcccccccccCCCCCC-CCCCCChHHHHHHHHHHHHHc
Q psy10181        161 AFGHRFSHRSNLNVHS-PASGFTPTFLQFLDAVHQLIS  197 (198)
Q Consensus       161 ~fGH~F~~R~~~~~~~-~~~~~sPiFlqFLDcV~Ql~~  197 (198)
                      +|||||.+|+||...+ .+++.||||+|||||||||++
T Consensus       257 ~~Gh~F~~R~~h~~~~~~~~e~sPvFl~FLDcV~ql~~  294 (387)
T d1zsqa2         257 SFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQMTR  294 (387)
T ss_dssp             TTTCCHHHHHTTTCCCTTCTTCCCHHHHHHHHHHHHHH
T ss_pred             hcCCchhhhhcCCCCCcccCCCCCchHHHHHHHHHHHH
Confidence            9999999999998654 457899999999999999985
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure