Psyllid ID: psy10226

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MSCEKVNGGDSEWEYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTLLGEKNLENVTHEEAVATLKATHERVNLLIGKFEPALRNSTNHLAHPSDIPSSPNPSLTKEPMPPPPQALETSVHSLHSSTTALHPMPPLPHPENGIVKENGNVTCTDSGQ
cccccccccccccEEEEEEEEEccccccEEEEcccccccccccccEEEEEEccccccccccccccccEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccHccccccccccEEEEEEEcccccEEEEEcccccccccccccEEEEEEcccccccccccEccccEEEEEcccccccccHHHHHHHHHHcccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEccccEEEccccc
mscekvnggdsewEYEEIRLErggaglgfsiaggtdnphigddtsiyitklipggaaasdgrlqvNDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTLlgeknlenvtHEEAVATLKATHERVNLLIGkfepalrnstnhlahpsdipsspnpsltkepmppppqaletsvhslhssttalhpmpplphpengivkengnvtctdsgq
mscekvnggdseWEYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTLLGEKNLENVTHEEAVATLKATHERVNLLIGKFEPALRNSTNHLAHPSDIPSSPNPSLTKEPMPPPPQALETSVHSLHSSTTALHPMPPLPhpengivkengnvtctdsgq
MSCEKVNGGDSEWEYEEIRLERggaglgfsiaggTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTLLGEKNLENVTHEEAVATLKATHERVNLLIGKFEPALRNSTNHLAHPSDIPSSPNPSLTKEPMPPPPQALETSVHSLHSSTTALHPMPPLPHPENGIVKENGNVTCTDSGQ
************WEYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTLLGEKNLENVTHEEAVATLKATHERVNLLIGKFEP****************************************************************************
*************EYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTLLGEKN*********************************************************************************************************
***********EWEYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTLLGEKNLENVTHEEAVATLKATHERVNLLIGKFEPALRNSTNHL**************************************ALHPMPPLPHPENGIVKENGNVTCTDSGQ
*SC**VNGGDSEWEYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTLLGEKNLENVTHE*****************************************************PQALETSVHSLHSSTTALHPMPPLPHPENGIVKENGNVTCT****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCEKVNGGDSEWEYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTLLGEKNLENVTHEEAVATLKATHERVNLLIGKFEPALRNSTNHLAHPSDIPSSPNPSLTKEPMPPPPQALETSVHSLHSSTTALHPMPPLPHPENGIVKENGNVTCTDSGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query208 2.2.26 [Sep-21-2011]
Q12959 904 Disks large homolog 1 OS= yes N/A 0.432 0.099 0.693 1e-33
Q28C55 927 Disks large homolog 1 OS= yes N/A 0.423 0.094 0.734 1e-33
Q811D0 905 Disks large homolog 1 OS= no N/A 0.432 0.099 0.683 4e-33
Q62696 911 Disks large homolog 1 OS= yes N/A 0.432 0.098 0.683 5e-33
Q5PYH5 827 Discs large homolog 1-lik yes N/A 0.423 0.106 0.723 6e-33
Q5PYH6 873 Disks large homolog 1 OS= no N/A 0.413 0.098 0.712 2e-32
P78352 724 Disks large homolog 4 OS= no N/A 0.427 0.122 0.726 3e-32
P31016 724 Disks large homolog 4 OS= no N/A 0.427 0.122 0.726 3e-32
Q62108 724 Disks large homolog 4 OS= no N/A 0.427 0.122 0.726 3e-32
Q15700 870 Disks large homolog 2 OS= no N/A 0.418 0.1 0.709 9e-32
>sp|Q12959|DLG1_HUMAN Disks large homolog 1 OS=Homo sapiens GN=DLG1 PE=1 SV=2 Back     alignment and function desciption
 Score =  143 bits (360), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (82%)

Query: 6   VNGGDSEWEYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQV 65
           VNG D+++EYEEI LERG +GLGFSIAGGTDNPHIGDD+SI+ITK+I GGAAA DGRL+V
Sbjct: 213 VNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRV 272

Query: 66  NDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTLLGEKN 103
           ND I +VN V V DV HS AVEALK AG++V L  ++ 
Sbjct: 273 NDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRR 310
Essential multidomain scaffolding protein required for normal development (By similarity). Recruits channels, receptors and signaling molecules to discrete plasma membrane domains in polarized cells. May play a role in adherens junction assembly, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation. Regulates the excitability of cardiac myocytes by modulating the functional expression of Kv4 channels. Functional regulator of Kv1.5 channel.
Homo sapiens (taxid: 9606)
>sp|Q28C55|DLG1_XENTR Disks large homolog 1 OS=Xenopus tropicalis GN=dlg1 PE=2 SV=1 Back     alignment and function description
>sp|Q811D0|DLG1_MOUSE Disks large homolog 1 OS=Mus musculus GN=Dlg1 PE=1 SV=1 Back     alignment and function description
>sp|Q62696|DLG1_RAT Disks large homolog 1 OS=Rattus norvegicus GN=Dlg1 PE=1 SV=1 Back     alignment and function description
>sp|Q5PYH5|DLG1L_DANRE Discs large homolog 1-like protein OS=Danio rerio GN=dlg1l PE=2 SV=1 Back     alignment and function description
>sp|Q5PYH6|DLG1_DANRE Disks large homolog 1 OS=Danio rerio GN=dlg1 PE=2 SV=2 Back     alignment and function description
>sp|P78352|DLG4_HUMAN Disks large homolog 4 OS=Homo sapiens GN=DLG4 PE=1 SV=3 Back     alignment and function description
>sp|P31016|DLG4_RAT Disks large homolog 4 OS=Rattus norvegicus GN=Dlg4 PE=1 SV=1 Back     alignment and function description
>sp|Q62108|DLG4_MOUSE Disks large homolog 4 OS=Mus musculus GN=Dlg4 PE=1 SV=1 Back     alignment and function description
>sp|Q15700|DLG2_HUMAN Disks large homolog 2 OS=Homo sapiens GN=DLG2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
333033759 882 discs large 1 [Gryllus bimaculatus] 0.298 0.070 0.855 1e-37
307193164 372 Disks large 1 tumor suppressor protein [ 0.456 0.255 0.791 3e-37
332025041 414 Disks large 1 tumor suppressor protein [ 0.456 0.229 0.781 6e-37
307175598 521 Disks large 1 tumor suppressor protein [ 0.370 0.147 0.811 5e-36
383849085 946 PREDICTED: disks large 1 tumor suppresso 0.307 0.067 0.811 6e-36
322786961278 hypothetical protein SINV_01290 [Solenop 0.25 0.187 0.8 1e-35
405971352 842 Disks large-like protein 1 [Crassostrea 0.581 0.143 0.578 1e-34
242023645238 discs large, putative [Pediculus humanus 0.302 0.264 0.8 1e-34
340722459 754 PREDICTED: disks large 1 tumor suppresso 0.312 0.086 0.8 2e-34
194769460 1005 GF19077 [Drosophila ananassae] gi|190618 0.461 0.095 0.762 2e-34
>gi|333033759|dbj|BAK23256.1| discs large 1 [Gryllus bimaculatus] Back     alignment and taxonomy information
 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/90 (85%), Positives = 83/90 (92%)

Query: 9   GDSEWEYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDV 68
           GD EWE+EEI LERGGAGLGFSIAGGTDNPHIGDDT+IYITKLIPGGAAA+DGRL+VND 
Sbjct: 170 GDGEWEFEEIVLERGGAGLGFSIAGGTDNPHIGDDTAIYITKLIPGGAAAADGRLRVNDT 229

Query: 69  IHQVNHVTVVDVPHSAAVEALKRAGNVVTL 98
           I QVN VTVVDVPH+AAV+ALKRAGN V L
Sbjct: 230 ILQVNDVTVVDVPHAAAVDALKRAGNEVRL 259

Source: Gryllus bimaculatus

Species: Gryllus bimaculatus

Genus: Gryllus

Family: Gryllidae

Order: Orthoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307193164|gb|EFN76069.1| Disks large 1 tumor suppressor protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332025041|gb|EGI65228.1| Disks large 1 tumor suppressor protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307175598|gb|EFN65508.1| Disks large 1 tumor suppressor protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383849085|ref|XP_003700177.1| PREDICTED: disks large 1 tumor suppressor protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322786961|gb|EFZ13185.1| hypothetical protein SINV_01290 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|405971352|gb|EKC36193.1| Disks large-like protein 1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|242023645|ref|XP_002432242.1| discs large, putative [Pediculus humanus corporis] gi|212517644|gb|EEB19504.1| discs large, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340722459|ref|XP_003399623.1| PREDICTED: disks large 1 tumor suppressor protein-like [Bombus terrestris] gi|350416652|ref|XP_003491037.1| PREDICTED: disks large 1 tumor suppressor protein-like isoform 1 [Bombus impatiens] gi|350416654|ref|XP_003491038.1| PREDICTED: disks large 1 tumor suppressor protein-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|194769460|ref|XP_001966822.1| GF19077 [Drosophila ananassae] gi|190618343|gb|EDV33867.1| GF19077 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
UNIPROTKB|F1MNQ3 800 F1MNQ3 "Uncharacterized protei 0.447 0.116 0.612 2.1e-29
FB|FBgn0001624 970 dlg1 "discs large 1" [Drosophi 0.451 0.096 0.642 3e-29
ZFIN|ZDB-GENE-010724-8 909 dlg1 "discs, large (Drosophila 0.447 0.102 0.612 1.3e-27
UNIPROTKB|F1NPX2 711 DLG2 "Uncharacterized protein" 0.447 0.130 0.602 7.3e-27
RGD|619895 852 Dlg2 "discs, large homolog 2 ( 0.447 0.109 0.602 3.8e-26
MGI|MGI:1344351 852 Dlg2 "discs, large homolog 2 ( 0.447 0.109 0.602 3.8e-26
UNIPROTKB|Q15700 870 DLG2 "Disks large homolog 2" [ 0.447 0.106 0.602 4.1e-26
ZFIN|ZDB-GENE-040628-3 801 dlg4 "discs, large (Drosophila 0.447 0.116 0.612 3.6e-25
ZFIN|ZDB-GENE-050222-3 906 dlg1l "discs, large (Drosophil 0.466 0.107 0.608 1e-24
UNIPROTKB|E1BT38 933 DLG1 "Uncharacterized protein" 0.524 0.116 0.562 7.6e-24
UNIPROTKB|F1MNQ3 F1MNQ3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 283 (104.7 bits), Expect = 2.1e-29, Sum P(2) = 2.1e-29
 Identities = 57/93 (61%), Positives = 68/93 (73%)

Query:     6 VNGGDSEWEYEEIRLERXXXXXXXXXXXXTDNPHIGDDTSIYITKLIPGGAAASDGRLQV 65
             VNG D+++EYEEI LER            TDNPHIGDD+SI+ITK+I GGAAA DGRL+V
Sbjct:   109 VNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIIAGGAAAQDGRLRV 168

Query:    66 NDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTL 98
             ND I +VN + V DV HS AVEALK AG++V L
Sbjct:   169 NDCILRVNEIDVRDVTHSKAVEALKEAGSIVRL 201
GO:0097025 "MPP7-DLG1-LIN7 complex" evidence=IEA
GO:0097016 "L27 domain binding" evidence=IEA
GO:0090004 "positive regulation of establishment of protein localization to plasma membrane" evidence=IEA
GO:0072659 "protein localization to plasma membrane" evidence=IEA
GO:0070830 "tight junction assembly" evidence=IEA
GO:0060022 "hard palate development" evidence=IEA
GO:0050680 "negative regulation of epithelial cell proliferation" evidence=IEA
GO:0048745 "smooth muscle tissue development" evidence=IEA
GO:0048704 "embryonic skeletal system morphogenesis" evidence=IEA
GO:0048608 "reproductive structure development" evidence=IEA
GO:0048471 "perinuclear region of cytoplasm" evidence=IEA
GO:0045930 "negative regulation of mitotic cell cycle" evidence=IEA
GO:0045121 "membrane raft" evidence=IEA
GO:0044325 "ion channel binding" evidence=IEA
GO:0043268 "positive regulation of potassium ion transport" evidence=IEA
GO:0043219 "lateral loop" evidence=IEA
GO:0042982 "amyloid precursor protein metabolic process" evidence=IEA
GO:0042391 "regulation of membrane potential" evidence=IEA
GO:0042130 "negative regulation of T cell proliferation" evidence=IEA
GO:0042110 "T cell activation" evidence=IEA
GO:0035748 "myelin sheath abaxonal region" evidence=IEA
GO:0033268 "node of Ranvier" evidence=IEA
GO:0032947 "protein complex scaffold" evidence=IEA
GO:0032147 "activation of protein kinase activity" evidence=IEA
GO:0031594 "neuromuscular junction" evidence=IEA
GO:0031579 "membrane raft organization" evidence=IEA
GO:0031434 "mitogen-activated protein kinase kinase binding" evidence=IEA
GO:0031253 "cell projection membrane" evidence=IEA
GO:0030866 "cortical actin cytoskeleton organization" evidence=IEA
GO:0030838 "positive regulation of actin filament polymerization" evidence=IEA
GO:0030432 "peristalsis" evidence=IEA
GO:0019902 "phosphatase binding" evidence=IEA
GO:0016337 "cell-cell adhesion" evidence=IEA
GO:0016328 "lateral plasma membrane" evidence=IEA
GO:0016323 "basolateral plasma membrane" evidence=IEA
GO:0014069 "postsynaptic density" evidence=IEA
GO:0009898 "internal side of plasma membrane" evidence=IEA
GO:0008284 "positive regulation of cell proliferation" evidence=IEA
GO:0008022 "protein C-terminus binding" evidence=IEA
GO:0007015 "actin filament organization" evidence=IEA
GO:0005923 "tight junction" evidence=IEA
GO:0005874 "microtubule" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0002369 "T cell cytokine production" evidence=IEA
GO:0002088 "lens development in camera-type eye" evidence=IEA
GO:0001935 "endothelial cell proliferation" evidence=IEA
GO:0001772 "immunological synapse" evidence=IEA
GO:0001771 "immunological synapse formation" evidence=IEA
GO:0001658 "branching involved in ureteric bud morphogenesis" evidence=IEA
FB|FBgn0001624 dlg1 "discs large 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-010724-8 dlg1 "discs, large (Drosophila) homolog 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPX2 DLG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|619895 Dlg2 "discs, large homolog 2 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1344351 Dlg2 "discs, large homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q15700 DLG2 "Disks large homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040628-3 dlg4 "discs, large (Drosophila) homolog 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050222-3 dlg1l "discs, large (Drosophila) homolog 1, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BT38 DLG1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5PYH5DLG1L_DANRENo assigned EC number0.72340.42300.1064yesN/A
Q28C55DLG1_XENTRNo assigned EC number0.73400.42300.0949yesN/A
Q62696DLG1_RATNo assigned EC number0.68360.43260.0987yesN/A
Q12959DLG1_HUMANNo assigned EC number0.69380.43260.0995yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 5e-20
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 3e-19
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 4e-17
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 1e-06
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information 
 Score = 79.9 bits (198), Expect = 5e-20
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 7/84 (8%)

Query: 17 EIRLERG-GAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHV 75
           + L +  G GLGFS+ GG D+        I+++++ PGG A   G L+V D I +VN V
Sbjct: 3  TVTLRKDPGGGLGFSLRGGKDS-----GGGIFVSRVEPGGPAER-GGLRVGDRILEVNGV 56

Query: 76 TVVDVPHSAAVEALKRAGNVVTLL 99
          +V  + H  AVE LK +G+ VTL 
Sbjct: 57 SVEGLTHEEAVELLKNSGDEVTLT 80

May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
KOG3550|consensus207 99.66
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.63
KOG3209|consensus984 99.6
KOG3209|consensus984 99.6
KOG3580|consensus 1027 99.55
KOG1892|consensus 1629 99.53
KOG3551|consensus 506 99.51
KOG3549|consensus 505 99.51
KOG3571|consensus 626 99.49
KOG3553|consensus124 99.45
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.27
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 99.2
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.1
KOG3605|consensus829 99.01
KOG3651|consensus 429 98.95
KOG3606|consensus358 98.93
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.76
KOG3552|consensus 1298 98.75
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.68
KOG3580|consensus 1027 98.57
KOG0609|consensus 542 98.43
KOG3542|consensus 1283 98.38
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.34
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.32
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.29
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.17
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.15
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.13
KOG3605|consensus829 98.12
KOG3938|consensus334 98.08
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.06
PRK11186 667 carboxy-terminal protease; Provisional 97.97
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.97
KOG0606|consensus 1205 97.94
KOG1738|consensus 638 97.73
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.59
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.55
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.47
PRK10139455 serine endoprotease; Provisional 97.45
PRK10942473 serine endoprotease; Provisional 97.43
PRK10779449 zinc metallopeptidase RseP; Provisional 97.39
PRK10139455 serine endoprotease; Provisional 97.37
PRK10898353 serine endoprotease; Provisional 97.32
PRK10942473 serine endoprotease; Provisional 97.29
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 97.26
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.22
PRK10779 449 zinc metallopeptidase RseP; Provisional 97.21
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.05
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.6
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 96.45
KOG4407|consensus 1973 96.43
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 96.26
COG3975558 Predicted protease with the C-terminal PDZ domain 96.09
KOG1320|consensus473 95.88
KOG4371|consensus1332 95.58
KOG3129|consensus231 95.46
KOG3532|consensus 1051 95.41
COG0265347 DegQ Trypsin-like serine proteases, typically peri 95.4
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 95.31
PRK09681276 putative type II secretion protein GspC; Provision 94.06
COG3480342 SdrC Predicted secreted protein containing a PDZ d 93.65
KOG3549|consensus 505 90.2
KOG1421|consensus 955 89.7
COG3031275 PulC Type II secretory pathway, component PulC [In 89.31
KOG4407|consensus 1973 87.89
PF06663 189 DUF1170: Protein of unknown function (DUF1170); In 87.4
PF1281278 PDZ_1: PDZ-like domain 86.25
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 86.14
KOG4371|consensus1332 85.78
KOG0792|consensus 1144 85.28
KOG3550|consensus207 80.9
>KOG3550|consensus Back     alignment and domain information 
Probab=99.66  E-value=2.9e-16  Score=118.19  Aligned_cols=91  Identities=34%  Similarity=0.545  Sum_probs=82.5

Q ss_pred             CCCcceEEEEEEeCCCcccEEEeccCCCCCCCCCCcEEEEEECCCCcccccCCCCCCCEEEEECCeecCCCCHHHHHHHH
Q psy10226         10 DSEWEYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHVTVVDVPHSAAVEAL   89 (208)
Q Consensus        10 ~~~~~~~~v~l~k~~~~lGf~i~gg~~~~~~~~~~~i~I~~v~~gg~A~~~G~L~~gD~Il~Vng~~l~~~t~~~av~~l   89 (208)
                      ++.-..+.|+|.|-.+||||.+-||++.     +.+|||++|.|||.|+|.|.|+.||++++|||+++++..|+.|+++|
T Consensus        86 eghahprvvelpktdeglgfnvmggkeq-----nspiyisriipggvadrhgglkrgdqllsvngvsvege~hekavell  160 (207)
T KOG3550|consen   86 EGHAHPRVVELPKTDEGLGFNVMGGKEQ-----NSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELL  160 (207)
T ss_pred             ccCCCCceeecCccccccceeeccCccc-----CCceEEEeecCCccccccCcccccceeEeecceeecchhhHHHHHHH
Confidence            4445567899999899999999999885     78999999999999999999999999999999999999999999999


Q ss_pred             HhCCCEEEEeeeeeCC
Q psy10226         90 KRAGNVVTLLGEKNLE  105 (208)
Q Consensus        90 ~~~~~~v~l~~~~~~~  105 (208)
                      +.+.+.|.|++++...
T Consensus       161 kaa~gsvklvvrytpk  176 (207)
T KOG3550|consen  161 KAAVGSVKLVVRYTPK  176 (207)
T ss_pred             HHhcCcEEEEEecChH
Confidence            9999999998766443

>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>PF06663 DUF1170: Protein of unknown function (DUF1170); InterPro: IPR010599 This region of unknown function is situated between the IPR001478 from INTERPRO and IPR001849 from INTERPRO domains in a cytoplasmic and membrane associated protein which appears to function as an adapter protein or regulator of Ras signalling pathways [] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 2e-25
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 2e-24
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 6e-24
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 1e-23
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 2e-23
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 2e-23
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 2e-23
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 2e-23
1kef_A93 Pdz1 Of Sap90 Length = 93 2e-23
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 3e-23
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 4e-19
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 2e-11
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 5e-11
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 2e-10
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 3e-10
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 4e-10
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 4e-10
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 4e-10
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 6e-10
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 7e-10
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 9e-10
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 1e-09
4amh_A106 Influence Of Circular Permutation On The Folding Pa 4e-09
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 6e-09
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 3e-08
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 4e-08
2jre_A108 C60-1, A Pdz Domain Designed Using Statistical Coup 5e-08
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 6e-08
2csj_A117 Solution Structure Of N-Terminal Pdz Domain From Mo 7e-07
1q7x_A108 Solution Structure Of The Alternatively Spliced Pdz 8e-07
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 9e-07
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 1e-06
1ozi_A99 The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Len 1e-06
3pdz_A96 Solution Structure Of The Pdz2 Domain From Human Ph 1e-06
1uju_A111 Solution Structure Of The Fourth Pdz Domain Of Huma 1e-06
1d5g_A96 Solution Structure Of The Pdz2 Domain From Human Ph 1e-06
2rrm_A100 Interplay Between Phosphatidyl-Inositol-Phosphates 7e-06
1wg6_A127 Solution Structure Of Pdz Domain In Protein Xp_1108 8e-06
2dmz_A129 Solution Structure Of The Third Pdz Domain Of Human 9e-06
2koh_A111 Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve 1e-05
2k1z_A104 Solution Structure Of Par-3 Pdz3 Length = 104 1e-05
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 2e-05
2h3m_A97 Crystal Structure Of Zo-1 Pdz1 Length = 97 2e-05
2h2c_A107 Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-Der 3e-05
2h2b_A107 Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-der 3e-05
3hvq_C170 Crystal Structure Of A Complex Between Protein Phos 4e-05
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 5e-05
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 7e-05
1x5q_A110 Solution Structure Of The First Pdz Domain Of Scrib 7e-05
1wf8_A107 Solution Structure Of The Pdz Domain Of Spinophilin 8e-05
3egh_C170 Crystal Structure Of A Complex Between Protein Phos 1e-04
3egg_C170 Crystal Structure Of A Complex Between Protein Phos 1e-04
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 1e-04
2fn5_A94 Nmr Structure Of The Neurabin Pdz Domain (502-594) 1e-04
2w4f_A97 Crystal Structure Of The First Pdz Domain Of Human 1e-04
3b76_A118 Crystal Structure Of The Third Pdz Domain Of Human 1e-04
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 1e-04
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 1e-04
1t2m_A101 Solution Structure Of The Pdz Domain Of Af-6 Length 2e-04
3axa_A106 Crystal Structure Of Afadin Pdz Domain In Complex W 2e-04
1xz9_A101 Structure Of Af-6 Pdz Domain Length = 101 2e-04
1um1_A110 Solution Structure Of Rsgi Ruh-007, Pdz Domain In H 2e-04
2ain_A93 Solution Structure Of The Af-6 Pdz Domain Complexed 2e-04
2g5m_B113 Spinophilin Pdz Domain Length = 113 2e-04
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 2e-04
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 2e-04
1mc7_A95 Solution Structure Of Mdvl1 Pdz Domain Length = 95 2e-04
1wfv_A103 Solution Structure Of The Fifth Pdz Domain Of Human 3e-04
2kaw_A90 Nmr Structure Of The Mdvl1 Pdz Domain In Complex Wi 3e-04
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 5e-04
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 5e-04
3cbz_A108 The Dvl2 Pdz Domain In Complex With The N2 Inhibito 5e-04
3cbx_A105 The Dvl2 Pdz Domain In Complex With The C1 Inhibito 5e-04
3cby_A108 The Dvl2 Pdz Domain In Complex With The N1 Inhibito 5e-04
2rey_A100 Crystal Structure Of The Pdz Domain Of Human Dishev 6e-04
3cc0_A108 The Dvl2 Pdz Domain In Complex With The N3 Inhibito 6e-04
2vrf_A95 Crystal Structure Of The Human Beta-2-Syntrophin Pd 9e-04
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (280), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 66/94 (70%)
Query: 6   VNGGDSEWEYEEIRLERXXXXXXXXXXXXTDNPHIGDDTSIYITKLIPGGAAASDGRLQV 65
           VNG + E EYEEI LER            TDNPHIGDD SI+ITK+IPGGAAA DGRL+V
Sbjct: 51  VNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRV 110
Query: 66  NDVIHQVNHVTVVDVPHSAAVEALKRAGNVVTLL 99
           ND I  VN V V +V HSAAVEALK AG++V L 
Sbjct: 111 NDSILFVNEVDVREVTHSAAVEALKEAGSIVRLY 144
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2JRE|A Chain A, C60-1, A Pdz Domain Designed Using Statistical Coupling Analysis Length = 108 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2CSJ|A Chain A, Solution Structure Of N-Terminal Pdz Domain From Mouse Tjp2 Length = 117 Back     alignment and structure
>pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|1OZI|A Chain A, The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Length = 99 Back     alignment and structure
>pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 Back     alignment and structure
>pdb|1UJU|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 111 Back     alignment and structure
>pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 Back     alignment and structure
>pdb|2RRM|A Chain A, Interplay Between Phosphatidyl-Inositol-Phosphates And Claudins Upon Binding To The 1st Pdz Domain Of Zonula Occludens 1 Length = 100 Back     alignment and structure
>pdb|1WG6|A Chain A, Solution Structure Of Pdz Domain In Protein Xp_110852 Length = 127 Back     alignment and structure
>pdb|2DMZ|A Chain A, Solution Structure Of The Third Pdz Domain Of Human Inad- Like Protein Length = 129 Back     alignment and structure
>pdb|2KOH|A Chain A, Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve-Cadherin C-Terminus Length = 111 Back     alignment and structure
>pdb|2K1Z|A Chain A, Solution Structure Of Par-3 Pdz3 Length = 104 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2H3M|A Chain A, Crystal Structure Of Zo-1 Pdz1 Length = 97 Back     alignment and structure
>pdb|2H2C|A Chain A, Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-Derived Ligand (Wrrttwv) Length = 107 Back     alignment and structure
>pdb|2H2B|A Chain A, Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-derived Ligand (wrrttyl) Length = 107 Back     alignment and structure
>pdb|3HVQ|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Neurabin Length = 170 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|1X5Q|A Chain A, Solution Structure Of The First Pdz Domain Of Scribble Homolog Protein (Hscrib) Length = 110 Back     alignment and structure
>pdb|1WF8|A Chain A, Solution Structure Of The Pdz Domain Of SpinophilinNEURABINII PROTEIN Length = 107 Back     alignment and structure
>pdb|3EGH|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1), The Pp1 Binding And Pdz Domains Of Spinophilin And The Small Natural Molecular Toxin Nodularin-R Length = 170 Back     alignment and structure
>pdb|3EGG|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 170 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|2FN5|A Chain A, Nmr Structure Of The Neurabin Pdz Domain (502-594) Length = 94 Back     alignment and structure
>pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 Back     alignment and structure
>pdb|3B76|A Chain A, Crystal Structure Of The Third Pdz Domain Of Human Ligand-of-numb Protein-x (lnx1) In Complex With The C-terminal Peptide From The Coxsackievirus And Adenovirus Receptor Length = 118 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|1T2M|A Chain A, Solution Structure Of The Pdz Domain Of Af-6 Length = 101 Back     alignment and structure
>pdb|3AXA|A Chain A, Crystal Structure Of Afadin Pdz Domain In Complex With The C-Terminal Peptide From Nectin-3 Length = 106 Back     alignment and structure
>pdb|1XZ9|A Chain A, Structure Of Af-6 Pdz Domain Length = 101 Back     alignment and structure
>pdb|1UM1|A Chain A, Solution Structure Of Rsgi Ruh-007, Pdz Domain In Human Cdna Length = 110 Back     alignment and structure
>pdb|2AIN|A Chain A, Solution Structure Of The Af-6 Pdz Domain Complexed With The C-Terminal Peptide From The Bcr Protein Length = 93 Back     alignment and structure
>pdb|2G5M|B Chain B, Spinophilin Pdz Domain Length = 113 Back     alignment and structure
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|1MC7|A Chain A, Solution Structure Of Mdvl1 Pdz Domain Length = 95 Back     alignment and structure
>pdb|1WFV|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|2KAW|A Chain A, Nmr Structure Of The Mdvl1 Pdz Domain In Complex With Its Inhibitor Length = 90 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|3CBZ|A Chain A, The Dvl2 Pdz Domain In Complex With The N2 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|3CBX|A Chain A, The Dvl2 Pdz Domain In Complex With The C1 Inhibitory Peptide Length = 105 Back     alignment and structure
>pdb|3CBY|A Chain A, The Dvl2 Pdz Domain In Complex With The N1 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|2REY|A Chain A, Crystal Structure Of The Pdz Domain Of Human Dishevelled 2 (Homologous To Drosophila Dsh) Length = 100 Back     alignment and structure
>pdb|3CC0|A Chain A, The Dvl2 Pdz Domain In Complex With The N3 Inhibitory Peptide Length = 108 Back     alignment and structure
>pdb|2VRF|A Chain A, Crystal Structure Of The Human Beta-2-Syntrophin Pdz Domain Length = 95 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 3e-40
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 2e-39
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 5e-38
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 1e-37
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 5e-36
2byg_A117 Channel associated protein of synapse-110; DLG2, P 6e-36
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 9e-36
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 5e-28
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 2e-35
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 3e-35
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 1e-34
2awx_A105 Synapse associated protein 97; membrane protein, s 2e-34
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-33
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-33
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 2e-33
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-33
2djt_A104 Unnamed protein product; PDZ domain, structural ge 3e-33
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 5e-33
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 2e-32
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 2e-32
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 2e-32
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 5e-32
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 5e-32
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 1e-31
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-31
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-31
2opg_A98 Multiple PDZ domain protein; structural protein, s 2e-31
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 5e-31
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 6e-31
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 4e-30
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 4e-30
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-29
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-29
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-29
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-29
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 4e-17
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 7e-16
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 3e-29
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 6e-29
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 1e-28
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-28
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-28
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 2e-28
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 2e-28
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 3e-28
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 3e-28
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 3e-28
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-28
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 5e-28
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 5e-28
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 8e-28
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 1e-27
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 1e-27
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 1e-27
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 1e-27
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 1e-27
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-27
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-26
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 3e-27
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 4e-27
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 4e-27
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 4e-27
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 4e-27
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 5e-27
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 5e-27
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 6e-27
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-22
2o2t_A117 Multiple PDZ domain protein; structural protein, s 1e-26
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 2e-26
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 6e-26
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 9e-26
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 1e-25
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 1e-25
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 2e-25
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 4e-25
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 4e-25
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 6e-25
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 8e-25
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 3e-24
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 4e-24
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 7e-24
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 7e-24
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-23
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 3e-23
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 4e-23
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 6e-23
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 8e-23
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 9e-23
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 1e-22
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 6e-22
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 7e-22
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 2e-21
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 5e-21
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 7e-21
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 7e-21
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 8e-21
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 1e-20
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 2e-20
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 2e-20
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 5e-20
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 7e-19
2eeh_A100 PDZ domain-containing protein 7; structural genomi 5e-20
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 7e-20
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 9e-20
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 1e-19
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 2e-19
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 3e-19
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 3e-19
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 6e-19
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 1e-18
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 1e-18
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 1e-18
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-18
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-18
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 2e-18
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 2e-18
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-18
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 4e-18
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 4e-18
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 4e-18
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 5e-18
2v90_A96 PDZ domain-containing protein 3; membrane, protein 5e-18
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 8e-18
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 8e-18
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 9e-18
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 9e-18
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-17
2eei_A106 PDZ domain-containing protein 1; regulatory factor 3e-17
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 3e-17
3k1r_A192 Harmonin; protein-protein complex, alternative spl 4e-17
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 5e-17
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 5e-17
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 6e-17
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 6e-17
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 7e-17
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 7e-17
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 8e-17
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 1e-16
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 1e-16
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 2e-16
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 3e-16
2d90_A102 PDZ domain containing protein 1; structural genomi 1e-15
3khf_A99 Microtubule-associated serine/threonine-protein ki 1e-15
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-15
2ego_A96 General receptor for phosphoinositides 1- associat 6e-15
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 8e-15
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 9e-15
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-13
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 2e-14
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 1e-06
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 4e-14
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 4e-14
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 8e-14
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 2e-13
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 3e-13
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 3e-13
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 4e-13
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 1e-12
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-12
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 6e-12
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 6e-12
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 8e-12
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 1e-11
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 1e-09
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 6e-09
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 3e-08
2hga_A125 Conserved protein MTH1368; GFT structural genomics 2e-05
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
 Score =  132 bits (333), Expect = 3e-40
 Identities = 60/89 (67%), Positives = 70/89 (78%)

Query: 11 SEWEYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIH 70
          S ++YEEI LERG +GLGFSIAGG DNPH+ DD  I+ITK+IPGGAAA DGRL VND + 
Sbjct: 1  SMFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVL 60

Query: 71 QVNHVTVVDVPHSAAVEALKRAGNVVTLL 99
          +VN V V +V HS AVEALK AG VV L+
Sbjct: 61 RVNEVDVSEVVHSRAVEALKEAGPVVRLV 89
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.74
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.73
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.72
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.72
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.71
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.7
2awx_A105 Synapse associated protein 97; membrane protein, s 99.7
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.69
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.69
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.69
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.68
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.68
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.68
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.68
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.67
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.67
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.67
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.66
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.66
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.65
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.65
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.65
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.65
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.65
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.65
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.64
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.64
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.64
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.64
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.64
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.64
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.64
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.64
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.63
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.63
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.63
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.63
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.63
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.63
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.62
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.62
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.62
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.62
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.62
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.62
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.62
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.62
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.62
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.62
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.62
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.62
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.62
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.61
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.61
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.61
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.61
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.61
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.6
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.6
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.6
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.6
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.6
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.6
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.59
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.59
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.59
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.59
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.59
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.59
2ego_A96 General receptor for phosphoinositides 1- associat 99.59
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.59
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.58
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.58
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.58
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.58
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.57
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.57
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.57
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.57
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.57
2d90_A102 PDZ domain containing protein 1; structural genomi 99.57
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.57
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.56
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.56
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.56
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.56
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.56
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.55
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.55
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.55
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.54
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.54
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.54
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.54
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.54
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.54
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.53
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.53
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.53
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.53
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.53
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.52
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.52
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.52
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.52
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.51
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.51
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.51
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.51
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.51
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.5
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.5
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.5
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.5
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.5
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.49
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.49
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.48
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 99.47
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.47
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.47
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.47
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.46
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.46
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.45
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.45
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.45
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.45
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.45
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.44
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.44
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.43
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.43
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.42
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.42
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.42
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.42
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.41
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 99.12
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.4
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.4
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.4
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.39
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.38
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.36
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.36
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.35
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.35
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.34
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.32
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.32
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.32
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.32
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.31
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.28
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.28
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.27
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.25
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.25
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.24
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.24
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.23
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.22
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.22
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.17
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.16
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.99
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.99
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.64
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.54
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.4
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.37
2kl1_A94 YLBL protein; structure genomics, structural genom 98.35
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.34
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.33
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.3
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.28
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.24
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.17
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.16
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.14
3k50_A 403 Putative S41 protease; structural genomics, joint 98.1
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.06
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.0
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.0
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.94
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 97.92
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.9
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.89
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.88
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.88
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.81
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.78
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.77
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.64
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.56
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.38
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.21
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.12
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 96.39
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 95.93
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 93.47
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 91.65
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 89.08
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 88.43
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 85.27
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 83.96
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 83.93
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 83.02
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 82.99
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 82.85
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 82.82
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 82.58
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 82.45
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 82.42
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 82.17
2d90_A102 PDZ domain containing protein 1; structural genomi 81.78
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 81.17
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 81.16
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 80.94
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 80.58
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 80.55
2byg_A117 Channel associated protein of synapse-110; DLG2, P 80.28
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 80.19
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
Probab=99.74  E-value=3.3e-17  Score=116.80  Aligned_cols=91  Identities=65%  Similarity=0.988  Sum_probs=82.5

Q ss_pred             CcceEEEEEEeCCCcccEEEeccCCCCCCCCCCcEEEEEECCCCcccccCCCCCCCEEEEECCeecCCCCHHHHHHHHHh
Q psy10226         12 EWEYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHVTVVDVPHSAAVEALKR   91 (208)
Q Consensus        12 ~~~~~~v~l~k~~~~lGf~i~gg~~~~~~~~~~~i~I~~v~~gg~A~~~G~L~~gD~Il~Vng~~l~~~t~~~av~~l~~   91 (208)
                      +|+.++|.|.|+..+|||++.++.+.+......+++|..|.++|+|+++|+|++||+|++|||..+.++++.+++.+++.
T Consensus         2 ~~~~~~v~l~k~~~glG~~i~~g~~~~~~~~~~gv~V~~V~~~spA~~aG~L~~GD~I~~vng~~v~~~~~~~~~~~~~~   81 (102)
T 2i1n_A            2 MFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKE   81 (102)
T ss_dssp             CEEEEEEEEECBTTBTSEEEEECTTSCSSTTCCCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECSSCCHHHHHHHHHH
T ss_pred             CceEEEEEEEECCCcCCEEEEcccCCCCcCCCCCEEEEEECCCCHHHHCCCCCCCCEEEEECCEECCCCCHHHHHHHHHc
Confidence            68999999999989999999998886554557799999999999999999999999999999999999999999999999


Q ss_pred             CCCEEEEeeee
Q psy10226         92 AGNVVTLLGEK  102 (208)
Q Consensus        92 ~~~~v~l~~~~  102 (208)
                      .+..+.|...|
T Consensus        82 ~g~~v~l~v~R   92 (102)
T 2i1n_A           82 AGPVVRLVVRR   92 (102)
T ss_dssp             SCSEEEEEEEE
T ss_pred             CCCeEEEEEEe
Confidence            88888886544
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 208
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 5e-29
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 6e-26
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 5e-24
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 1e-23
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 3e-23
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 4e-23
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 5e-23
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 9e-23
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-22
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 2e-22
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 3e-22
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 9e-22
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 2e-21
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 4e-21
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 5e-21
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 6e-21
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 6e-21
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 1e-20
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 1e-20
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-20
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 2e-20
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 5e-20
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-20
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-19
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 2e-19
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 3e-19
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 4e-19
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 4e-19
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 6e-19
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 9e-19
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-18
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-18
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 3e-18
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 5e-18
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 5e-18
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 6e-18
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 7e-18
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 7e-18
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-17
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 7e-17
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-16
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 1e-16
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 2e-16
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 3e-16
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 4e-16
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 4e-16
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 1e-15
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-15
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-15
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 4e-15
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 6e-15
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 1e-14
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-14
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 4e-14
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 5e-14
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 1e-13
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 1e-13
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 5e-13
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 5e-12
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 8e-11
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 4e-08
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 5e-04
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 5e-06
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 2e-05
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synaptic protein PSD-95
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  101 bits (254), Expect = 5e-29
 Identities = 65/86 (75%), Positives = 72/86 (83%)

Query: 14 EYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVN 73
          EYEEI LERG +GLGFSIAGGTDNPHIGDD SI+ITK+IPGGAAA DGRL+VND I  VN
Sbjct: 1  EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVN 60

Query: 74 HVTVVDVPHSAAVEALKRAGNVVTLL 99
           V V +V HSAAVEALK AG++V L 
Sbjct: 61 EVDVREVTHSAAVEALKEAGSIVRLY 86
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.87
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.86
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.84
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.82
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.82
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.82
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.82
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.81
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.81
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.8
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.8
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.8
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.8
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.8
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.8
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.79
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.79
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.79
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.79
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.78
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.78
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.78
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.77
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.77
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.76
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.76
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.76
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.76
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.76
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.76
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.75
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.74
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.74
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.74
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.74
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.74
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.73
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.73
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.73
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.73
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.72
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.71
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.71
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.7
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.69
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.69
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.68
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.68
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.67
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.65
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.64
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.64
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.59
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.41
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.03
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.75
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.54
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.48
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.26
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.26
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.18
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.11
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 95.65
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 95.35
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 95.33
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 95.33
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 94.99
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 94.77
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 94.74
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 94.66
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 94.65
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 94.64
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 94.6
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 94.55
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 94.43
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 94.39
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 94.38
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 94.18
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 94.14
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 94.1
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 94.07
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 94.07
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 94.05
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 93.88
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 93.77
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 93.73
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 93.69
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 93.63
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 93.5
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 93.41
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 93.35
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 93.34
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 93.28
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 93.18
d1y7na179 Amyloid beta A4 precursor protein-binding family A 93.15
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 93.12
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 93.02
d1rzxa_98 GTPase-binding domain of the cell polarity protein 92.67
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 92.57
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 92.38
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 92.34
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 92.29
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 91.55
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 91.26
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 91.22
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 91.21
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 91.12
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 91.04
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 90.95
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 89.07
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 88.67
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 88.54
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 87.93
d1x45a185 Amyloid beta A4 precursor protein-binding family A 87.66
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 83.79
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 83.39
d1fc6a392 Photosystem II D1 C-terminal processing protease { 83.38
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 83.31
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 82.05
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 81.37
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synaptic protein PSD-95
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.87  E-value=4.6e-22  Score=138.72  Aligned_cols=89  Identities=73%  Similarity=1.076  Sum_probs=81.3

Q ss_pred             ceEEEEEEeCCCcccEEEeccCCCCCCCCCCcEEEEEECCCCcccccCCCCCCCEEEEECCeecCCCCHHHHHHHHHhCC
Q psy10226         14 EYEEIRLERGGAGLGFSIAGGTDNPHIGDDTSIYITKLIPGGAAASDGRLQVNDVIHQVNHVTVVDVPHSAAVEALKRAG   93 (208)
Q Consensus        14 ~~~~v~l~k~~~~lGf~i~gg~~~~~~~~~~~i~I~~v~~gg~A~~~G~L~~gD~Il~Vng~~l~~~t~~~av~~l~~~~   93 (208)
                      |+++|+|.|+..+|||+|.||.+.+......++||..|.+||+|+++|+|++||+|++|||+++.+++|++|+++|++++
T Consensus         1 E~~~V~l~k~~~glG~~i~gg~~~~~~~~~~gi~I~~V~~gg~A~~~G~L~~GD~Il~VNg~~v~~~s~~e~~~~l~~~~   80 (93)
T d1rgra_           1 EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAG   80 (93)
T ss_dssp             CEEEEEEECCSSCCSEEECCCSSSCSCTTCCCCCEEEECTTSHHHHHCCCCTTCEEEEETTEECSSSCHHHHHHHHHHTT
T ss_pred             CCEEEEEEeCCCcCCEEEEeecCCCCcCCCCCEEEEEECCCChHHhcCCCCcCcEEEEECCEECCCCCHHHHHHHHHcCC
Confidence            46789999998899999999998776666889999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEeeee
Q psy10226         94 NVVTLLGEK  102 (208)
Q Consensus        94 ~~v~l~~~~  102 (208)
                      +.++|++.|
T Consensus        81 ~~v~L~v~R   89 (93)
T d1rgra_          81 SIVRLYVMR   89 (93)
T ss_dssp             TEEEEEEEC
T ss_pred             CEEEEEEEe
Confidence            999886543
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure