Psyllid ID: psy10334

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----

MDELDGLSTIEVLFLRLFISTTSHVSRALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCRWMEEVTQHLDNLQMNSKSSLQTYQRLFPNSTLCLNVKNLLSELKLKYGLSIKLVWIPGHMNISGNCAVDLAAKQAQTSPDAEILNVTHTDLKSFFKKIPSEKWKLTWSYETCDNKLKNIKQDTKYWASSTRNIRKEEVVLTRLRIGHSLLTHKFLLDRQEPPMCNDCQVQITIKQFKHILCDCPLYQSFRRKNNLTELTLSSLLRDDSTQIYKVMRFLRQTKLFKLI

cccccccccHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHcccccccccccccccHHccccccccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHccccccccccccccccccccccEEcccccccHHHHHHcccccHHHHHHccccHHHHHHHHHHHHHHcccccc

ccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEcccccccccccccccHHHHHHHHHHHHcccHHHHHHHHccccccccHHcccccccccEEEEEEccHHHHHHHHHHcccccHHHHcccccHHHHHHHHHHHHHcccHccc

mdeldglsTIEVLFLRLFISTTSHVSRALAEVFRCFICIEklrdthlcphcsklcCLACIRQFLTeersqcphcraslhmtdlvncRWMEEVTQHLDnlqmnsksslqtyqrlfpnstlcLNVKNLLSELKLKYGlsiklvwipghmnisgnCAVDLAAkqaqtspdaeilnVTHTDLKSFfkkipsekwkltwsYETCDNKLKNIKQDTKYWASSTRNIRKEEVVLTRLRIGHSLLTHKflldrqeppmcndcqVQITIKQFKHilcdcplyqsfrrknnlteLTLSSLLRDDSTQIYKVMRFLRQTKLFKLI

mdeldglsTIEVLFLRLFISTTSHVSRALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCRWMEEVTQHLDNLQMNSKSSLQTYQRLFPNSTLCLNVKNLLSELKLKYGLSIKLVWIPGHMNISGNCAVDLAAKQAQTSPDAEILNVTHTDlksffkkipsekwkltwsyetcdnklknikqdtkywasstrnirkeevvltRLRIGHSLLTHKFLLDRQEPPMCNDCQVQITIKQFKHILCDCPLYQSFRRKNNLTEltlssllrddstqiyKVMRFLRQTKLFKLI

******LSTIEVLFLRLFISTTSHVSRALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCRWMEEVTQHLDNLQMN**SSLQTYQRLFPNSTLCLNVKNLLSELKLKYGLSIKLVWIPGHMNISGNCAVDLAAKQAQTSPDAEILNVTHTDLKSFFKKIPSEKWKLTWSYETCDNKLKNIKQDTKYWASSTRNIRKEEVVLTRLRIGHSLLTHKFLLDRQEPPMCNDCQVQITIKQFKHILCDCPLYQSFRRKNNLTELTLSSLLRDDSTQIYKVMRFLRQTKLF***

*******************************VFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCRWMEEVTQHLDNLQMNSKSSLQTYQRLFPNSTLCLNVKNLLSELKLKYGLSIKLVWIPGHMNISGNCAVDLAAKQAQTSPDAEILNVTHTDLKSFFKKIPSEKWKLTWSYETCDNKLKNIKQDTKYWASSTRNIRKEEVVLTRLRIGHSLLTHKFLLDRQEPPMCNDCQVQITIKQFKHILCDCPLYQSFRRKNNLTELTLSSLLRDDSTQIYKVMRFLRQTKLFKLI

***LDGLSTIEVLFLRLFISTTSHVSRALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCRWMEEVTQHLDNLQMNSKSSLQTYQRLFPNSTLCLNVKNLLSELKLKYGLSIKLVWIPGHMNISGNCAVDLAAKQAQTSPDAEILNVTHTDLKSFFKKIPSEKWKLTWSYETCDNKLKNIKQDTKYWASSTRNIRKEEVVLTRLRIGHSLLTHKFLLDRQEPPMCNDCQVQITIKQFKHILCDCPLYQSFRRKNNLTELTLSSLLRDDSTQIYKVMRFLRQTKLFKL*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		314	2.2.26 [Sep-21-2011]
O94972		964	E3 ubiquitin-protein liga	yes	N/A	0.235	0.076	0.729	1e-29
Q6PCX9		961	E3 ubiquitin-protein liga	yes	N/A	0.235	0.077	0.729	1e-29
Q9NS91		495	E3 ubiquitin-protein liga	no	N/A	0.229	0.145	0.342	8e-05
Q9QXK2		509	E3 ubiquitin-protein liga	no	N/A	0.229	0.141	0.328	0.0002

>sp\|O94972\|TRI37_HUMAN E3 ubiquitin-protein ligase TRIM37 OS=Homo sapiens GN=TRIM37 PE=1 SV=2	Back alignment and function desciption

 Score =  130 bits (328), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 54/74 (72%), Positives = 65/74 (87%)

Query: 28  ALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCR 87
           ++AEVFRCFIC+EKLRD  LCPHCSKLCC +CIR++LTE+R+QCPHCRA L + +LVNCR
Sbjct: 8   SIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCR 67

Query: 88  WMEEVTQHLDNLQM 101
           W EEVTQ LD LQ+
Sbjct: 68  WAEEVTQQLDTLQL 81

E3 ubiquitin-protein ligase.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|Q6PCX9\|TRI37_MOUSE E3 ubiquitin-protein ligase TRIM37 OS=Mus musculus GN=Trim37 PE=2 SV=1	Back alignment and function description

>sp\|Q9NS91\|RAD18_HUMAN E3 ubiquitin-protein ligase RAD18 OS=Homo sapiens GN=RAD18 PE=1 SV=2	Back alignment and function description

>sp\|Q9QXK2\|RAD18_MOUSE E3 ubiquitin-protein ligase RAD18 OS=Mus musculus GN=Rad18 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		314
322796557		1087	hypothetical protein SINV_07059 [Solenop	0.254	0.073	0.762	7e-31
307179558		1099	Tripartite motif-containing protein 37 [	0.245	0.070	0.779	7e-31
307205392		1090	Tripartite motif-containing protein 37 [	0.245	0.070	0.779	1e-30
332020273		1116	E3 ubiquitin-protein ligase TRIM37 [Acro	0.245	0.068	0.779	1e-30
91095417		884	PREDICTED: similar to tripartite motif-c	0.229	0.081	0.819	2e-30
383857056		1033	PREDICTED: uncharacterized protein LOC10	0.257	0.078	0.740	2e-30
270016968		852	hypothetical protein TcasGA2_TC010300 [T	0.229	0.084	0.819	2e-30
242006926		825	tripartite motif-containing protein, put	0.261	0.099	0.719	3e-30
345481792		1052	PREDICTED: hypothetical protein LOC10012	0.245	0.073	0.753	5e-30
326931489		1029	PREDICTED: e3 ubiquitin-protein ligase T	0.321	0.098	0.578	1e-28

>gi\|322796557\|gb\|EFZ19031.1\| hypothetical protein SINV_07059 [Solenopsis invicta]	Back alignment and taxonomy information

 Score =  140 bits (353), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 68/80 (85%)

Query: 21  TTSHVSRALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHM 80
           T  H    LAEVFRCFIC+EKLRD HLCPHCSKLCC  CIR++LTE+RSQCPHCRASLH+
Sbjct: 13  TDDHSVETLAEVFRCFICMEKLRDAHLCPHCSKLCCYTCIRRWLTEQRSQCPHCRASLHL 72

Query: 81  TDLVNCRWMEEVTQHLDNLQ 100
            +LVNCRW+EEVTQ LD LQ
Sbjct: 73  HELVNCRWVEEVTQQLDTLQ 92

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|307179558\|gb\|EFN67872.1\| Tripartite motif-containing protein 37 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|307205392\|gb\|EFN83733.1\| Tripartite motif-containing protein 37 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|332020273\|gb\|EGI60707.1\| E3 ubiquitin-protein ligase TRIM37 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|91095417\|ref\|XP_972942.1\| PREDICTED: similar to tripartite motif-containing 37 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|383857056\|ref\|XP_003704022.1\| PREDICTED: uncharacterized protein LOC100879152 [Megachile rotundata]	Back alignment and taxonomy information

>gi\|270016968\|gb\|EFA13414.1\| hypothetical protein TcasGA2_TC010300 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|242006926\|ref\|XP_002424293.1\| tripartite motif-containing protein, putative [Pediculus humanus corporis] gi\|212507693\|gb\|EEB11555.1\| tripartite motif-containing protein, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|345481792\|ref\|XP_001604793.2\| PREDICTED: hypothetical protein LOC100121202 [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|326931489\|ref\|XP_003211861.1\| PREDICTED: e3 ubiquitin-protein ligase TRIM37-like [Meleagris gallopavo]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		314
UNIPROTKB\|J3QRK3		103	TRIM37 "E3 ubiquitin-protein l	0.242	0.737	0.723	1e-29
UNIPROTKB\|J3QSH5		113	TRIM37 "E3 ubiquitin-protein l	0.242	0.672	0.723	1e-29
UNIPROTKB\|F1S260		340	LOC100739276 "Uncharacterized	0.242	0.223	0.723	1e-29
UNIPROTKB\|E1BGD4		961	TRIM37 "Uncharacterized protei	0.242	0.079	0.723	1.6e-28
MGI\|MGI:2153072		961	Trim37 "tripartite motif-conta	0.242	0.079	0.723	1.6e-28
UNIPROTKB\|E2RKB8		962	TRIM37 "Uncharacterized protei	0.242	0.079	0.723	1.6e-28
UNIPROTKB\|F1PKZ8		962	TRIM37 "Uncharacterized protei	0.242	0.079	0.723	1.6e-28
UNIPROTKB\|O94972		964	TRIM37 "E3 ubiquitin-protein l	0.242	0.078	0.723	1.6e-28
ZFIN\|ZDB-GENE-030131-2957		957	trim37 "tripartite motif conta	0.235	0.077	0.729	2e-28
UNIPROTKB\|F1NYX7		983	TRIM37 "Uncharacterized protei	0.235	0.075	0.729	2.1e-28

UNIPROTKB\|J3QRK3 TRIM37 "E3 ubiquitin-protein ligase TRIM37" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

 Score = 329 (120.9 bits), Expect = 1.0e-29, P = 1.0e-29
 Identities = 55/76 (72%), Positives = 66/76 (86%)

Query:    28 ALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCR 87
             ++AEVFRCFIC+EKLRD  LCPHCSKLCC +CIR++LTE+R+QCPHCRA L + +LVNCR
Sbjct:     8 SIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCR 67

Query:    88 WMEEVTQHLDNLQMNS 103
             W EEVTQ LD LQ+ S
Sbjct:    68 WAEEVTQQLDTLQLCS 83

GO:0008270 "zinc ion binding" evidence=IEA

UNIPROTKB\|J3QSH5 TRIM37 "E3 ubiquitin-protein ligase TRIM37" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S260 LOC100739276 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BGD4 TRIM37 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

MGI\|MGI:2153072 Trim37 "tripartite motif-containing 37" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RKB8 TRIM37 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PKZ8 TRIM37 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|O94972 TRIM37 "E3 ubiquitin-protein ligase TRIM37" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-2957 trim37 "tripartite motif containing 37" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NYX7 TRIM37 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	6.3.2	0.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		314
cd09276		128	cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI dom	7e-11
pfam00075		126	pfam00075, RNase_H, RNase H	2e-07
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	3e-05
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	5e-05
COG5574		271	COG5574, PEX10, RING-finger-containing E3 ubiquiti	0.001
TIGR00599		397	TIGR00599, rad18, DNA repair protein rad18	0.004

>gnl\|CDD\|187700 cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI domain of reverse transcriptases	Back alignment and domain information

 Score = 58.4 bits (142), Expect = 7e-11
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 103 SKSSLQTYQRLFPNSTLCLNVKNLLSELKLKYGLSIKLVWIPGHMNISGNCAVDLAAKQA 162
           S+++L+  +    +S L L ++  + EL    G+ ++L W+PGH  I GN   D  AK+A
Sbjct: 68  SQAALKALRSPRSSSPLVLRIRKAIRELANH-GVKVRLHWVPGHSGIEGNERADRLAKEA 126

Ribonuclease H (RNase H) is classified into two families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). Ribonuclease HI (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes. RNase HI has also been observed as an adjunct domain to the reverse transcriptase gene in retroviruses, long-term repeat (LTR)-bearing retrotransposons and non-LTR retrotransposons. RNase HI in LTR retrotransposons perform degradation of the original RNA template, generation of a polypurine tract (the primer for plus-strand DNA synthesis), and final removal of RNA primers from newly synthesized minus and plus strands. The catalytic residues for RNase H enzymatic activity, three aspartatic acids and one glutamatic acid residue (DEDD), are unvaried across all RNase H domains. The position of the RNase domain of non-LTR and LTR transposons is at the carboxyl terminal of the reverse transcriptase (RT) domain and their RNase domains group together, indicating a common evolutionary origin. Many non-LTR transposons have lost the RNase domain because their activity is at the nucleus and cellular RNase may suffice; however LTR retotransposons always encode their own RNase domain because it requires RNase activity in RNA-protein particles in the cytoplasm. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription. Length = 128

>gnl\|CDD\|215695 pfam00075, RNase_H, RNase H	Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233043 TIGR00599, rad18, DNA repair protein rad18	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		314
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	99.49
KOG0287\|consensus		442		99.47
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	99.42
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	99.42
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	99.41
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	99.34
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	99.32
KOG2177\|consensus		386		99.31
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	99.26
KOG0317\|consensus		293		99.25
KOG0823\|consensus		230		99.24
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	99.14
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	99.1
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	99.09
PHA02929		238	N1R/p28-like protein; Provisional	99.07
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	99.07
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	99.03
PHA02926		242	zinc finger-like protein; Provisional	99.01
KOG0320\|consensus		187		98.98
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	98.84
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.8
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	98.69
PF14634		44	zf-RING_5: zinc-RING finger domain	98.68
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	98.65
KOG0311\|consensus		381		98.64
KOG2164\|consensus		513		98.56
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	98.56
KOG2660\|consensus		331		98.43
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	98.4
KOG0978\|consensus		698		98.39
KOG4628\|consensus		348		98.17
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	98.17
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	98.09
KOG0297\|consensus		391		98.07
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	98.03
KOG0802\|consensus		543		98.0
KOG4159\|consensus		398		97.98
KOG0824\|consensus		324		97.87
COG5222		427	Uncharacterized conserved protein, contains RING Z	97.84
KOG2879\|consensus		298		97.76
KOG4172\|consensus		62		97.72
KOG1039\|consensus		344		97.58
PF00075		132	RNase_H: RNase H; InterPro: IPR002156 The RNase H	97.5
COG5152		259	Uncharacterized conserved protein, contains RING a	97.47
KOG1813\|consensus		313		97.39
KOG1002\|consensus		791		97.38
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	97.38
KOG0804\|consensus		493		97.25
PRK08719		147	ribonuclease H; Reviewed	97.17
PRK00203		150	rnhA ribonuclease H; Reviewed	97.16
KOG1645\|consensus		463		97.15
PRK06548		161	ribonuclease H; Provisional	97.14
KOG4367\|consensus		699		97.1
KOG1493\|consensus		84		97.09
COG5219		1525	Uncharacterized conserved protein, contains RING Z	97.04
COG0328		154	RnhA Ribonuclease HI [DNA replication, recombinati	96.94
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	96.91
KOG1734\|consensus		328		96.83
KOG0827\|consensus		465		96.76
KOG0828\|consensus		636		96.74
KOG1785\|consensus		563		96.72
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	96.68
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	96.61
KOG0825\|consensus		1134		96.53
KOG3002\|consensus		299		96.39
KOG4692\|consensus		489		96.32
KOG3039\|consensus		303		96.29
PF13966		86	zf-RVT: zinc-binding in reverse transcriptase	96.29
KOG1001\|consensus		674		96.26
KOG1814\|consensus		445		95.98
KOG4265\|consensus		349		95.71
PHA03096		284	p28-like protein; Provisional	95.69
KOG2930\|consensus		114		95.65
KOG4275\|consensus		350		95.36
KOG1571\|consensus		355		95.23
cd06222		130	RnaseH RNase H (RNase HI) is an endonuclease that	95.22
KOG3800\|consensus		300		95.1
KOG3039\|consensus		303		95.02
KOG4185\|consensus		296		94.94
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	94.62
KOG4739\|consensus		233		94.61
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	94.57
PF04641		260	Rtf2: Rtf2 RING-finger	94.53
KOG0826\|consensus		357		94.48
PF08746		43	zf-RING-like: RING-like domain; InterPro: IPR01485	94.44
KOG4362\|consensus		684		93.83
COG5175		480	MOT2 Transcriptional repressor [Transcription]	93.79
KOG1941\|consensus		518		92.85
KOG0298\|consensus		1394		92.35
KOG3268\|consensus		234		92.17
KOG1812\|consensus		384		92.06
KOG4445\|consensus		368		91.85
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	91.48
PF10571		26	UPF0547: Uncharacterised protein family UPF0547; I	91.35
PF02891		50	zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041	90.93
KOG3970\|consensus		299		90.92
KOG2114\|consensus		933		90.85
KOG3161\|consensus		861		90.62
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	90.48
KOG3752\|consensus		371		90.4
PF14569		80	zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A.	89.44
KOG3579\|consensus		352		89.26
PF07975		51	C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al	88.03
PHA02862		156	5L protein; Provisional	87.69
COG5220		314	TFB3 Cdk activating kinase (CAK)/RNA polymerase II	87.36
PHA02825		162	LAP/PHD finger-like protein; Provisional	87.07
COG5236		493	Uncharacterized conserved protein, contains RING Z	86.35
PF14446		54	Prok-RING_1: Prokaryotic RING finger family 1	85.28
PF10272		358	Tmpp129: Putative transmembrane protein precursor;	85.0
PF07191		70	zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807	84.23
KOG1940\|consensus		276		81.63
KOG2817\|consensus		394		81.37
KOG1952\|consensus		950		81.15
KOG1815\|consensus		444		81.11
PLN02189		1040	cellulose synthase	80.4
KOG3899\|consensus		381		80.08

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

Probab=99.49  E-value=1.3e-14  Score=93.77  Aligned_cols=39  Identities=28%  Similarity=0.840  Sum_probs=31.2

Q ss_pred             eccccccccCccccCCCCCcchHHHHHHHHhccC---Cccccc
Q psy10334         35 CFICIEKLRDTHLCPHCSKLCCLACIRQFLTEER---SQCPHC   74 (314)
Q Consensus        35 C~IC~~~~~~p~~~~~CgH~FC~~Ci~~~~~~~~---~~CP~C   74 (314)
                      ||||+++|+|||++ .|||+||++||.+||+...   ..||+|
T Consensus         1 CpiC~~~~~~Pv~l-~CGH~FC~~Cl~~~~~~~~~~~~~CP~C   42 (42)
T PF15227_consen    1 CPICLDLFKDPVSL-PCGHSFCRSCLERLWKEPSGSGFSCPEC   42 (42)
T ss_dssp             ETTTTSB-SSEEE--SSSSEEEHHHHHHHHCCSSSST---SSS
T ss_pred             CCccchhhCCcccc-CCcCHHHHHHHHHHHHccCCcCCCCcCC
Confidence            89999999999998 5999999999999998742   369988

>KOG0287\|consensus	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>KOG2177\|consensus	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>KOG0317\|consensus	Back alignment and domain information

>KOG0823\|consensus	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>KOG0320\|consensus	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0311\|consensus	Back alignment and domain information

>KOG2164\|consensus	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>KOG2660\|consensus	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG0978\|consensus	Back alignment and domain information

>KOG4628\|consensus	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0297\|consensus	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0802\|consensus	Back alignment and domain information

>KOG4159\|consensus	Back alignment and domain information

>KOG0824\|consensus	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG2879\|consensus	Back alignment and domain information

>KOG4172\|consensus	Back alignment and domain information

>KOG1039\|consensus	Back alignment and domain information

>PF00075 RNase_H: RNase H; InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>KOG1813\|consensus	Back alignment and domain information

>KOG1002\|consensus	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>KOG0804\|consensus	Back alignment and domain information

>PRK08719 ribonuclease H; Reviewed	Back alignment and domain information

>PRK00203 rnhA ribonuclease H; Reviewed	Back alignment and domain information

>KOG1645\|consensus	Back alignment and domain information

>PRK06548 ribonuclease H; Provisional	Back alignment and domain information

>KOG4367\|consensus	Back alignment and domain information

>KOG1493\|consensus	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair]	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1734\|consensus	Back alignment and domain information

>KOG0827\|consensus	Back alignment and domain information

>KOG0828\|consensus	Back alignment and domain information

>KOG1785\|consensus	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>KOG0825\|consensus	Back alignment and domain information

>KOG3002\|consensus	Back alignment and domain information

>KOG4692\|consensus	Back alignment and domain information

>KOG3039\|consensus	Back alignment and domain information

>PF13966 zf-RVT: zinc-binding in reverse transcriptase	Back alignment and domain information

>KOG1001\|consensus	Back alignment and domain information

>KOG1814\|consensus	Back alignment and domain information

>KOG4265\|consensus	Back alignment and domain information

>PHA03096 p28-like protein; Provisional	Back alignment and domain information

>KOG2930\|consensus	Back alignment and domain information

>KOG4275\|consensus	Back alignment and domain information

>KOG1571\|consensus	Back alignment and domain information

>cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner	Back alignment and domain information

>KOG3800\|consensus	Back alignment and domain information

>KOG3039\|consensus	Back alignment and domain information

>KOG4185\|consensus	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>KOG4739\|consensus	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>KOG0826\|consensus	Back alignment and domain information

>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO)	Back alignment and domain information

>KOG4362\|consensus	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>KOG0298\|consensus	Back alignment and domain information

>KOG3268\|consensus	Back alignment and domain information

>KOG1812\|consensus	Back alignment and domain information

>KOG4445\|consensus	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines	Back alignment and domain information

>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG3970\|consensus	Back alignment and domain information

>KOG2114\|consensus	Back alignment and domain information

>KOG3161\|consensus	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>KOG3752\|consensus	Back alignment and domain information

>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A	Back alignment and domain information

>KOG3579\|consensus	Back alignment and domain information

>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair	Back alignment and domain information

>PHA02862 5L protein; Provisional	Back alignment and domain information

>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PHA02825 LAP/PHD finger-like protein; Provisional	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF14446 Prok-RING_1: Prokaryotic RING finger family 1	Back alignment and domain information

>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans	Back alignment and domain information

>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length	Back alignment and domain information

>KOG1940\|consensus	Back alignment and domain information

>KOG2817\|consensus	Back alignment and domain information

>KOG1952\|consensus	Back alignment and domain information

>KOG1815\|consensus	Back alignment and domain information

>PLN02189 cellulose synthase	Back alignment and domain information

>KOG3899\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		314
3lrq_A		100	Crystal Structure Of The U-Box Domain Of Human Ubiq		2e-28
2y43_A		99	Rad18 Ubiquitin Ligase Ring Domain Structure Length		1e-05

>pdb|3LRQ|A Chain A, Crystal Structure Of The U-Box Domain Of Human Ubiquitin- Protein Ligase (E3), Northeast Structural Genomics Consortium Target Hr4604d. Length = 100

Back alignment and structure

Iteration: 1

Score = 123 bits (308), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 55/76 (72%), Positives = 65/76 (85%) Query: 28 ALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCR 87 ++AEVFRCFIC EKLRD LCPHCSKLCC +CIR++LTE+R+QCPHCRA L + +LVNCR Sbjct: 18 SIAEVFRCFICXEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCR 77 Query: 88 WMEEVTQHLDNLQMNS 103 W EEVTQ LD LQ+ S Sbjct: 78 WAEEVTQQLDTLQLCS 93

PyMOL of 3lrq

>pdb|2Y43|A Chain A, Rad18 Ubiquitin Ligase Ring Domain Structure Length = 99

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		314
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	5e-23
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	4e-17
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	7e-08
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	1e-07
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	9e-07
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	2e-06
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	2e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-05
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	7e-06
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	2e-05
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	2e-05
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	2e-05
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	2e-05
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	2e-05
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	2e-05
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	6e-05
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	2e-04
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	5e-04
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	6e-04
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	6e-04

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

 Score = 90.3 bits (224), Expect = 5e-23
 Identities = 55/84 (65%), Positives = 67/84 (79%)

Query: 23  SHVSRALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTD 82
                ++AEVFRCFIC+EKLRD  LCPHCSKLCC +CIR++LTE+R+QCPHCRA L + +
Sbjct: 13  EQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRE 72

Query: 83  LVNCRWMEEVTQHLDNLQMNSKSS 106
           LVNCRW EEVTQ LD LQ+ S + 
Sbjct: 73  LVNCRWAEEVTQQLDTLQLCSLTK 96

PyMOL of 3lrq

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		314
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	99.69
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	99.68
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	99.67
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	99.66
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	99.65
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	99.64
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	99.62
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	99.62
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	99.62
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	99.62
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	99.6
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	99.58
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	99.57
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	99.57
1z6u_A		150	NP95-like ring finger protein isoform B; structura	99.56
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	99.55
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	99.54
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	99.54
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	99.52
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	99.52
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	99.51
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	99.51
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	99.51
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	99.49
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.49
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	99.47
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	99.45
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	99.45
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	99.44
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	99.43
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	99.43
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	99.43
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	99.42
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	99.42
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	99.41
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	99.41
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	99.4
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	99.39
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	99.38
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	99.36
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	99.36
2ect_A		78	Ring finger protein 126; metal binding protein, st	99.34
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	99.29
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	99.29
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	99.27
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	99.26
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	99.26
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	99.25
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	99.25
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	99.25
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	99.22
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	99.22
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	99.2
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	99.17
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	99.13
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	99.1
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	99.06
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	99.04
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	99.01
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	98.99
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	98.99
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	98.98
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	98.98
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	98.86
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	98.77
2ea5_A		68	Cell growth regulator with ring finger domain prot	98.74
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	98.65
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	98.63
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	98.14
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	98.13
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	98.02
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	98.01
3h08_A		146	RNH (ribonuclease H); RNAse H, 3D-structure, endon	97.73
1jl1_A		155	Ribonuclease HI; RNAse HI, protein stability, ther	97.56
2e4l_A		158	Ribonuclease HI, RNAse HI; hydrolase, endoribonucl	97.5
2qkb_A		154	Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy	97.49
3qio_A		150	GAG-POL polyprotein; RNAse H, inhibitor, nuclease,	97.32
3p1g_A		165	Xenotropic murine leukemia virus-related virus (X	97.22
1ril_A		166	Ribonuclease H; hydrolase(endoribonuclease); 2.80A	97.19
3nw0_A		238	Non-structural maintenance of chromosomes element	97.19
2kq2_A		147	Ribonuclease H-related protein; PSI, NESG, protein	97.1
3m62_A		968	Ubiquitin conjugation factor E4; armadillo-like re	96.9
1mu2_A		555	HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym	96.48
2lsn_A		165	Reverse transcriptase; RNAse H, viral protein; NMR	96.4
2zd1_A		557	Reverse transcriptase/ribonuclease H; P51/P66, het	96.11
2cs3_A		93	Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s	94.15
2did_A		53	Tripartite motif protein 39; ZF-B-box domian, Zn b	92.25
3u3g_D		140	Ribonuclease H, RNAse H1; hydrolase, cleave the RN	92.01
3hst_B		141	Protein RV2228C/MT2287; ribonuclease H1, RV2228C N	91.78
1weo_A		93	Cellulose synthase, catalytic subunit (IRX3); stru	91.59
2ehg_A		149	Ribonuclease HI; RNAse HI, hyperthermophilic archa	91.35
2d8u_A		64	Ubiquitin ligase TRIM63; tripartite motif-containi	91.08
2yrg_A		59	Tripartite motif-containing protein 5; B-box domai	90.82
2csv_A		72	Tripartite motif protein 29; ZF-B_BOX domain, TRIM	90.53
3i2d_A		371	E3 SUMO-protein ligase SIZ1; signal transduction,	88.7
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	87.59
4fo9_A		360	E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom	86.5
2yvr_A		50	Transcription intermediary factor 1-beta; ZF-B_BOX	85.99
2dja_A		84	Midline-2; tripartite motif protein 1, ZF-B_BOX, s	85.31
1fre_A		42	Nuclear factor XNF7; zinc-binding protein, BBOX, d	84.18
2jmo_A		80	Parkin; IBR, E3 ligase, zinc binding domain, RBR;	81.61
2ct7_A		86	Ring finger protein 31; IBR, structural genomics,	81.12
1z60_A		59	TFIIH basal transcription factor complex P44 subun	80.99

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

Probab=99.69  E-value=6.9e-18  Score=129.70  Aligned_cols=78  Identities=69%  Similarity=1.431  Sum_probs=67.8

Q ss_pred             hHHHhccccceeccccccccCccccCCCCCcchHHHHHHHHhccCCcccccccccccchhhhhhhhHhhhhhhccccc
Q psy10334         24 HVSRALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCRWMEEVTQHLDNLQM  101 (314)
Q Consensus        24 ~~~~~~~~~~~C~IC~~~~~~p~~~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~~~~~~~~~~~~~~~~~~~~~~~l~~  101 (314)
                      .....+++++.|+||+++|.+|+++..|||.||+.||.+|+......||.||.++...++.+++.+.++++.++.+..
T Consensus        14 ~~~~~l~~~~~C~IC~~~~~~p~~~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~~~~~~~l~~~~~~~~i~~~~~~l~~   91 (100)
T 3lrq_A           14 QSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQL   91 (100)
T ss_dssp             HHHHHHHHHTBCTTTCSBCSSEEECTTTCCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCEECTTHHHHHHHHHHHCC
T ss_pred             cccccCCCCCCCccCCccccCccccCCCCChhhHHHHHHHHHHCcCCCCCCCCcCCHHHhHhhHHHHHHHHHHHHHHH
Confidence            445667889999999999999998336999999999999999743689999999999999999999999998876643

PyMOL of 3lrq

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum}	Back alignment and structure

>1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ...	Back alignment and structure

>2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A	Back alignment and structure

>2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A*	Back alignment and structure

>3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} SCOP: c.55.3.1 PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A	Back alignment and structure

>3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A 4e89_A	Back alignment and structure

>1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A	Back alignment and structure

>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A	Back alignment and structure

>1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B	Back alignment and structure

>2lsn_A Reverse transcriptase; RNAse H, viral protein; NMR {Simian foamy virus}	Back alignment and structure

>2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ...	Back alignment and structure

>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3	Back alignment and structure

>2did_A Tripartite motif protein 39; ZF-B-box domian, Zn binding, one sequence two fold, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dif_A	Back alignment and structure

>3u3g_D Ribonuclease H, RNAse H1; hydrolase, cleave the RNA strand of RNA/DNA hybrid; 1.40A {Uncultured organism}	Back alignment and structure

>3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis}	Back alignment and structure

>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1	Back alignment and structure

>2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A	Back alignment and structure

>2d8u_A Ubiquitin ligase TRIM63; tripartite motif-containing 63, muscle-specific ring finger protein 1, MURF1, ring finger protein 28; NMR {Homo sapiens} SCOP: g.43.1.1	Back alignment and structure

>2yrg_A Tripartite motif-containing protein 5; B-box domain, ring finger protein 88, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2csv_A Tripartite motif protein 29; ZF-B_BOX domain, TRIM29, ataxia-telangiectasia group D-associated protein, ATDC, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1	Back alignment and structure

>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B	Back alignment and structure

>2yvr_A Transcription intermediary factor 1-beta; ZF-B_BOX domain, structural genomics, NPPSFA; 1.80A {Homo sapiens}	Back alignment and structure

>2dja_A Midline-2; tripartite motif protein 1, ZF-B_BOX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dq5_A	Back alignment and structure

>1fre_A Nuclear factor XNF7; zinc-binding protein, BBOX, development, MID-blastula- transition; NMR {Xenopus laevis} SCOP: g.43.1.1	Back alignment and structure

>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens}	Back alignment and structure

>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4	Back alignment and structure

>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		314
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	1e-07
d1jm7b_		97	g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie	1e-07
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	8e-06
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	9e-06
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	9e-06
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	1e-05
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	1e-04
d1t1ha_		78	g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre	7e-04
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	8e-04
d2baya1		56	g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {	0.001

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 46.5 bits (110), Expect = 1e-07
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 35 CFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLV 84
          C IC E  +D  + P C  L C +C+  +   E   CP CR  +  T+ +
Sbjct: 26 CKICAENDKDVKIEP-CGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPI 74

PyMOL of d1fbva4

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		314
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	99.69
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	99.68
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	99.67
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	99.66
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	99.65
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	99.59
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	99.57
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	99.44
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	99.41
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	99.39
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	99.38
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	99.36
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	99.35
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	98.99
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	98.96
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	98.9
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	98.41
d1jl1a_		152	RNase H (RNase HI) {Escherichia coli [TaxId: 562]}	97.95
d1mu2a1		126	HIV RNase H (Domain of reverse transcriptase) {Hum	97.89
d1rila_		147	RNase H (RNase HI) {Thermus thermophilus [TaxId: 2	97.62
d2cs3a1		80	Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [	94.52
d1weoa_		93	Cellulose synthase A catalytic subunit 7, IRX3 {Th	92.64
d1frea_		39	Nuclear factor XNF7 {African clawed frog (Xenopus	91.81
d1z60a1		59	TFIIH p44 subunit cysteine-rich domain {Human (Hom	90.31
d2dida1		40	Tripartite motif-containing protein 39 {Human (Hom	90.13
d2csva1		59	Tripartite motif-containing protein 29 {Human (Hom	90.12
d2d8ua1		51	Ubiquitin ligase trim63 {Human (Homo sapiens) [Tax	80.87

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.69  E-value=4.3e-18  Score=123.68  Aligned_cols=69  Identities=17%  Similarity=0.146  Sum_probs=61.8

Q ss_pred             hccccceeccccccccCccccCCCCCcchHHHHHHHHhccCCcccccccccccchhhhhhhhHhhhhhhc
Q psy10334         28 ALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCRWMEEVTQHLD   97 (314)
Q Consensus        28 ~~~~~~~C~IC~~~~~~p~~~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~~~~~~~~~~~~~~~~~~~~~~   97 (314)
                      ++.++|.||||+++|+|||++ .|||+||+.||.+|+......||.||.++...++.+|..|.++++.+.
T Consensus         3 eiP~~l~CpIc~~l~~dPv~~-~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~~~~l~pN~~L~~~I~~~l   71 (80)
T d2c2la2           3 DIPDYLCGKISFELMREPCIT-PSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFI   71 (80)
T ss_dssp             CCCSTTBCTTTCSBCSSEEEC-SSCCEEETTHHHHHHHHTCSSCTTTCCCCCGGGCEECHHHHHHHHHHH
T ss_pred             CCCccccCcCcCchhhhhccc-CCcCeecHHHHHHHHhcCCccCCCccccccccccccHHHHHHHHHHHH
Confidence            356889999999999999997 599999999999999865567999999999999999999988888764

PyMOL of d2c2la2

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]}	Back information, alignment and structure

>d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]}	Back information, alignment and structure

>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2d8ua1 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure