Psyllid ID: psy10334
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 314 | ||||||
| 322796557 | 1087 | hypothetical protein SINV_07059 [Solenop | 0.254 | 0.073 | 0.762 | 7e-31 | |
| 307179558 | 1099 | Tripartite motif-containing protein 37 [ | 0.245 | 0.070 | 0.779 | 7e-31 | |
| 307205392 | 1090 | Tripartite motif-containing protein 37 [ | 0.245 | 0.070 | 0.779 | 1e-30 | |
| 332020273 | 1116 | E3 ubiquitin-protein ligase TRIM37 [Acro | 0.245 | 0.068 | 0.779 | 1e-30 | |
| 91095417 | 884 | PREDICTED: similar to tripartite motif-c | 0.229 | 0.081 | 0.819 | 2e-30 | |
| 383857056 | 1033 | PREDICTED: uncharacterized protein LOC10 | 0.257 | 0.078 | 0.740 | 2e-30 | |
| 270016968 | 852 | hypothetical protein TcasGA2_TC010300 [T | 0.229 | 0.084 | 0.819 | 2e-30 | |
| 242006926 | 825 | tripartite motif-containing protein, put | 0.261 | 0.099 | 0.719 | 3e-30 | |
| 345481792 | 1052 | PREDICTED: hypothetical protein LOC10012 | 0.245 | 0.073 | 0.753 | 5e-30 | |
| 326931489 | 1029 | PREDICTED: e3 ubiquitin-protein ligase T | 0.321 | 0.098 | 0.578 | 1e-28 |
| >gi|322796557|gb|EFZ19031.1| hypothetical protein SINV_07059 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 140 bits (353), Expect = 7e-31, Method: Compositional matrix adjust.
Identities = 61/80 (76%), Positives = 68/80 (85%)
Query: 21 TTSHVSRALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHM 80
T H LAEVFRCFIC+EKLRD HLCPHCSKLCC CIR++LTE+RSQCPHCRASLH+
Sbjct: 13 TDDHSVETLAEVFRCFICMEKLRDAHLCPHCSKLCCYTCIRRWLTEQRSQCPHCRASLHL 72
Query: 81 TDLVNCRWMEEVTQHLDNLQ 100
+LVNCRW+EEVTQ LD LQ
Sbjct: 73 HELVNCRWVEEVTQQLDTLQ 92
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307179558|gb|EFN67872.1| Tripartite motif-containing protein 37 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307205392|gb|EFN83733.1| Tripartite motif-containing protein 37 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332020273|gb|EGI60707.1| E3 ubiquitin-protein ligase TRIM37 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|91095417|ref|XP_972942.1| PREDICTED: similar to tripartite motif-containing 37 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383857056|ref|XP_003704022.1| PREDICTED: uncharacterized protein LOC100879152 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|270016968|gb|EFA13414.1| hypothetical protein TcasGA2_TC010300 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242006926|ref|XP_002424293.1| tripartite motif-containing protein, putative [Pediculus humanus corporis] gi|212507693|gb|EEB11555.1| tripartite motif-containing protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|345481792|ref|XP_001604793.2| PREDICTED: hypothetical protein LOC100121202 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|326931489|ref|XP_003211861.1| PREDICTED: e3 ubiquitin-protein ligase TRIM37-like [Meleagris gallopavo] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 314 | ||||||
| UNIPROTKB|J3QRK3 | 103 | TRIM37 "E3 ubiquitin-protein l | 0.242 | 0.737 | 0.723 | 1e-29 | |
| UNIPROTKB|J3QSH5 | 113 | TRIM37 "E3 ubiquitin-protein l | 0.242 | 0.672 | 0.723 | 1e-29 | |
| UNIPROTKB|F1S260 | 340 | LOC100739276 "Uncharacterized | 0.242 | 0.223 | 0.723 | 1e-29 | |
| UNIPROTKB|E1BGD4 | 961 | TRIM37 "Uncharacterized protei | 0.242 | 0.079 | 0.723 | 1.6e-28 | |
| MGI|MGI:2153072 | 961 | Trim37 "tripartite motif-conta | 0.242 | 0.079 | 0.723 | 1.6e-28 | |
| UNIPROTKB|E2RKB8 | 962 | TRIM37 "Uncharacterized protei | 0.242 | 0.079 | 0.723 | 1.6e-28 | |
| UNIPROTKB|F1PKZ8 | 962 | TRIM37 "Uncharacterized protei | 0.242 | 0.079 | 0.723 | 1.6e-28 | |
| UNIPROTKB|O94972 | 964 | TRIM37 "E3 ubiquitin-protein l | 0.242 | 0.078 | 0.723 | 1.6e-28 | |
| ZFIN|ZDB-GENE-030131-2957 | 957 | trim37 "tripartite motif conta | 0.235 | 0.077 | 0.729 | 2e-28 | |
| UNIPROTKB|F1NYX7 | 983 | TRIM37 "Uncharacterized protei | 0.235 | 0.075 | 0.729 | 2.1e-28 |
| UNIPROTKB|J3QRK3 TRIM37 "E3 ubiquitin-protein ligase TRIM37" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 329 (120.9 bits), Expect = 1.0e-29, P = 1.0e-29
Identities = 55/76 (72%), Positives = 66/76 (86%)
Query: 28 ALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCR 87
++AEVFRCFIC+EKLRD LCPHCSKLCC +CIR++LTE+R+QCPHCRA L + +LVNCR
Sbjct: 8 SIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCR 67
Query: 88 WMEEVTQHLDNLQMNS 103
W EEVTQ LD LQ+ S
Sbjct: 68 WAEEVTQQLDTLQLCS 83
|
|
| UNIPROTKB|J3QSH5 TRIM37 "E3 ubiquitin-protein ligase TRIM37" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S260 LOC100739276 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BGD4 TRIM37 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2153072 Trim37 "tripartite motif-containing 37" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RKB8 TRIM37 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PKZ8 TRIM37 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O94972 TRIM37 "E3 ubiquitin-protein ligase TRIM37" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-2957 trim37 "tripartite motif containing 37" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NYX7 TRIM37 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 314 | |||
| cd09276 | 128 | cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI dom | 7e-11 | |
| pfam00075 | 126 | pfam00075, RNase_H, RNase H | 2e-07 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 3e-05 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 5e-05 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 0.001 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 0.004 |
| >gnl|CDD|187700 cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI domain of reverse transcriptases | Back alignment and domain information |
|---|
Score = 58.4 bits (142), Expect = 7e-11
Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
Query: 103 SKSSLQTYQRLFPNSTLCLNVKNLLSELKLKYGLSIKLVWIPGHMNISGNCAVDLAAKQA 162
S+++L+ + +S L L ++ + EL G+ ++L W+PGH I GN D AK+A
Sbjct: 68 SQAALKALRSPRSSSPLVLRIRKAIRELANH-GVKVRLHWVPGHSGIEGNERADRLAKEA 126
|
Ribonuclease H (RNase H) is classified into two families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). Ribonuclease HI (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes. RNase HI has also been observed as an adjunct domain to the reverse transcriptase gene in retroviruses, long-term repeat (LTR)-bearing retrotransposons and non-LTR retrotransposons. RNase HI in LTR retrotransposons perform degradation of the original RNA template, generation of a polypurine tract (the primer for plus-strand DNA synthesis), and final removal of RNA primers from newly synthesized minus and plus strands. The catalytic residues for RNase H enzymatic activity, three aspartatic acids and one glutamatic acid residue (DEDD), are unvaried across all RNase H domains. The position of the RNase domain of non-LTR and LTR transposons is at the carboxyl terminal of the reverse transcriptase (RT) domain and their RNase domains group together, indicating a common evolutionary origin. Many non-LTR transposons have lost the RNase domain because their activity is at the nucleus and cellular RNase may suffice; however LTR retotransposons always encode their own RNase domain because it requires RNase activity in RNA-protein particles in the cytoplasm. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription. Length = 128 |
| >gnl|CDD|215695 pfam00075, RNase_H, RNase H | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 314 | |||
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.49 | |
| KOG0287|consensus | 442 | 99.47 | ||
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 99.42 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.42 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.41 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.34 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.32 | |
| KOG2177|consensus | 386 | 99.31 | ||
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 99.26 | |
| KOG0317|consensus | 293 | 99.25 | ||
| KOG0823|consensus | 230 | 99.24 | ||
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 99.14 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.1 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 99.09 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.07 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.07 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 99.03 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 99.01 | |
| KOG0320|consensus | 187 | 98.98 | ||
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.84 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.8 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.69 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.68 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.65 | |
| KOG0311|consensus | 381 | 98.64 | ||
| KOG2164|consensus | 513 | 98.56 | ||
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.56 | |
| KOG2660|consensus | 331 | 98.43 | ||
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.4 | |
| KOG0978|consensus | 698 | 98.39 | ||
| KOG4628|consensus | 348 | 98.17 | ||
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 98.17 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.09 | |
| KOG0297|consensus | 391 | 98.07 | ||
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.03 | |
| KOG0802|consensus | 543 | 98.0 | ||
| KOG4159|consensus | 398 | 97.98 | ||
| KOG0824|consensus | 324 | 97.87 | ||
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.84 | |
| KOG2879|consensus | 298 | 97.76 | ||
| KOG4172|consensus | 62 | 97.72 | ||
| KOG1039|consensus | 344 | 97.58 | ||
| PF00075 | 132 | RNase_H: RNase H; InterPro: IPR002156 The RNase H | 97.5 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.47 | |
| KOG1813|consensus | 313 | 97.39 | ||
| KOG1002|consensus | 791 | 97.38 | ||
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 97.38 | |
| KOG0804|consensus | 493 | 97.25 | ||
| PRK08719 | 147 | ribonuclease H; Reviewed | 97.17 | |
| PRK00203 | 150 | rnhA ribonuclease H; Reviewed | 97.16 | |
| KOG1645|consensus | 463 | 97.15 | ||
| PRK06548 | 161 | ribonuclease H; Provisional | 97.14 | |
| KOG4367|consensus | 699 | 97.1 | ||
| KOG1493|consensus | 84 | 97.09 | ||
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 97.04 | |
| COG0328 | 154 | RnhA Ribonuclease HI [DNA replication, recombinati | 96.94 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 96.91 | |
| KOG1734|consensus | 328 | 96.83 | ||
| KOG0827|consensus | 465 | 96.76 | ||
| KOG0828|consensus | 636 | 96.74 | ||
| KOG1785|consensus | 563 | 96.72 | ||
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 96.68 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 96.61 | |
| KOG0825|consensus | 1134 | 96.53 | ||
| KOG3002|consensus | 299 | 96.39 | ||
| KOG4692|consensus | 489 | 96.32 | ||
| KOG3039|consensus | 303 | 96.29 | ||
| PF13966 | 86 | zf-RVT: zinc-binding in reverse transcriptase | 96.29 | |
| KOG1001|consensus | 674 | 96.26 | ||
| KOG1814|consensus | 445 | 95.98 | ||
| KOG4265|consensus | 349 | 95.71 | ||
| PHA03096 | 284 | p28-like protein; Provisional | 95.69 | |
| KOG2930|consensus | 114 | 95.65 | ||
| KOG4275|consensus | 350 | 95.36 | ||
| KOG1571|consensus | 355 | 95.23 | ||
| cd06222 | 130 | RnaseH RNase H (RNase HI) is an endonuclease that | 95.22 | |
| KOG3800|consensus | 300 | 95.1 | ||
| KOG3039|consensus | 303 | 95.02 | ||
| KOG4185|consensus | 296 | 94.94 | ||
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 94.62 | |
| KOG4739|consensus | 233 | 94.61 | ||
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 94.57 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.53 | |
| KOG0826|consensus | 357 | 94.48 | ||
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 94.44 | |
| KOG4362|consensus | 684 | 93.83 | ||
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 93.79 | |
| KOG1941|consensus | 518 | 92.85 | ||
| KOG0298|consensus | 1394 | 92.35 | ||
| KOG3268|consensus | 234 | 92.17 | ||
| KOG1812|consensus | 384 | 92.06 | ||
| KOG4445|consensus | 368 | 91.85 | ||
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 91.48 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 91.35 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 90.93 | |
| KOG3970|consensus | 299 | 90.92 | ||
| KOG2114|consensus | 933 | 90.85 | ||
| KOG3161|consensus | 861 | 90.62 | ||
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 90.48 | |
| KOG3752|consensus | 371 | 90.4 | ||
| PF14569 | 80 | zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. | 89.44 | |
| KOG3579|consensus | 352 | 89.26 | ||
| PF07975 | 51 | C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al | 88.03 | |
| PHA02862 | 156 | 5L protein; Provisional | 87.69 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 87.36 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 87.07 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 86.35 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 85.28 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 85.0 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 84.23 | |
| KOG1940|consensus | 276 | 81.63 | ||
| KOG2817|consensus | 394 | 81.37 | ||
| KOG1952|consensus | 950 | 81.15 | ||
| KOG1815|consensus | 444 | 81.11 | ||
| PLN02189 | 1040 | cellulose synthase | 80.4 | |
| KOG3899|consensus | 381 | 80.08 |
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
Probab=99.49 E-value=1.3e-14 Score=93.77 Aligned_cols=39 Identities=28% Similarity=0.840 Sum_probs=31.2
Q ss_pred eccccccccCccccCCCCCcchHHHHHHHHhccC---Cccccc
Q psy10334 35 CFICIEKLRDTHLCPHCSKLCCLACIRQFLTEER---SQCPHC 74 (314)
Q Consensus 35 C~IC~~~~~~p~~~~~CgH~FC~~Ci~~~~~~~~---~~CP~C 74 (314)
||||+++|+|||++ .|||+||++||.+||+... ..||+|
T Consensus 1 CpiC~~~~~~Pv~l-~CGH~FC~~Cl~~~~~~~~~~~~~CP~C 42 (42)
T PF15227_consen 1 CPICLDLFKDPVSL-PCGHSFCRSCLERLWKEPSGSGFSCPEC 42 (42)
T ss_dssp ETTTTSB-SSEEE--SSSSEEEHHHHHHHHCCSSSST---SSS
T ss_pred CCccchhhCCcccc-CCcCHHHHHHHHHHHHccCCcCCCCcCC
Confidence 89999999999998 5999999999999998742 369988
|
|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >PF00075 RNase_H: RNase H; InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >PRK08719 ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >PRK00203 rnhA ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >PRK06548 ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >KOG1493|consensus | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG3002|consensus | Back alignment and domain information |
|---|
| >KOG4692|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >PF13966 zf-RVT: zinc-binding in reverse transcriptase | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >KOG1814|consensus | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2930|consensus | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner | Back alignment and domain information |
|---|
| >KOG3800|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG0826|consensus | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG4362|consensus | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1941|consensus | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >KOG3268|consensus | Back alignment and domain information |
|---|
| >KOG1812|consensus | Back alignment and domain information |
|---|
| >KOG4445|consensus | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3970|consensus | Back alignment and domain information |
|---|
| >KOG2114|consensus | Back alignment and domain information |
|---|
| >KOG3161|consensus | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG3752|consensus | Back alignment and domain information |
|---|
| >PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A | Back alignment and domain information |
|---|
| >KOG3579|consensus | Back alignment and domain information |
|---|
| >PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >KOG1940|consensus | Back alignment and domain information |
|---|
| >KOG2817|consensus | Back alignment and domain information |
|---|
| >KOG1952|consensus | Back alignment and domain information |
|---|
| >KOG1815|consensus | Back alignment and domain information |
|---|
| >PLN02189 cellulose synthase | Back alignment and domain information |
|---|
| >KOG3899|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 314 | ||||
| 3lrq_A | 100 | Crystal Structure Of The U-Box Domain Of Human Ubiq | 2e-28 | ||
| 2y43_A | 99 | Rad18 Ubiquitin Ligase Ring Domain Structure Length | 1e-05 |
| >pdb|3LRQ|A Chain A, Crystal Structure Of The U-Box Domain Of Human Ubiquitin- Protein Ligase (E3), Northeast Structural Genomics Consortium Target Hr4604d. Length = 100 | Back alignment and structure |
|
| >pdb|2Y43|A Chain A, Rad18 Ubiquitin Ligase Ring Domain Structure Length = 99 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 314 | |||
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 5e-23 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 4e-17 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 7e-08 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 1e-07 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 9e-07 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 2e-06 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 7e-06 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 2e-05 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 2e-05 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 2e-05 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 2e-05 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 2e-05 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 2e-05 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 6e-05 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 2e-04 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 5e-04 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 6e-04 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 6e-04 |
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
Score = 90.3 bits (224), Expect = 5e-23
Identities = 55/84 (65%), Positives = 67/84 (79%)
Query: 23 SHVSRALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTD 82
++AEVFRCFIC+EKLRD LCPHCSKLCC +CIR++LTE+R+QCPHCRA L + +
Sbjct: 13 EQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRE 72
Query: 83 LVNCRWMEEVTQHLDNLQMNSKSS 106
LVNCRW EEVTQ LD LQ+ S +
Sbjct: 73 LVNCRWAEEVTQQLDTLQLCSLTK 96
|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 314 | |||
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.69 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.68 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.67 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.66 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.65 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.64 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.62 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.62 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.62 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.62 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.6 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.58 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.57 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.57 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.56 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.55 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.54 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.54 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.52 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.52 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.51 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.51 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.51 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.49 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.49 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.47 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.45 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.45 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.44 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.43 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.43 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.43 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.42 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.42 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.41 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.41 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.4 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.39 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.38 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.36 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.36 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.34 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.29 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.29 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.27 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.26 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.26 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.25 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.25 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.25 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.22 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.22 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.2 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.17 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 99.13 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.1 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.06 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 99.04 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.01 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.99 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.99 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.98 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.98 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.86 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.77 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.74 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.65 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.63 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 98.14 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.13 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.02 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.01 | |
| 3h08_A | 146 | RNH (ribonuclease H); RNAse H, 3D-structure, endon | 97.73 | |
| 1jl1_A | 155 | Ribonuclease HI; RNAse HI, protein stability, ther | 97.56 | |
| 2e4l_A | 158 | Ribonuclease HI, RNAse HI; hydrolase, endoribonucl | 97.5 | |
| 2qkb_A | 154 | Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy | 97.49 | |
| 3qio_A | 150 | GAG-POL polyprotein; RNAse H, inhibitor, nuclease, | 97.32 | |
| 3p1g_A | 165 | Xenotropic murine leukemia virus-related virus (X | 97.22 | |
| 1ril_A | 166 | Ribonuclease H; hydrolase(endoribonuclease); 2.80A | 97.19 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 97.19 | |
| 2kq2_A | 147 | Ribonuclease H-related protein; PSI, NESG, protein | 97.1 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 96.9 | |
| 1mu2_A | 555 | HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym | 96.48 | |
| 2lsn_A | 165 | Reverse transcriptase; RNAse H, viral protein; NMR | 96.4 | |
| 2zd1_A | 557 | Reverse transcriptase/ribonuclease H; P51/P66, het | 96.11 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 94.15 | |
| 2did_A | 53 | Tripartite motif protein 39; ZF-B-box domian, Zn b | 92.25 | |
| 3u3g_D | 140 | Ribonuclease H, RNAse H1; hydrolase, cleave the RN | 92.01 | |
| 3hst_B | 141 | Protein RV2228C/MT2287; ribonuclease H1, RV2228C N | 91.78 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 91.59 | |
| 2ehg_A | 149 | Ribonuclease HI; RNAse HI, hyperthermophilic archa | 91.35 | |
| 2d8u_A | 64 | Ubiquitin ligase TRIM63; tripartite motif-containi | 91.08 | |
| 2yrg_A | 59 | Tripartite motif-containing protein 5; B-box domai | 90.82 | |
| 2csv_A | 72 | Tripartite motif protein 29; ZF-B_BOX domain, TRIM | 90.53 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 88.7 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 87.59 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 86.5 | |
| 2yvr_A | 50 | Transcription intermediary factor 1-beta; ZF-B_BOX | 85.99 | |
| 2dja_A | 84 | Midline-2; tripartite motif protein 1, ZF-B_BOX, s | 85.31 | |
| 1fre_A | 42 | Nuclear factor XNF7; zinc-binding protein, BBOX, d | 84.18 | |
| 2jmo_A | 80 | Parkin; IBR, E3 ligase, zinc binding domain, RBR; | 81.61 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 81.12 | |
| 1z60_A | 59 | TFIIH basal transcription factor complex P44 subun | 80.99 |
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.69 E-value=6.9e-18 Score=129.70 Aligned_cols=78 Identities=69% Similarity=1.431 Sum_probs=67.8
Q ss_pred hHHHhccccceeccccccccCccccCCCCCcchHHHHHHHHhccCCcccccccccccchhhhhhhhHhhhhhhccccc
Q psy10334 24 HVSRALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCRWMEEVTQHLDNLQM 101 (314)
Q Consensus 24 ~~~~~~~~~~~C~IC~~~~~~p~~~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~~~~~~~~~~~~~~~~~~~~~~~l~~ 101 (314)
.....+++++.|+||+++|.+|+++..|||.||+.||.+|+......||.||.++...++.+++.+.++++.++.+..
T Consensus 14 ~~~~~l~~~~~C~IC~~~~~~p~~~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~~~~~~~l~~~~~~~~i~~~~~~l~~ 91 (100)
T 3lrq_A 14 QSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLRELVNCRWAEEVTQQLDTLQL 91 (100)
T ss_dssp HHHHHHHHHTBCTTTCSBCSSEEECTTTCCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCEECTTHHHHHHHHHHHCC
T ss_pred cccccCCCCCCCccCCccccCccccCCCCChhhHHHHHHHHHHCcCCCCCCCCcCCHHHhHhhHHHHHHHHHHHHHHH
Confidence 445667889999999999999998336999999999999999743689999999999999999999999998876643
|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ... | Back alignment and structure |
|---|
| >2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A | Back alignment and structure |
|---|
| >2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* | Back alignment and structure |
|---|
| >3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} SCOP: c.55.3.1 PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A | Back alignment and structure |
|---|
| >3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A 4e89_A | Back alignment and structure |
|---|
| >1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B | Back alignment and structure |
|---|
| >2lsn_A Reverse transcriptase; RNAse H, viral protein; NMR {Simian foamy virus} | Back alignment and structure |
|---|
| >2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2did_A Tripartite motif protein 39; ZF-B-box domian, Zn binding, one sequence two fold, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dif_A | Back alignment and structure |
|---|
| >3u3g_D Ribonuclease H, RNAse H1; hydrolase, cleave the RNA strand of RNA/DNA hybrid; 1.40A {Uncultured organism} | Back alignment and structure |
|---|
| >3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A | Back alignment and structure |
|---|
| >2d8u_A Ubiquitin ligase TRIM63; tripartite motif-containing 63, muscle-specific ring finger protein 1, MURF1, ring finger protein 28; NMR {Homo sapiens} SCOP: g.43.1.1 | Back alignment and structure |
|---|
| >2yrg_A Tripartite motif-containing protein 5; B-box domain, ring finger protein 88, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csv_A Tripartite motif protein 29; ZF-B_BOX domain, TRIM29, ataxia-telangiectasia group D-associated protein, ATDC, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >2yvr_A Transcription intermediary factor 1-beta; ZF-B_BOX domain, structural genomics, NPPSFA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dja_A Midline-2; tripartite motif protein 1, ZF-B_BOX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dq5_A | Back alignment and structure |
|---|
| >1fre_A Nuclear factor XNF7; zinc-binding protein, BBOX, development, MID-blastula- transition; NMR {Xenopus laevis} SCOP: g.43.1.1 | Back alignment and structure |
|---|
| >2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 314 | ||||
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 1e-07 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 1e-07 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 8e-06 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 9e-06 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 9e-06 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-05 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-04 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 7e-04 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 8e-04 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 0.001 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Score = 46.5 bits (110), Expect = 1e-07
Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
Query: 35 CFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLV 84
C IC E +D + P C L C +C+ + E CP CR + T+ +
Sbjct: 26 CKICAENDKDVKIEP-CGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPI 74
|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 314 | |||
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.69 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.68 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.67 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.66 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.65 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.59 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.57 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.41 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.39 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.38 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.36 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.35 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.99 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.96 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.9 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.41 | |
| d1jl1a_ | 152 | RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | 97.95 | |
| d1mu2a1 | 126 | HIV RNase H (Domain of reverse transcriptase) {Hum | 97.89 | |
| d1rila_ | 147 | RNase H (RNase HI) {Thermus thermophilus [TaxId: 2 | 97.62 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 94.52 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 92.64 | |
| d1frea_ | 39 | Nuclear factor XNF7 {African clawed frog (Xenopus | 91.81 | |
| d1z60a1 | 59 | TFIIH p44 subunit cysteine-rich domain {Human (Hom | 90.31 | |
| d2dida1 | 40 | Tripartite motif-containing protein 39 {Human (Hom | 90.13 | |
| d2csva1 | 59 | Tripartite motif-containing protein 29 {Human (Hom | 90.12 | |
| d2d8ua1 | 51 | Ubiquitin ligase trim63 {Human (Homo sapiens) [Tax | 80.87 |
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.69 E-value=4.3e-18 Score=123.68 Aligned_cols=69 Identities=17% Similarity=0.146 Sum_probs=61.8
Q ss_pred hccccceeccccccccCccccCCCCCcchHHHHHHHHhccCCcccccccccccchhhhhhhhHhhhhhhc
Q psy10334 28 ALAEVFRCFICIEKLRDTHLCPHCSKLCCLACIRQFLTEERSQCPHCRASLHMTDLVNCRWMEEVTQHLD 97 (314)
Q Consensus 28 ~~~~~~~C~IC~~~~~~p~~~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~~~~~~~~~~~~~~~~~~~~~~ 97 (314)
++.++|.||||+++|+|||++ .|||+||+.||.+|+......||.||.++...++.+|..|.++++.+.
T Consensus 3 eiP~~l~CpIc~~l~~dPv~~-~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~~~~l~pN~~L~~~I~~~l 71 (80)
T d2c2la2 3 DIPDYLCGKISFELMREPCIT-PSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFI 71 (80)
T ss_dssp CCCSTTBCTTTCSBCSSEEEC-SSCCEEETTHHHHHHHHTCSSCTTTCCCCCGGGCEECHHHHHHHHHHH
T ss_pred CCCccccCcCcCchhhhhccc-CCcCeecHHHHHHHHhcCCccCCCccccccccccccHHHHHHHHHHHH
Confidence 356889999999999999997 599999999999999865567999999999999999999988888764
|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ua1 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|