Psyllid ID: psy10347
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 67 | ||||||
| 242021051 | 671 | conserved hypothetical protein [Pediculu | 0.626 | 0.062 | 0.952 | 6e-15 | |
| 389614612 | 304 | tango protein [Papilio polytes] | 0.626 | 0.138 | 0.952 | 8e-15 | |
| 345481068 | 690 | PREDICTED: aryl hydrocarbon receptor nuc | 0.626 | 0.060 | 0.952 | 1e-14 | |
| 332018235 | 612 | Aryl hydrocarbon receptor nuclear transl | 0.776 | 0.084 | 0.788 | 1e-14 | |
| 383856080 | 668 | PREDICTED: aryl hydrocarbon receptor nuc | 0.626 | 0.062 | 0.928 | 1e-14 | |
| 427794165 | 700 | Putative tango, partial [Rhipicephalus p | 0.626 | 0.06 | 0.928 | 1e-14 | |
| 357628246 | 641 | putative arylhydrocarbon receptor nuclea | 0.626 | 0.065 | 0.952 | 1e-14 | |
| 189233619 | 661 | PREDICTED: similar to arylhydrocarbon re | 0.626 | 0.063 | 0.952 | 1e-14 | |
| 307168322 | 612 | Aryl hydrocarbon receptor nuclear transl | 0.626 | 0.068 | 0.952 | 1e-14 | |
| 270014664 | 679 | hypothetical protein TcasGA2_TC004710 [T | 0.626 | 0.061 | 0.952 | 1e-14 |
| >gi|242021051|ref|XP_002430960.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516180|gb|EEB18222.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 84.7 bits (208), Expect = 6e-15, Method: Composition-based stats.
Identities = 40/42 (95%), Positives = 40/42 (95%)
Query: 1 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTA 42
MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALR T
Sbjct: 87 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRGTG 128
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|389614612|dbj|BAM20342.1| tango protein [Papilio polytes] | Back alignment and taxonomy information |
|---|
| >gi|345481068|ref|XP_001605013.2| PREDICTED: aryl hydrocarbon receptor nuclear translocator homolog [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332018235|gb|EGI58840.1| Aryl hydrocarbon receptor nuclear translocator-like protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|383856080|ref|XP_003703538.1| PREDICTED: aryl hydrocarbon receptor nuclear translocator homolog [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|427794165|gb|JAA62534.1| Putative tango, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|357628246|gb|EHJ77636.1| putative arylhydrocarbon receptor nuclear translocator-like protein b [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|189233619|ref|XP_970422.2| PREDICTED: similar to arylhydrocarbon receptor nuclear translocator homolog b [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307168322|gb|EFN61528.1| Aryl hydrocarbon receptor nuclear translocator-like protein [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|270014664|gb|EFA11112.1| hypothetical protein TcasGA2_TC004710 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 67 | ||||||
| UNIPROTKB|K7GSB9 | 133 | ARNT "Uncharacterized protein" | 0.656 | 0.330 | 0.888 | 4.2e-15 | |
| FB|FBgn0264075 | 642 | tgo "tango" [Drosophila melano | 0.656 | 0.068 | 0.933 | 1.1e-14 | |
| UNIPROTKB|K7GQY6 | 347 | ARNT "Uncharacterized protein" | 0.656 | 0.126 | 0.888 | 1.1e-14 | |
| UNIPROTKB|A6NGV6 | 416 | ARNT "Aryl hydrocarbon recepto | 0.656 | 0.105 | 0.888 | 2e-14 | |
| UNIPROTKB|G3N3F0 | 207 | G3N3F0 "Uncharacterized protei | 0.611 | 0.198 | 0.878 | 3.8e-14 | |
| UNIPROTKB|F1RIF2 | 208 | ARNT2 "Uncharacterized protein | 0.611 | 0.197 | 0.878 | 3.8e-14 | |
| UNIPROTKB|F6V057 | 781 | ARNT "Uncharacterized protein" | 0.656 | 0.056 | 0.888 | 6.6e-14 | |
| UNIPROTKB|F1SS94 | 781 | ARNT "Uncharacterized protein" | 0.656 | 0.056 | 0.888 | 6.6e-14 | |
| UNIPROTKB|F1MYI1 | 782 | ARNT "Aryl hydrocarbon recepto | 0.656 | 0.056 | 0.888 | 6.7e-14 | |
| UNIPROTKB|E9PTS2 | 785 | Arnt "Aryl hydrocarbon recepto | 0.656 | 0.056 | 0.888 | 6.7e-14 |
| UNIPROTKB|K7GSB9 ARNT "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 191 (72.3 bits), Expect = 4.2e-15, P = 4.2e-15
Identities = 40/45 (88%), Positives = 42/45 (93%)
Query: 1 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTAVNT 45
MTAYITELSDMVPTCSALARKPDKLTILRMAV+HMK+LR T NT
Sbjct: 82 MTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTG-NT 125
|
|
| FB|FBgn0264075 tgo "tango" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GQY6 ARNT "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6NGV6 ARNT "Aryl hydrocarbon receptor nuclear translocator" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N3F0 G3N3F0 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RIF2 ARNT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6V057 ARNT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SS94 ARNT "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MYI1 ARNT "Aryl hydrocarbon receptor nuclear translocator" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PTS2 Arnt "Aryl hydrocarbon receptor nuclear translocator" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 67 | |||
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 6e-07 | |
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 2e-05 | |
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 2e-05 |
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
Score = 41.1 bits (97), Expect = 6e-07
Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
Query: 1 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALR 39
+ EL ++PT +K K ILR+A+ ++K+L+
Sbjct: 11 INEAFDELRSLLPTLPK-NKKLSKAEILRLAIEYIKSLQ 48
|
Length = 53 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 67 | |||
| KOG3561|consensus | 803 | 99.62 | ||
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 98.99 | |
| smart00353 | 53 | HLH helix loop helix domain. | 98.96 | |
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 98.93 | |
| KOG3560|consensus | 712 | 98.77 | ||
| KOG4029|consensus | 228 | 97.56 | ||
| KOG3558|consensus | 768 | 97.55 | ||
| KOG4304|consensus | 250 | 97.31 | ||
| KOG1318|consensus | 411 | 97.06 | ||
| KOG3898|consensus | 254 | 96.07 | ||
| KOG3559|consensus | 598 | 96.01 | ||
| KOG4395|consensus | 285 | 95.35 | ||
| KOG3960|consensus | 284 | 92.1 | ||
| KOG1319|consensus | 229 | 91.89 | ||
| KOG2588|consensus | 953 | 86.37 |
| >KOG3561|consensus | Back alignment and domain information |
|---|
Probab=99.62 E-value=2.5e-16 Score=130.41 Aligned_cols=41 Identities=59% Similarity=0.953 Sum_probs=40.1
Q ss_pred ChHHHHHHHhcCCCCCccCCCCcHHHHHHHHHHHHHHhhhc
Q psy10347 1 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVT 41 (67)
Q Consensus 1 mN~~I~ELssMVP~c~~~~RKLDKLTVLRmAV~hLk~lrg~ 41 (67)
||.||+|||+|||.|..++|||||+|||||||+|||.+||.
T Consensus 35 ~N~yI~ELs~Mvp~~~~~~RK~DK~tVLr~aV~~lr~~k~~ 75 (803)
T KOG3561|consen 35 MNKYIEELSEMVPTNASLSRKPDKLTVLRMAVDHLRLIKEQ 75 (803)
T ss_pred HHHHHHHHHHhhhcchhcccCchHHHHHHHHHHHHHHHhhh
Confidence 79999999999999999999999999999999999999996
|
|
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >KOG3560|consensus | Back alignment and domain information |
|---|
| >KOG4029|consensus | Back alignment and domain information |
|---|
| >KOG3558|consensus | Back alignment and domain information |
|---|
| >KOG4304|consensus | Back alignment and domain information |
|---|
| >KOG1318|consensus | Back alignment and domain information |
|---|
| >KOG3898|consensus | Back alignment and domain information |
|---|
| >KOG3559|consensus | Back alignment and domain information |
|---|
| >KOG4395|consensus | Back alignment and domain information |
|---|
| >KOG3960|consensus | Back alignment and domain information |
|---|
| >KOG1319|consensus | Back alignment and domain information |
|---|
| >KOG2588|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 67 | ||||
| 4f3l_B | 387 | Crystal Structure Of The Heterodimeric Clock:bmal1 | 6e-10 | ||
| 4h10_A | 73 | Intermolecular Recognition Revealed By The Complex | 1e-09 |
| >pdb|4F3L|B Chain B, Crystal Structure Of The Heterodimeric Clock:bmal1 Transcriptional Activator Complex Length = 387 | Back alignment and structure |
|
| >pdb|4H10|A Chain A, Intermolecular Recognition Revealed By The Complex Structure Of Human Clock-bmal1 Basic Helix-loop-helix Domains With E-box Dna Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 67 | |||
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 9e-14 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 3e-11 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 2e-09 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 4e-05 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 9e-05 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 2e-04 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 6e-04 |
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 | Back alignment and structure |
|---|
Score = 62.7 bits (152), Expect = 9e-14
Identities = 26/57 (45%), Positives = 36/57 (63%)
Query: 1 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTAVNTFRHHSQPWLFVH 57
M ++I EL+ +VPTC+A++RK DKLT+LRMAV HMK LR + +P
Sbjct: 28 MNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSD 84
|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 67 | |||
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.35 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 99.33 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.21 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 99.12 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 98.98 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 98.84 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 98.8 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 98.79 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 98.78 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 98.73 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 98.71 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 98.69 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 98.61 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 98.49 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 98.45 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 98.38 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 98.35 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 98.12 |
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.35 E-value=2e-13 Score=83.79 Aligned_cols=42 Identities=60% Similarity=0.931 Sum_probs=38.8
Q ss_pred ChHHHHHHHhcCCCCCccCCCCcHHHHHHHHHHHHHHhhhcc
Q psy10347 1 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTA 42 (67)
Q Consensus 1 mN~~I~ELssMVP~c~~~~RKLDKLTVLRmAV~hLk~lrg~~ 42 (67)
+|..|+||++|||.|....+|+||.+||++||+||+.+++..
T Consensus 24 IN~~l~eL~~LvP~~~~~~~KldKasIL~~tV~ylk~l~~~~ 65 (73)
T 4h10_A 24 MNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGAW 65 (73)
T ss_dssp HHHHHHHHHHHSHHHHTCSSCCCHHHHHHHHHHHHHHHSCC-
T ss_pred HHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHhcCc
Confidence 589999999999999888899999999999999999999853
|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 67 | ||||
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 1e-05 | |
| d1uklc_ | 61 | a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId | 3e-05 | |
| d1nlwa_ | 79 | a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T | 1e-04 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 4e-04 | |
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 4e-04 | |
| d1am9a_ | 80 | a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI | 0.001 | |
| d1mdya_ | 68 | a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul | 0.002 |
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Usf B/HLH domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 36.3 bits (84), Expect = 1e-05
Identities = 11/41 (26%), Positives = 20/41 (48%), Gaps = 2/41 (4%)
Query: 1 MTAYITELSDMVPTCSALAR--KPDKLTILRMAVAHMKALR 39
+ +I +LS ++P S + K IL A +++ LR
Sbjct: 20 INNWIVQLSKIIPDSSMESTKSGQSKGGILSKASDYIQELR 60
|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 67 | |||
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 98.96 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 98.9 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 98.83 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 98.78 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 98.69 | |
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 98.66 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.56 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 98.56 |
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Pho4 B/HLH domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=98.96 E-value=1.2e-10 Score=66.75 Aligned_cols=41 Identities=20% Similarity=0.391 Sum_probs=36.3
Q ss_pred ChHHHHHHHhcCCCC---CccCCCCcHHHHHHHHHHHHHHhhhc
Q psy10347 1 MTAYITELSDMVPTC---SALARKPDKLTILRMAVAHMKALRVT 41 (67)
Q Consensus 1 mN~~I~ELssMVP~c---~~~~RKLDKLTVLRmAV~hLk~lrg~ 41 (67)
||..+++|.++||.| ....+|+||.+||++||+||+.|+..
T Consensus 17 in~~~~~L~~llP~~~~~~~~~~k~sKa~iL~~Av~yI~~Lq~~ 60 (63)
T d1a0aa_ 17 LAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQN 60 (63)
T ss_dssp HHHHHHHHHHTSCHHHHTSSCCCCSCTTHHHHHHHHHHHHHHTC
T ss_pred HHHHHHHHHHHCCCcccccCCcccccHHHHHHHHHHHHHHHHHh
Confidence 589999999999965 34579999999999999999999864
|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|