Psyllid ID: psy10347


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-------
MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTAVNTFRHHSQPWLFVHFGQNIDSIFR
cHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHccHHHHHc
ccHHHHHHHHHcccccHHHccHcHHHHHHHHHHHHHHHcccccccccccccccHHHHcccccHHHcc
MTAYITELsdmvptcsalarkpdkLTILRMAVAHMKALRVTAVNTfrhhsqpwlfvhfgqnIDSIFR
mtayitelsdmvptcsalarkpDKLTILRMAVAHMKALRVTAVNTFRHHsqpwlfvhfgqniDSIFR
MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTAVNTFRHHSQPWLFVHFGQNIDSIFR
****ITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTAVNTFRHHSQPWLFVHFGQNIDS***
*TAYITELSDMVPTCSALARKPDKLTILRMAVAHMKA***********HSQPWLFVHFGQNIDSIFR
MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTAVNTFRHHSQPWLFVHFGQNIDSIFR
*TAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTAVNTFRHHSQPWLFVHFGQNIDSIFR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTAVNTFRHHSQPWLFVHFGQNIDSIFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query67 2.2.26 [Sep-21-2011]
O15945 642 Aryl hydrocarbon receptor yes N/A 0.626 0.065 0.952 6e-16
Q9BE97 790 Aryl hydrocarbon receptor yes N/A 0.626 0.053 0.904 1e-15
P27540 789 Aryl hydrocarbon receptor yes N/A 0.626 0.053 0.904 1e-15
P53762 791 Aryl hydrocarbon receptor yes N/A 0.626 0.053 0.904 2e-15
P41739 800 Aryl hydrocarbon receptor yes N/A 0.626 0.052 0.904 2e-15
P79832 723 Aryl hydrocarbon receptor N/A N/A 0.582 0.053 0.948 2e-15
O02748 790 Aryl hydrocarbon receptor yes N/A 0.626 0.053 0.880 3e-15
Q9DG12 737 Aryl hydrocarbon receptor no N/A 0.626 0.056 0.857 4e-15
Q61324 712 Aryl hydrocarbon receptor no N/A 0.626 0.058 0.857 5e-15
Q78E60 712 Aryl hydrocarbon receptor no N/A 0.626 0.058 0.857 5e-15
>sp|O15945|ARNT_DROME Aryl hydrocarbon receptor nuclear translocator homolog OS=Drosophila melanogaster GN=tgo PE=1 SV=3 Back     alignment and function desciption
 Score = 82.8 bits (203), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%)

Query: 1  MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTA 42
          MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALR T 
Sbjct: 29 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRGTG 70




Heterodimers of tgo/trh are involved in the control of breathless expression. Plays a role in the cellular or tissue response to oxygen deprivation.
Drosophila melanogaster (taxid: 7227)
>sp|Q9BE97|ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator OS=Bos taurus GN=ARNT PE=2 SV=1 Back     alignment and function description
>sp|P27540|ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator OS=Homo sapiens GN=ARNT PE=1 SV=1 Back     alignment and function description
>sp|P53762|ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator OS=Mus musculus GN=Arnt PE=1 SV=3 Back     alignment and function description
>sp|P41739|ARNT_RAT Aryl hydrocarbon receptor nuclear translocator OS=Rattus norvegicus GN=Arnt PE=1 SV=2 Back     alignment and function description
>sp|P79832|ARNT_ONCMY Aryl hydrocarbon receptor nuclear translocator OS=Oncorhynchus mykiss GN=arnt PE=1 SV=1 Back     alignment and function description
>sp|O02748|ARNT_RABIT Aryl hydrocarbon receptor nuclear translocator OS=Oryctolagus cuniculus GN=ARNT PE=2 SV=1 Back     alignment and function description
>sp|Q9DG12|ARNT2_DANRE Aryl hydrocarbon receptor nuclear translocator 2 OS=Danio rerio GN=arnt2 PE=1 SV=2 Back     alignment and function description
>sp|Q61324|ARNT2_MOUSE Aryl hydrocarbon receptor nuclear translocator 2 OS=Mus musculus GN=Arnt2 PE=1 SV=2 Back     alignment and function description
>sp|Q78E60|ARNT2_RAT Aryl hydrocarbon receptor nuclear translocator 2 OS=Rattus norvegicus GN=Arnt2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
242021051 671 conserved hypothetical protein [Pediculu 0.626 0.062 0.952 6e-15
389614612 304 tango protein [Papilio polytes] 0.626 0.138 0.952 8e-15
345481068 690 PREDICTED: aryl hydrocarbon receptor nuc 0.626 0.060 0.952 1e-14
332018235 612 Aryl hydrocarbon receptor nuclear transl 0.776 0.084 0.788 1e-14
383856080 668 PREDICTED: aryl hydrocarbon receptor nuc 0.626 0.062 0.928 1e-14
427794165 700 Putative tango, partial [Rhipicephalus p 0.626 0.06 0.928 1e-14
357628246 641 putative arylhydrocarbon receptor nuclea 0.626 0.065 0.952 1e-14
189233619 661 PREDICTED: similar to arylhydrocarbon re 0.626 0.063 0.952 1e-14
307168322 612 Aryl hydrocarbon receptor nuclear transl 0.626 0.068 0.952 1e-14
270014664 679 hypothetical protein TcasGA2_TC004710 [T 0.626 0.061 0.952 1e-14
>gi|242021051|ref|XP_002430960.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516180|gb|EEB18222.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 84.7 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%)

Query: 1   MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTA 42
           MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALR T 
Sbjct: 87  MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRGTG 128




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|389614612|dbj|BAM20342.1| tango protein [Papilio polytes] Back     alignment and taxonomy information
>gi|345481068|ref|XP_001605013.2| PREDICTED: aryl hydrocarbon receptor nuclear translocator homolog [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332018235|gb|EGI58840.1| Aryl hydrocarbon receptor nuclear translocator-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383856080|ref|XP_003703538.1| PREDICTED: aryl hydrocarbon receptor nuclear translocator homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|427794165|gb|JAA62534.1| Putative tango, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|357628246|gb|EHJ77636.1| putative arylhydrocarbon receptor nuclear translocator-like protein b [Danaus plexippus] Back     alignment and taxonomy information
>gi|189233619|ref|XP_970422.2| PREDICTED: similar to arylhydrocarbon receptor nuclear translocator homolog b [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307168322|gb|EFN61528.1| Aryl hydrocarbon receptor nuclear translocator-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|270014664|gb|EFA11112.1| hypothetical protein TcasGA2_TC004710 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
UNIPROTKB|K7GSB9133 ARNT "Uncharacterized protein" 0.656 0.330 0.888 4.2e-15
FB|FBgn0264075 642 tgo "tango" [Drosophila melano 0.656 0.068 0.933 1.1e-14
UNIPROTKB|K7GQY6 347 ARNT "Uncharacterized protein" 0.656 0.126 0.888 1.1e-14
UNIPROTKB|A6NGV6 416 ARNT "Aryl hydrocarbon recepto 0.656 0.105 0.888 2e-14
UNIPROTKB|G3N3F0207 G3N3F0 "Uncharacterized protei 0.611 0.198 0.878 3.8e-14
UNIPROTKB|F1RIF2208 ARNT2 "Uncharacterized protein 0.611 0.197 0.878 3.8e-14
UNIPROTKB|F6V057 781 ARNT "Uncharacterized protein" 0.656 0.056 0.888 6.6e-14
UNIPROTKB|F1SS94 781 ARNT "Uncharacterized protein" 0.656 0.056 0.888 6.6e-14
UNIPROTKB|F1MYI1 782 ARNT "Aryl hydrocarbon recepto 0.656 0.056 0.888 6.7e-14
UNIPROTKB|E9PTS2 785 Arnt "Aryl hydrocarbon recepto 0.656 0.056 0.888 6.7e-14
UNIPROTKB|K7GSB9 ARNT "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 191 (72.3 bits), Expect = 4.2e-15, P = 4.2e-15
 Identities = 40/45 (88%), Positives = 42/45 (93%)

Query:     1 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTAVNT 45
             MTAYITELSDMVPTCSALARKPDKLTILRMAV+HMK+LR T  NT
Sbjct:    82 MTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTG-NT 125




GO:0046983 "protein dimerization activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005667 "transcription factor complex" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
FB|FBgn0264075 tgo "tango" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|K7GQY6 ARNT "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A6NGV6 ARNT "Aryl hydrocarbon receptor nuclear translocator" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3N3F0 G3N3F0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIF2 ARNT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6V057 ARNT "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SS94 ARNT "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYI1 ARNT "Aryl hydrocarbon receptor nuclear translocator" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTS2 Arnt "Aryl hydrocarbon receptor nuclear translocator" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53762ARNT_MOUSENo assigned EC number0.90470.62680.0530yesN/A
O15945ARNT_DROMENo assigned EC number0.95230.62680.0654yesN/A
Q9BE97ARNT_BOVINNo assigned EC number0.90470.62680.0531yesN/A
O02748ARNT_RABITNo assigned EC number0.88090.62680.0531yesN/A
O02219AHA1_CAEELNo assigned EC number0.71790.58200.0860yesN/A
P79832ARNT_ONCMYNo assigned EC number0.94870.58200.0539N/AN/A
P27540ARNT_HUMANNo assigned EC number0.90470.62680.0532yesN/A
P41739ARNT_RATNo assigned EC number0.90470.62680.0525yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
smart0035353 smart00353, HLH, helix loop helix domain 6e-07
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 2e-05
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 2e-05
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information
 Score = 41.1 bits (97), Expect = 6e-07
 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 1  MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALR 39
          +     EL  ++PT     +K  K  ILR+A+ ++K+L+
Sbjct: 11 INEAFDELRSLLPTLPK-NKKLSKAEILRLAIEYIKSLQ 48


Length = 53

>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 67
KOG3561|consensus 803 99.62
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 98.99
smart0035353 HLH helix loop helix domain. 98.96
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 98.93
KOG3560|consensus 712 98.77
KOG4029|consensus228 97.56
KOG3558|consensus 768 97.55
KOG4304|consensus 250 97.31
KOG1318|consensus411 97.06
KOG3898|consensus 254 96.07
KOG3559|consensus 598 96.01
KOG4395|consensus285 95.35
KOG3960|consensus284 92.1
KOG1319|consensus229 91.89
KOG2588|consensus 953 86.37
>KOG3561|consensus Back     alignment and domain information
Probab=99.62  E-value=2.5e-16  Score=130.41  Aligned_cols=41  Identities=59%  Similarity=0.953  Sum_probs=40.1

Q ss_pred             ChHHHHHHHhcCCCCCccCCCCcHHHHHHHHHHHHHHhhhc
Q psy10347          1 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVT   41 (67)
Q Consensus         1 mN~~I~ELssMVP~c~~~~RKLDKLTVLRmAV~hLk~lrg~   41 (67)
                      ||.||+|||+|||.|..++|||||+|||||||+|||.+||.
T Consensus        35 ~N~yI~ELs~Mvp~~~~~~RK~DK~tVLr~aV~~lr~~k~~   75 (803)
T KOG3561|consen   35 MNKYIEELSEMVPTNASLSRKPDKLTVLRMAVDHLRLIKEQ   75 (803)
T ss_pred             HHHHHHHHHHhhhcchhcccCchHHHHHHHHHHHHHHHhhh
Confidence            79999999999999999999999999999999999999996



>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>KOG3560|consensus Back     alignment and domain information
>KOG4029|consensus Back     alignment and domain information
>KOG3558|consensus Back     alignment and domain information
>KOG4304|consensus Back     alignment and domain information
>KOG1318|consensus Back     alignment and domain information
>KOG3898|consensus Back     alignment and domain information
>KOG3559|consensus Back     alignment and domain information
>KOG4395|consensus Back     alignment and domain information
>KOG3960|consensus Back     alignment and domain information
>KOG1319|consensus Back     alignment and domain information
>KOG2588|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
4f3l_B 387 Crystal Structure Of The Heterodimeric Clock:bmal1 6e-10
4h10_A73 Intermolecular Recognition Revealed By The Complex 1e-09
>pdb|4F3L|B Chain B, Crystal Structure Of The Heterodimeric Clock:bmal1 Transcriptional Activator Complex Length = 387 Back     alignment and structure

Iteration: 1

Score = 58.9 bits (141), Expect = 6e-10, Method: Composition-based stats. Identities = 25/39 (64%), Positives = 33/39 (84%) Query: 1 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALR 39 M ++I EL+ +VPTC+A++RK DKLT+LRMAV HMK LR Sbjct: 28 MNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLR 66
>pdb|4H10|A Chain A, Intermolecular Recognition Revealed By The Complex Structure Of Human Clock-bmal1 Basic Helix-loop-helix Domains With E-box Dna Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query67
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 9e-14
4f3l_A 361 Mclock, circadian locomoter output cycles protein 3e-11
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 2e-09
1hlo_A80 Protein (transcription factor MAX); transcriptiona 4e-05
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 9e-05
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 2e-04
1a0a_A63 BHLH, protein (phosphate system positive regulator 6e-04
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
 Score = 62.7 bits (152), Expect = 9e-14
 Identities = 26/57 (45%), Positives = 36/57 (63%)

Query: 1  MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTAVNTFRHHSQPWLFVH 57
          M ++I EL+ +VPTC+A++RK DKLT+LRMAV HMK LR         + +P     
Sbjct: 28 MNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSD 84


>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query67
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.35
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 99.33
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.21
4f3l_A 361 Mclock, circadian locomoter output cycles protein 99.12
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 98.98
4ati_A118 MITF, microphthalmia-associated transcription fact 98.84
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 98.8
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.79
1hlo_A80 Protein (transcription factor MAX); transcriptiona 98.78
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 98.73
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 98.71
1a0a_A63 BHLH, protein (phosphate system positive regulator 98.69
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 98.61
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 98.49
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.45
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 98.38
4ath_A83 MITF, microphthalmia-associated transcription fact 98.35
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 98.12
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
Probab=99.35  E-value=2e-13  Score=83.79  Aligned_cols=42  Identities=60%  Similarity=0.931  Sum_probs=38.8

Q ss_pred             ChHHHHHHHhcCCCCCccCCCCcHHHHHHHHHHHHHHhhhcc
Q psy10347          1 MTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRVTA   42 (67)
Q Consensus         1 mN~~I~ELssMVP~c~~~~RKLDKLTVLRmAV~hLk~lrg~~   42 (67)
                      +|..|+||++|||.|....+|+||.+||++||+||+.+++..
T Consensus        24 IN~~l~eL~~LvP~~~~~~~KldKasIL~~tV~ylk~l~~~~   65 (73)
T 4h10_A           24 MNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGAW   65 (73)
T ss_dssp             HHHHHHHHHHHSHHHHTCSSCCCHHHHHHHHHHHHHHHSCC-
T ss_pred             HHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHhcCc
Confidence            589999999999999888899999999999999999999853



>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 67
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 1e-05
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 3e-05
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 1e-04
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 4e-04
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 4e-04
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 0.001
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 0.002
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Usf B/HLH domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 36.3 bits (84), Expect = 1e-05
 Identities = 11/41 (26%), Positives = 20/41 (48%), Gaps = 2/41 (4%)

Query: 1  MTAYITELSDMVPTCSALAR--KPDKLTILRMAVAHMKALR 39
          +  +I +LS ++P  S  +      K  IL  A  +++ LR
Sbjct: 20 INNWIVQLSKIIPDSSMESTKSGQSKGGILSKASDYIQELR 60


>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query67
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 98.96
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 98.9
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 98.83
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 98.69
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 98.56
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 98.56
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Pho4 B/HLH domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=98.96  E-value=1.2e-10  Score=66.75  Aligned_cols=41  Identities=20%  Similarity=0.391  Sum_probs=36.3

Q ss_pred             ChHHHHHHHhcCCCC---CccCCCCcHHHHHHHHHHHHHHhhhc
Q psy10347          1 MTAYITELSDMVPTC---SALARKPDKLTILRMAVAHMKALRVT   41 (67)
Q Consensus         1 mN~~I~ELssMVP~c---~~~~RKLDKLTVLRmAV~hLk~lrg~   41 (67)
                      ||..+++|.++||.|   ....+|+||.+||++||+||+.|+..
T Consensus        17 in~~~~~L~~llP~~~~~~~~~~k~sKa~iL~~Av~yI~~Lq~~   60 (63)
T d1a0aa_          17 LAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQQN   60 (63)
T ss_dssp             HHHHHHHHHHTSCHHHHTSSCCCCSCTTHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHCCCcccccCCcccccHHHHHHHHHHHHHHHHHh
Confidence            589999999999965   34579999999999999999999864



>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure