Psyllid ID: psy10360
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 380 | 2.2.26 [Sep-21-2011] | |||||||
| Q15256 | 657 | Receptor-type tyrosine-pr | no | N/A | 0.544 | 0.315 | 0.306 | 2e-28 | |
| P08575 | 1304 | Receptor-type tyrosine-pr | no | N/A | 0.555 | 0.161 | 0.324 | 3e-28 | |
| Q16825 | 1174 | Tyrosine-protein phosphat | no | N/A | 0.521 | 0.168 | 0.333 | 3e-28 | |
| Q62136 | 1176 | Tyrosine-protein phosphat | yes | N/A | 0.521 | 0.168 | 0.329 | 3e-28 | |
| Q62728 | 1175 | Tyrosine-protein phosphat | yes | N/A | 0.521 | 0.168 | 0.329 | 4e-28 | |
| Q12913 | 1337 | Receptor-type tyrosine-pr | no | N/A | 0.515 | 0.146 | 0.311 | 6e-28 | |
| P20417 | 432 | Tyrosine-protein phosphat | no | N/A | 0.502 | 0.442 | 0.312 | 7e-28 | |
| P29351 | 595 | Tyrosine-protein phosphat | no | N/A | 0.507 | 0.324 | 0.304 | 8e-28 | |
| P35236 | 360 | Tyrosine-protein phosphat | no | N/A | 0.539 | 0.569 | 0.304 | 8e-28 | |
| Q62132 | 656 | Receptor-type tyrosine-pr | no | N/A | 0.542 | 0.314 | 0.303 | 1e-27 |
| >sp|Q15256|PTPRR_HUMAN Receptor-type tyrosine-protein phosphatase R OS=Homo sapiens GN=PTPRR PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 127 bits (318), Expect = 2e-28, Method: Compositional matrix adjust.
Identities = 76/248 (30%), Positives = 119/248 (47%), Gaps = 41/248 (16%)
Query: 127 IFAEFSTGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQSKVILMITALFENSVEKCADYL 186
I A + G G+EK +IA Q P+ NT++DFW+M+W S VI+MIT L E + EKC Y
Sbjct: 447 INANYIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKEKN-EKCVLYW 505
Query: 187 PPSEVLDCHRVFGDFQITLKKREVEKCADYLPPSEVLDCHRVFGDFQITLKKREVREKYV 246
P +KR + +G ++ + + Y
Sbjct: 506 P------------------EKRGI------------------YGKVEVLVISVNECDNYT 529
Query: 247 ISSLQIKNLETNLWRELTHVWYTNWPTTGVPNEESSLIAFLIEARAHMKGAAGREAGPLV 306
I +L +K + + + + H WYT+WP P+ L+ +++ + GR GP+V
Sbjct: 530 IRNLVLK--QGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGR--GPVV 585
Query: 307 IHCSPGTGRTGTVLACDILIRHFETSRSVDVPRVVYNIRQCRAGAVATSQQYAFIYRVLN 366
+HCS G GRTG +A I + + VD +V +R R G V TS+QY F++ L
Sbjct: 586 VHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALC 645
Query: 367 VYASKLTG 374
+Y S+L+
Sbjct: 646 LYESRLSA 653
|
Sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus. Homo sapiens (taxid: 9606) EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8 |
| >sp|P08575|PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens GN=PTPRC PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q16825|PTN21_HUMAN Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens GN=PTPN21 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q62136|PTN21_MOUSE Tyrosine-protein phosphatase non-receptor type 21 OS=Mus musculus GN=Ptpn21 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q62728|PTN21_RAT Tyrosine-protein phosphatase non-receptor type 21 OS=Rattus norvegicus GN=Ptpn21 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q12913|PTPRJ_HUMAN Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens GN=PTPRJ PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P20417|PTN1_RAT Tyrosine-protein phosphatase non-receptor type 1 OS=Rattus norvegicus GN=Ptpn1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P29351|PTN6_MOUSE Tyrosine-protein phosphatase non-receptor type 6 OS=Mus musculus GN=Ptpn6 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P35236|PTN7_HUMAN Tyrosine-protein phosphatase non-receptor type 7 OS=Homo sapiens GN=PTPN7 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q62132|PTPRR_MOUSE Receptor-type tyrosine-protein phosphatase R OS=Mus musculus GN=Ptprr PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 380 | ||||||
| 328723271 | 1414 | PREDICTED: hypothetical protein LOC10016 | 0.678 | 0.182 | 0.461 | 7e-91 | |
| 270001700 | 1145 | hypothetical protein TcasGA2_TC000572 [T | 0.668 | 0.221 | 0.536 | 1e-87 | |
| 189234533 | 1088 | PREDICTED: similar to IP14232p [Triboliu | 0.668 | 0.233 | 0.536 | 1e-87 | |
| 307190592 | 1576 | Leukocyte common antigen [Camponotus flo | 0.668 | 0.161 | 0.436 | 2e-80 | |
| 307199744 | 1555 | Tyrosine-protein phosphatase non-recepto | 0.668 | 0.163 | 0.431 | 3e-78 | |
| 242017130 | 352 | tyrosine-protein phosphatase non-recepto | 0.586 | 0.633 | 0.564 | 5e-78 | |
| 345479463 | 953 | PREDICTED: hypothetical protein LOC10012 | 0.665 | 0.265 | 0.424 | 3e-76 | |
| 328788711 | 1427 | PREDICTED: hypothetical protein LOC40971 | 0.665 | 0.177 | 0.427 | 1e-75 | |
| 350426553 | 1488 | PREDICTED: hypothetical protein LOC10074 | 0.665 | 0.170 | 0.421 | 4e-75 | |
| 340723516 | 1498 | PREDICTED: hypothetical protein LOC10064 | 0.665 | 0.168 | 0.421 | 4e-75 |
| >gi|328723271|ref|XP_001943476.2| PREDICTED: hypothetical protein LOC100164472 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 340 bits (872), Expect = 7e-91, Method: Compositional matrix adjust.
Identities = 175/379 (46%), Positives = 221/379 (58%), Gaps = 121/379 (31%)
Query: 1 VRPDELPPGTEDKNRYANVIPIPETRVRLCSGGEAASDSEDYINANYVRGPKGEEKFYIA 60
V+PDELPPG E KNRYANVIP+PETRV L G + DYINAN+V+G Y
Sbjct: 1156 VKPDELPPGAETKNRYANVIPMPETRVLLNPRGSGLN--SDYINANFVKG-------Y-- 1204
Query: 61 CQAPLQNTIEDFWRMIWTHQSKVILMITALFENSGPKGEEKFYIACQAPLQNTIEDFYFG 120
KG +KFYIACQAP+Q+T+
Sbjct: 1205 ------------------------------------KGADKFYIACQAPMQSTV------ 1222
Query: 121 AMKQSLIFAEFSTGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQSKVILMITALFENSVE 180
DFW+MIW S+VI+M+T+L E VE
Sbjct: 1223 ---------------------------------PDFWQMIWDQNSRVIIMVTSLTEKGVE 1249
Query: 181 KCADYLPPSEVLDCHRVFGDFQITLKKREVEKCADYLPPSEVLDCHRVFGDFQITLKKRE 240
+CADYLPPSEVLDCHR+FGD+QITLK KRE
Sbjct: 1250 RCADYLPPSEVLDCHRLFGDYQITLK-------------------------------KRE 1278
Query: 241 VREKYVISSLQIKNLETNLWRELTHVWYTNWPTTGVPNEESSLIAFLIEARAHMKGAAGR 300
V+EK++IS+LQ+KNLETNLWR++TH+WY WP GVP++ +++AF++EAR+HMK
Sbjct: 1279 VKEKFIISNLQLKNLETNLWRDVTHLWYGGWPVQGVPSDPGAMLAFVMEARSHMK----T 1334
Query: 301 EAGPLVIHCSPGTGRTGTVLACDILIRHFETSRSVDVPRVVYNIRQCRAGAVATSQQYAF 360
+GP V+HCSPGTGRTGTV+ACD+ IR FE +R+VDVP+ VY +R+CRAGAV T QYA
Sbjct: 1335 NSGPHVVHCSPGTGRTGTVIACDMAIRDFELTRTVDVPKTVYAVRRCRAGAVQTRDQYAL 1394
Query: 361 IYRVLNVYASKLTGGALDS 379
IY+V+N+YASKL+GG LDS
Sbjct: 1395 IYKVVNLYASKLSGGVLDS 1413
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270001700|gb|EEZ98147.1| hypothetical protein TcasGA2_TC000572 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189234533|ref|XP_972865.2| PREDICTED: similar to IP14232p [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307190592|gb|EFN74574.1| Leukocyte common antigen [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307199744|gb|EFN80217.1| Tyrosine-protein phosphatase non-receptor type 6 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242017130|ref|XP_002429045.1| tyrosine-protein phosphatase non-receptor type, putative [Pediculus humanus corporis] gi|212513900|gb|EEB16307.1| tyrosine-protein phosphatase non-receptor type, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|345479463|ref|XP_001606923.2| PREDICTED: hypothetical protein LOC100123300 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328788711|ref|XP_393213.4| PREDICTED: hypothetical protein LOC409714 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350426553|ref|XP_003494472.1| PREDICTED: hypothetical protein LOC100744232 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340723516|ref|XP_003400135.1| PREDICTED: hypothetical protein LOC100648338 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 380 | ||||||
| FB|FBgn0259227 | 1429 | CG42327 [Drosophila melanogast | 0.665 | 0.177 | 0.425 | 2.6e-45 | |
| UNIPROTKB|G5E541 | 339 | PTPN7 "Uncharacterized protein | 0.236 | 0.265 | 0.451 | 2.8e-38 | |
| UNIPROTKB|P35236 | 360 | PTPN7 "Tyrosine-protein phosph | 0.236 | 0.25 | 0.462 | 2.1e-37 | |
| MGI|MGI:2156893 | 359 | Ptpn7 "protein tyrosine phosph | 0.236 | 0.250 | 0.462 | 3.3e-37 | |
| RGD|708516 | 359 | Ptpn7 "protein tyrosine phosph | 0.236 | 0.250 | 0.462 | 7.2e-37 | |
| UNIPROTKB|F1P3K6 | 537 | PTPN5 "Uncharacterized protein | 0.415 | 0.294 | 0.283 | 1.5e-36 | |
| UNIPROTKB|J3KR55 | 441 | PTPN7 "Tyrosine-protein phosph | 0.236 | 0.204 | 0.462 | 1.7e-36 | |
| UNIPROTKB|Q5SXQ0 | 465 | PTPN7 "Tyrosine-protein phosph | 0.236 | 0.193 | 0.462 | 2.3e-36 | |
| UNIPROTKB|E1C6P9 | 365 | PTPN7 "Uncharacterized protein | 0.436 | 0.454 | 0.308 | 5.6e-36 | |
| UNIPROTKB|A5D980 | 593 | PTPN6 "Protein tyrosine phosph | 0.407 | 0.261 | 0.357 | 2e-35 |
| FB|FBgn0259227 CG42327 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 489 (177.2 bits), Expect = 2.6e-45, P = 2.6e-45
Identities = 117/275 (42%), Positives = 160/275 (58%)
Query: 123 KQSLIFAEFSTGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQSKVILMITALFENSVEKC 182
K I A + GP+ +YIACQAPL++T DFWRMIW QS+VI+ T L EN +E+C
Sbjct: 1159 KTEYINANYVRGPRDAPNYYIACQAPLESTTSDFWRMIWEQQSRVIIQATDLSENGIERC 1218
Query: 183 ADYLPPSEVLDCHRVFGDFQITLKKREVEKCADYLPPSEVLDCHRVFGDF--QIT---LK 237
A+YLPPS LD H +GD+Q+TLK REV+ Y + VL RV G+ ++T K
Sbjct: 1219 AEYLPPSATLDNHSSYGDYQVTLKHREVKD--RYAISTLVLK--RVDGEESRELTHYWYK 1274
Query: 238 KREV----REKYVI-------SSLQIKNLE-TNLWRELTHVWYTNWPTTGVPNEESSLIA 285
E E +I SSL+ +LE N RE + T+ G E S +
Sbjct: 1275 WPEAGVPAEEAPIIAMLLEARSSLKSYSLEQANELREKSATLETSMDADGSKAEAGSTSS 1334
Query: 286 FLIEARAHMKGAAGREAGPLVIHCSPGTGRTGTVLACDILIRHFET-SRSVDVPRVVYNI 344
I + + GPL +HCSPGTGRTGT++A D+ IR ET RSVD+P++VY +
Sbjct: 1335 HEINGNISSRSGTRSQQGPLTVHCSPGTGRTGTIIASDMAIRSLETPKRSVDIPQLVYYV 1394
Query: 345 RQCRAGAVATSQQYAFIYRVLNVYASKLTGGALDS 379
R+ RA AV T +QY FIY+V ++YA+K+T + D+
Sbjct: 1395 RRGRASAVQTKEQYEFIYKVASMYAAKITNLSNDN 1429
|
|
| UNIPROTKB|G5E541 PTPN7 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P35236 PTPN7 "Tyrosine-protein phosphatase non-receptor type 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2156893 Ptpn7 "protein tyrosine phosphatase, non-receptor type 7" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|708516 Ptpn7 "protein tyrosine phosphatase, non-receptor type 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3K6 PTPN5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KR55 PTPN7 "Tyrosine-protein phosphatase non-receptor type 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5SXQ0 PTPN7 "Tyrosine-protein phosphatase non-receptor type 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C6P9 PTPN7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5D980 PTPN6 "Protein tyrosine phosphatase, non-receptor type 6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3 | 0.691 |
| 3rd Layer | 3.1.3.48 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 380 | |||
| cd00047 | 231 | cd00047, PTPc, Protein tyrosine phosphatases (PTP) | 4e-68 | |
| smart00194 | 259 | smart00194, PTPc, Protein tyrosine phosphatase, ca | 2e-67 | |
| pfam00102 | 233 | pfam00102, Y_phosphatase, Protein-tyrosine phospha | 3e-63 | |
| PHA02738 | 320 | PHA02738, PHA02738, hypothetical protein; Provisio | 3e-34 | |
| PHA02746 | 323 | PHA02746, PHA02746, protein tyrosine phosphatase; | 5e-33 | |
| PHA02747 | 312 | PHA02747, PHA02747, protein tyrosine phosphatase; | 1e-32 | |
| PHA02742 | 303 | PHA02742, PHA02742, protein tyrosine phosphatase; | 2e-29 | |
| COG5599 | 302 | COG5599, PTP2, Protein tyrosine phosphatase [Signa | 1e-25 | |
| smart00404 | 105 | smart00404, PTPc_motif, Protein tyrosine phosphata | 1e-24 | |
| smart00012 | 105 | smart00012, PTPc_DSPc, Protein tyrosine phosphatas | 1e-24 | |
| PHA02738 | 320 | PHA02738, PHA02738, hypothetical protein; Provisio | 9e-16 | |
| PHA02742 | 303 | PHA02742, PHA02742, protein tyrosine phosphatase; | 2e-12 | |
| PHA02746 | 323 | PHA02746, PHA02746, protein tyrosine phosphatase; | 9e-12 | |
| PHA02740 | 298 | PHA02740, PHA02740, protein tyrosine phosphatase; | 5e-10 |
| >gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
Score = 214 bits (547), Expect = 4e-68
Identities = 99/354 (27%), Positives = 133/354 (37%), Gaps = 125/354 (35%)
Query: 12 DKNRYANVIPIPETRVRLCSGGEAASDSEDYINANYVRGPKGEEKFYIACQAPLQNTIED 71
KNRY +++P TRV+L + SD YINA+Y+ G
Sbjct: 1 KKNRYKDILPYDHTRVKLKPDDDEGSD---YINASYIDGYN------------------- 38
Query: 72 FWRMIWTHQSKVILMITALFENSGPKGEEKFYIACQAPLQNTIEDFYFGAMKQSLIFAEF 131
K YIA Q
Sbjct: 39 ---------------------------PPKAYIATQG----------------------- 48
Query: 132 STGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQSKVILMITALFENSVEKCADYLPPSEV 191
PL NT+EDFWRM+W + VI+M+T L E EKCA Y P
Sbjct: 49 ----------------PLPNTVEDFWRMVWEQKVPVIVMLTELVEKGREKCAQYWP---- 88
Query: 192 LDCHRVFGDFQITLKKREVEKCADYLPPSEVLDCHRVFGDFQITLKKREVREKYVISSLQ 251
E +GD +TL E + Y + +L+
Sbjct: 89 ----------------EEEGSL--------------TYGDITVTLVSEEKLDDYTVRTLK 118
Query: 252 IKNLETNLWRELTHVWYTNWPTTGVPNEESSLIAFLIEARAHMKGAAGREAGPLVIHCSP 311
+ N T R +TH YT WP GVP SL+ L + R +GP+V+HCS
Sbjct: 119 LSNTGTGETRTVTHFQYTGWPDHGVPESPDSLLDLLRKVRKSQ---QQPGSGPIVVHCSA 175
Query: 312 GTGRTGTVLACDILIRHFETSRSVDVPRVVYNIRQCRAGAVATSQQYAFIYRVL 365
G GRTGT +A DIL++ E VD+ + V +R R G V T +QY F+YR +
Sbjct: 176 GVGRTGTFIAIDILLQRLEAEGVVDIFQTVKELRSQRPGMVQTEEQYIFLYRAI 229
|
The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active. Length = 231 |
| >gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 380 | |||
| KOG4228|consensus | 1087 | 100.0 | ||
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 100.0 | |
| KOG0792|consensus | 1144 | 100.0 | ||
| KOG0790|consensus | 600 | 100.0 | ||
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 100.0 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 100.0 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 100.0 | |
| KOG0791|consensus | 374 | 100.0 | ||
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 100.0 | |
| KOG0793|consensus | 1004 | 100.0 | ||
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 100.0 | |
| KOG4228|consensus | 1087 | 100.0 | ||
| KOG0789|consensus | 415 | 100.0 | ||
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.9 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.9 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.68 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.52 | |
| KOG2836|consensus | 173 | 99.25 | ||
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.23 | |
| KOG1720|consensus | 225 | 99.21 | ||
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 99.16 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 99.13 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 98.96 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 98.91 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 98.9 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 98.9 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 98.78 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 98.78 | |
| KOG0792|consensus | 1144 | 98.72 | ||
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 98.71 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 98.71 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 98.68 | |
| KOG0793|consensus | 1004 | 98.59 | ||
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 98.51 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 98.17 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 98.16 | |
| KOG0789|consensus | 415 | 98.12 | ||
| KOG0791|consensus | 374 | 98.06 | ||
| KOG0790|consensus | 600 | 97.95 | ||
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 97.79 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 97.56 | |
| KOG1718|consensus | 198 | 97.28 | ||
| KOG1719|consensus | 183 | 97.0 | ||
| KOG1716|consensus | 285 | 96.87 | ||
| KOG2283|consensus | 434 | 96.75 | ||
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 96.73 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 96.66 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 96.58 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 96.34 | |
| KOG1717|consensus | 343 | 96.11 | ||
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 95.16 | |
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 94.16 | |
| PLN02727 | 986 | NAD kinase | 93.77 | |
| KOG4471|consensus | 717 | 92.54 | ||
| KOG1572|consensus | 249 | 90.52 | ||
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 86.63 | |
| KOG2386|consensus | 393 | 81.7 |
| >KOG4228|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-75 Score=596.91 Aligned_cols=322 Identities=34% Similarity=0.599 Sum_probs=284.6
Q ss_pred CCCCCcCCCCCCCCCCCCCCeeEecCCCCCCCCCCCceeecccCCCCCCCceEEEeCCCCcCCHHHHHHHHHhcCCcEEE
Q psy10360 6 LPPGTEDKNRYANVIPIPETRVRLCSGGEAASDSEDYINANYVRGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQSKVIL 85 (380)
Q Consensus 6 ~~~~n~~kNR~~~i~p~d~sRV~L~~~~~~~~~~~~YINAs~v~~~~~~~~~~I~tQ~P~~~t~~dFW~mi~~~~~~~iv 85 (380)
-.++|..||||.||++|||+||+|.+.+++ +.+||||||||+||..++ .|||||||++.|+.||||||||+++.+||
T Consensus 561 ~~~en~~KNRY~nilayD~sRV~L~~i~Gd--~~sDYINAnyIdGy~e~n-~yIaaQgP~~eTv~DFWRMVWEq~S~~IV 637 (1087)
T KOG4228|consen 561 NKKENKQKNRYENILAYDHSRVILPPIEGD--PNSDYINANYIDGYKEPN-AYIAAQGPRPETVGDFWRMVWEQKSAGIV 637 (1087)
T ss_pred ccccccccccCCcchhhhcceeeecccCCC--ccccceeeeeeecccccc-cceeccCCcccchHHHHHHheeccCCcEE
Confidence 356799999999999999999999999886 689999999999998764 49999999999999999999999999999
Q ss_pred EeccccccCCCcccccee--------------------------------------------------------------
Q psy10360 86 MITALFENSGPKGEEKFY-------------------------------------------------------------- 103 (380)
Q Consensus 86 ~~~~~~e~~~~~~~~~~~-------------------------------------------------------------- 103 (380)
|++.+.|+++.||..||+
T Consensus 638 MvTnl~E~~r~kC~qYWP~~t~~yGdi~V~~~~~~~~a~y~iRtf~l~~~g~~~~R~v~qfhFt~Wpd~gvPe~~t~lL~ 717 (1087)
T KOG4228|consen 638 MVTNLEEFSRVKCAQYWPEGTETYGDIKVTLVQTKPLAEYGIRTFALKKQGENPKREVRQFHFTAWPDHGVPETPTGLLK 717 (1087)
T ss_pred EEecccccccccccccCCCCccccccccccceeeeeeccceEEeeeccccCCCCCceeeeeeeccCCCCCCcccchHHHH
Confidence 999999999999998764
Q ss_pred -----------------ecccCCCccc--------------------------------------eeeeec---------
Q psy10360 104 -----------------IACQAPLQNT--------------------------------------IEDFYF--------- 119 (380)
Q Consensus 104 -----------------~~~~~~~~~~--------------------------------------~~~~~~--------- 119 (380)
|||+||.||| .+||.|
T Consensus 718 f~rrvk~~~p~~aGPiVVHCSAGvGRTG~fi~iDaml~~~~~e~~vdiy~~v~~lR~QR~~mVQt~eQYiFi~~AllE~~ 797 (1087)
T KOG4228|consen 718 FRRRVKTFNPPDAGPIVVHCSAGVGRTGCFIVIDAMLDRLECEGKVDIYGHVKTLRRQRNNMVQTEEQYIFIHEALLEAC 797 (1087)
T ss_pred HHHHhccCCCcCCCCEEEECCCCCCCcceEEEeHHHHHHHHhhCccceechhHHHHhccccccccHHHHHHHHHHHHHHH
Confidence 9999999997 122211
Q ss_pred --c------------------------------------------------c----------------------------
Q psy10360 120 --G------------------------------------------------A---------------------------- 121 (380)
Q Consensus 120 --~------------------------------------------------~---------------------------- 121 (380)
| .
T Consensus 798 ~~G~T~i~~~~~~~~~~~l~~~~p~~~~t~le~EF~~L~~~~~~~~~~~~~~l~~N~~KNR~~~i~P~d~~rv~L~~~~G 877 (1087)
T KOG4228|consen 798 LCGDTEVPASTLAPYSQKLKRIDPPENKTGLEEEFKTLNSCKPRTRMMICGNLPENKSKNRQVNILPYDRNRVILIPTHG 877 (1087)
T ss_pred hcCCccccHHHHHHHHHHhccCCCCCCCcchHHHHHHHhhccccchhhhccccchhcccccccccCCchhcccceeccCC
Confidence 0 0
Q ss_pred cccceEEeEeecCCCCCcceEEEecCCCCCcHHHHHHHHHhCCCcEEEEcCCCccCCcccccccCCCCccccccccccce
Q psy10360 122 MKQSLIFAEFSTGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQSKVILMITALFENSVEKCADYLPPSEVLDCHRVFGDF 201 (380)
Q Consensus 122 ~~~~~i~a~~~~~~~~~~~~yI~tQ~Pl~~T~~dFW~mV~~~~v~~IVmL~~~~E~~~~kc~~YwP~~~~~~~~~~~g~~ 201 (380)
..+++|+|+|++|+. +.+.|||+|.|+.+|++|||+|+|++++.+||||++..+. ++|.+|||.+.
T Consensus 878 ~~sdYINAs~idgy~-~~~~fivtq~PL~~T~~DFWrmi~d~~~tsiVmL~~l~~~--~~C~qyw~~~g----------- 943 (1087)
T KOG4228|consen 878 ESSDYINASFIDGYR-QPKAFIVTQGPLAETVEDFWRMIWDQNVTSIVMLTELKHP--EKCPQYWPPEG----------- 943 (1087)
T ss_pred CcccccchhhhcccC-CcceEEEecCCcccchHHHHHHhhccceeEEEEecccCcc--cccccccCCcC-----------
Confidence 123589999999986 5668999999999999999999999999999999998776 89999999632
Q ss_pred eeeeeccccccccCCCCCCcccccceeecceEEEEEEEEeecceEEEEEEEeecCCcceEEEEEEEeCCCCCCCCCCChh
Q psy10360 202 QITLKKREVEKCADYLPPSEVLDCHRVFGDFQITLKKREVREKYVISSLQIKNLETNLWRELTHVWYTNWPTTGVPNEES 281 (380)
Q Consensus 202 ~v~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~V~~~~~~~~~~~~~~~l~v~~~~~~~~~~v~h~~y~~Wpd~~vP~~~~ 281 (380)
...+|.++|+.........++.|.|.|++...+..++|.+|||++||..+.|+...
T Consensus 944 ------------------------~~~yg~i~Ve~~~~~~~~~~t~r~f~i~n~~~~~~r~v~qfq~~~WP~~~~~p~~~ 999 (1087)
T KOG4228|consen 944 ------------------------SQRYGPIEVEDMNEHINPQYTAREFGVTNEREKQSRTVRQFQFTGWPEYGKPPQSK 999 (1087)
T ss_pred ------------------------ceecCcEEEEecccccchhhhhhhheeeeccccCceEEEEEEecCCcccCcCCCCc
Confidence 45689999999999999999999999999998999999999999999988887766
Q ss_pred HHHHHHHHHHHHhhhhcCCCCCCEEEEcCCCCChhHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHhcCCCCCChhHHHHH
Q psy10360 282 SLIAFLIEARAHMKGAAGREAGPLVIHCSPGTGRTGTVLACDILIRHFETSRSVDVPRVVYNIRQCRAGAVATSQQYAFI 361 (380)
Q Consensus 282 ~~l~~i~~v~~~~~~~~~~~~~PivVHCs~GvGRtG~f~al~~~~~~l~~~~~vdv~~~v~~lR~qR~~~V~t~~Qy~fi 361 (380)
..+..+..+.+..+.... .+|++|||++|+||+|+|||+.+++++++.++.|||+++|+.||.+|++||++.+||.||
T Consensus 1000 ~~~~~i~~~~~~~q~~~~--~~P~~Vhc~nG~~rsg~f~ai~~l~e~~~~e~~vDVfq~vk~Lr~~rp~mv~t~~QY~fc 1077 (1087)
T KOG4228|consen 1000 GPISKIPSVASKWQQLGA--DGPIIVHCLNGVGRTGTFCAISILLERMRKEGVVDVFQTVKTLRFQRPGMVDTSDQYQFC 1077 (1087)
T ss_pred chhhhHHHHHHHHHhhcC--CCCEEEEEcCCCcceeehHHHHHHHHHHhhcCceeeehhhhhhhhcCccccCcHHHHHHH
Confidence 666665555444443322 799999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHH
Q psy10360 362 YRVLNVYAS 370 (380)
Q Consensus 362 y~~l~~y~~ 370 (380)
|+++++|+.
T Consensus 1078 Ydv~~~y~~ 1086 (1087)
T KOG4228|consen 1078 YDVALEYLG 1086 (1087)
T ss_pred HHHHHHhhc
Confidence 999999973
|
|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG2836|consensus | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >KOG1720|consensus | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG1718|consensus | Back alignment and domain information |
|---|
| >KOG1719|consensus | Back alignment and domain information |
|---|
| >KOG1716|consensus | Back alignment and domain information |
|---|
| >KOG2283|consensus | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >KOG1717|consensus | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >KOG4471|consensus | Back alignment and domain information |
|---|
| >KOG1572|consensus | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
| >KOG2386|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 380 | ||||
| 2a8b_A | 283 | Crystal Structure Of The Catalytic Domain Of Human | 1e-29 | ||
| 1nwl_A | 298 | Crystal Structure Of The Ptp1b Complexed With Sp734 | 4e-29 | ||
| 2gp0_A | 309 | Heptp Catalytic Domain (Residues 44-339), S225d Mut | 4e-29 | ||
| 1bzc_A | 321 | Human Ptp1b Catalytic Domain Complexed With Tpi Len | 5e-29 | ||
| 1bzh_A | 298 | Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 | 5e-29 | ||
| 2qdc_A | 309 | Crystal Structure Of The Heptp Catalytic Domain D23 | 5e-29 | ||
| 1zc0_A | 309 | Crystal Structure Of Human Hematopoietic Tyrosine P | 6e-29 | ||
| 3o4s_A | 308 | Crystal Structure Of Heptp With A Closed Wpd Loop A | 6e-29 | ||
| 2a3k_A | 296 | Crystal Structure Of The Human Protein Tyrosine Pho | 7e-29 | ||
| 2bij_A | 305 | Crystal Structure Of The Human Protein Tyrosine Pho | 7e-29 | ||
| 2nt7_A | 299 | Crystal Structure Of Ptp1b-inhibitor Complex Length | 8e-29 | ||
| 1g7f_A | 298 | Human Ptp1b Catalytic Domain Complexed With Pnu1774 | 9e-29 | ||
| 1jln_A | 297 | Crystal Structure Of The Catalytic Domain Of Protei | 1e-28 | ||
| 1c86_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 1e-28 | ||
| 1l8g_A | 321 | Crystal Structure Of Ptp1b Complexed With 7-(1,1-di | 1e-28 | ||
| 1ecv_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 1e-28 | ||
| 4i8n_A | 354 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 1e-28 | ||
| 2cma_A | 327 | Structural Basis For Inhibition Of Protein Tyrosine | 1e-28 | ||
| 1nl9_A | 321 | Potent, Selective Protein Tyrosine Phosphatase 1b I | 1e-28 | ||
| 3cwe_A | 290 | Ptp1b In Complex With A Phosphonic Acid Inhibitor L | 1e-28 | ||
| 1q6j_A | 310 | The Structure Of Phosphotyrosine Phosphatase 1b In | 1e-28 | ||
| 1bzj_A | 297 | Human Ptp1b Complexed With Tpicooh Length = 297 | 1e-28 | ||
| 2azr_A | 299 | Crystal Structure Of Ptp1b With Bicyclic Thiophene | 1e-28 | ||
| 1lqf_A | 295 | Structure Of Ptp1b In Complex With A Peptidic Bisph | 1e-28 | ||
| 2fjm_A | 310 | The Structure Of Phosphotyrosine Phosphatase 1b In | 1e-28 | ||
| 2f6f_A | 302 | The Structure Of The S295f Mutant Of Human Ptp1b Le | 1e-28 | ||
| 1g7g_A | 298 | Human Ptp1b Catalytic Domain Complexes With Pnu1793 | 1e-28 | ||
| 2cm2_A | 304 | Structure Of Protein Tyrosine Phosphatase 1b (P2121 | 1e-28 | ||
| 3sme_A | 300 | Structure Of Ptp1b Inactivated By H2o2BICARBONATE L | 2e-28 | ||
| 2qdm_A | 309 | Crystal Structure Of The Heptp Catalytic Domain C27 | 2e-28 | ||
| 2b3o_A | 532 | Crystal Structure Of Human Tyrosine Phosphatase Shp | 2e-28 | ||
| 1a5y_A | 330 | Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate | 2e-28 | ||
| 1gwz_A | 299 | Crystal Structure Of The Catalytic Domain Of The Pr | 2e-28 | ||
| 4gs0_A | 308 | Crystal Structure Of Shp1 Catalytic Domain With Jak | 2e-28 | ||
| 3i36_A | 342 | Crystal Structure Of Rat Protein Tyrosine Phosphata | 3e-28 | ||
| 2nz6_A | 316 | Crystal Structure Of The Ptprj Inactivating Mutant | 4e-28 | ||
| 3d42_A | 308 | Crystal Structure Of Heptp In Complex With A Monoph | 7e-28 | ||
| 2hvl_A | 309 | Crystal Structure Of The Heptp Catalytic Domain C27 | 7e-28 | ||
| 1gfy_A | 298 | Residue 259 Is A Key Determinant Of Substrate Speci | 9e-28 | ||
| 2cfv_A | 316 | Crystal Structure Of Human Protein Tyrosine Phospha | 1e-27 | ||
| 2ooq_A | 286 | Crystal Structure Of The Human Receptor Phosphatase | 1e-27 | ||
| 3ps5_A | 595 | Crystal Structure Of The Full-Length Human Protein | 1e-27 | ||
| 2cjz_A | 305 | Crystal Structure Of The C472s Mutant Of Human Prot | 1e-27 | ||
| 1ptv_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 1e-27 | ||
| 1g1f_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 1e-27 | ||
| 3qkp_A | 321 | Protein Tyrosine Phosphatase 1b - Apo W179f Mutant | 1e-27 | ||
| 2bv5_A | 282 | Crystal Structure Of The Human Protein Tyrosine Pho | 2e-27 | ||
| 1i57_A | 310 | Crystal Structure Of Apo Human Ptp1b (C215s) Mutant | 2e-27 | ||
| 1een_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 2e-27 | ||
| 1aax_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 2e-27 | ||
| 1rpm_A | 278 | Human Receptor Protein Tyrosine Phosphatase Mu, Dom | 2e-27 | ||
| 4gry_A | 288 | Crystal Structure Of Shp1 Catalytic Domain With Jak | 2e-27 | ||
| 1oeo_X | 321 | Ptp1b With The Catalytic Cysteine Oxidized To Sulfo | 2e-27 | ||
| 3eu0_A | 327 | Crystal Structure Of The S-Nitrosylated Cys215 Of P | 2e-27 | ||
| 1ptu_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 2e-27 | ||
| 1fpr_A | 284 | Crystal Structure Of The Complex Formed Between The | 2e-27 | ||
| 2c7s_A | 313 | Crystal Structure Of Human Protein Tyrosine Phospha | 3e-27 | ||
| 2pa5_A | 314 | Crystal Structure Of Human Protein Tyrosine Phospha | 3e-27 | ||
| 1pa1_A | 310 | Crystal Structure Of The C215d Mutant Of Protein Ty | 3e-27 | ||
| 3a5k_A | 304 | Crystal Structure Of Protein-Tyrosine Phosphatase 1 | 3e-27 | ||
| 1p15_A | 253 | Crystal Structure Of The D2 Domain Of Rptpa Length | 3e-27 | ||
| 3zv2_A | 320 | Human Protein-Tyrosine Phosphatase 1b C215a, S216a | 4e-27 | ||
| 1ygr_A | 610 | Crystal Structure Of The Tandem Phosphatase Domain | 1e-26 | ||
| 1l8k_A | 314 | T Cell Protein-Tyrosine Phosphatase Structure Lengt | 2e-26 | ||
| 3qcm_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 2e-26 | ||
| 3qcl_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 2e-26 | ||
| 1wch_A | 315 | Crystal Structure Of Ptpl1 Human Tyrosine Phosphata | 2e-26 | ||
| 2h4v_A | 320 | Crystal Structure Of The Human Tyrosine Receptor Ph | 3e-26 | ||
| 3qcb_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 3e-26 | ||
| 2pbn_A | 313 | Crystal Structure Of The Human Tyrosine Receptor Ph | 3e-26 | ||
| 2nlk_A | 627 | Crystal Structure Of D1 And D2 Catalytic Domains Of | 4e-26 | ||
| 2bzl_A | 325 | Crystal Structure Of The Human Protein Tyrosine Pho | 5e-26 | ||
| 3b7o_A | 316 | Crystal Structure Of The Human Tyrosine Phosphatase | 1e-25 | ||
| 3sr9_A | 583 | Crystal Structure Of Mouse Ptpsigma Length = 583 | 2e-25 | ||
| 3o5x_A | 276 | Crystal Structure Of The Oncogenic Tyrosine Phospha | 4e-25 | ||
| 3s3e_A | 307 | Crystal Structure Of The Catalytic Domain Of Ptp10d | 9e-25 | ||
| 1yfo_A | 302 | Receptor Protein Tyrosine Phosphatase Alpha, Domain | 1e-24 | ||
| 2hy3_A | 313 | Crystal Structure Of The Human Tyrosine Receptor Ph | 2e-24 | ||
| 2jjd_A | 599 | Protein Tyrosine Phosphatase, Receptor Type, E Isof | 2e-24 | ||
| 2shp_A | 525 | Tyrosine Phosphatase Shp-2 Length = 525 | 3e-24 | ||
| 2ahs_A | 295 | Crystal Structure Of The Catalytic Domain Of Human | 4e-24 | ||
| 2h02_A | 313 | Structural Studies Of Protein Tyrosine Phosphatase | 4e-24 | ||
| 2fh7_A | 595 | Crystal Structure Of The Phosphatase Domains Of Hum | 5e-24 | ||
| 2h03_A | 291 | Structural Studies Of Protein Tyrosine Phosphatase | 5e-24 | ||
| 1lar_A | 575 | Crystal Structure Of The Tandem Phosphatase Domains | 6e-24 | ||
| 2i75_A | 320 | Crystal Structure Of Human Protein Tyrosine Phospha | 1e-23 | ||
| 2g59_A | 297 | Crystal Structure Of The Catalytic Domain Of Protei | 2e-23 | ||
| 2gjt_A | 295 | Crystal Structure Of The Human Receptor Phosphatase | 3e-23 | ||
| 2pi7_A | 312 | Structure Of The Catalytic Domain Of The Chick Reti | 5e-23 | ||
| 2nv5_A | 299 | Crystal Structure Of A C-Terminal Phosphatase Domai | 3e-22 | ||
| 2qep_A | 304 | Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be | 5e-22 | ||
| 2i1y_A | 301 | Crystal Structure Of The Phosphatase Domain Of Huma | 2e-21 | ||
| 3h2x_A | 302 | Crystal Structure Of The Human Lymphoid Tyrosine Ph | 3e-20 | ||
| 2p6x_A | 309 | Crystal Structure Of Human Tyrosine Phosphatase Ptp | 3e-20 | ||
| 2qcj_A | 313 | Native Structure Of Lyp Length = 313 | 4e-20 | ||
| 2b49_A | 287 | Crystal Structure Of The Catalytic Domain Of Protei | 5e-20 | ||
| 2oc3_A | 303 | Crystal Structure Of The Catalytic Domain Of Human | 4e-19 | ||
| 3brh_A | 310 | Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To | 5e-19 | ||
| 3olr_A | 313 | Ptpn22 In Complex With Consensus Phospho-Tyrosine P | 6e-19 | ||
| 4az1_A | 302 | Crystal Structure Of The Trypanosoma Cruzi Protein | 4e-16 | ||
| 3m4u_A | 306 | Crystal Structure Of Trypanosoma Brucei Protein Tyr | 7e-12 | ||
| 2i6i_A | 161 | Crystal Structures Of The Archaeal Sulfolobus Ptp-F | 1e-05 | ||
| 1ohc_A | 348 | Structure Of The Proline Directed Phosphatase Cdc14 | 1e-04 | ||
| 2dxp_A | 161 | Crystal Structure Of The Complex Of The Archaeal Su | 1e-04 |
| >pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 | Back alignment and structure |
|
| >pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 | Back alignment and structure |
| >pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 | Back alignment and structure |
| >pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 | Back alignment and structure |
| >pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 | Back alignment and structure |
| >pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 | Back alignment and structure |
| >pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 | Back alignment and structure |
| >pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 | Back alignment and structure |
| >pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 | Back alignment and structure |
| >pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 | Back alignment and structure |
| >pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 | Back alignment and structure |
| >pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 | Back alignment and structure |
| >pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 | Back alignment and structure |
| >pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 | Back alignment and structure |
| >pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 | Back alignment and structure |
| >pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 | Back alignment and structure |
| >pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 | Back alignment and structure |
| >pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 | Back alignment and structure |
| >pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 | Back alignment and structure |
| >pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 | Back alignment and structure |
| >pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 | Back alignment and structure |
| >pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 | Back alignment and structure |
| >pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 | Back alignment and structure |
| >pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 | Back alignment and structure |
| >pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 | Back alignment and structure |
| >pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 | Back alignment and structure |
| >pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 | Back alignment and structure |
| >pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 | Back alignment and structure |
| >pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 | Back alignment and structure |
| >pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 | Back alignment and structure |
| >pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 | Back alignment and structure |
| >pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 | Back alignment and structure |
| >pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 | Back alignment and structure |
| >pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 | Back alignment and structure |
| >pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 | Back alignment and structure |
| >pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 | Back alignment and structure |
| >pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 | Back alignment and structure |
| >pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 | Back alignment and structure |
| >pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 | Back alignment and structure |
| >pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 | Back alignment and structure |
| >pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 | Back alignment and structure |
| >pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 | Back alignment and structure |
| >pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 | Back alignment and structure |
| >pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 | Back alignment and structure |
| >pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 | Back alignment and structure |
| >pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 | Back alignment and structure |
| >pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 | Back alignment and structure |
| >pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 | Back alignment and structure |
| >pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 | Back alignment and structure |
| >pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 | Back alignment and structure |
| >pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 | Back alignment and structure |
| >pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 | Back alignment and structure |
| >pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 | Back alignment and structure |
| >pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 | Back alignment and structure |
| >pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 | Back alignment and structure |
| >pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 | Back alignment and structure |
| >pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 | Back alignment and structure |
| >pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 | Back alignment and structure |
| >pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 | Back alignment and structure |
| >pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 | Back alignment and structure |
| >pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 | Back alignment and structure |
| >pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 | Back alignment and structure |
| >pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 | Back alignment and structure |
| >pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 | Back alignment and structure |
| >pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 | Back alignment and structure |
| >pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 | Back alignment and structure |
| >pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 | Back alignment and structure |
| >pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 | Back alignment and structure |
| >pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 | Back alignment and structure |
| >pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 | Back alignment and structure |
| >pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 | Back alignment and structure |
| >pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 | Back alignment and structure |
| >pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 | Back alignment and structure |
| >pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 | Back alignment and structure |
| >pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 | Back alignment and structure |
| >pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 | Back alignment and structure |
| >pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 | Back alignment and structure |
| >pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 | Back alignment and structure |
| >pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 | Back alignment and structure |
| >pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 | Back alignment and structure |
| >pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 | Back alignment and structure |
| >pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 | Back alignment and structure |
| >pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 | Back alignment and structure |
| >pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 | Back alignment and structure |
| >pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 | Back alignment and structure |
| >pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 | Back alignment and structure |
| >pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 | Back alignment and structure |
| >pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 | Back alignment and structure |
| >pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 | Back alignment and structure |
| >pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 | Back alignment and structure |
| >pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 | Back alignment and structure |
| >pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 | Back alignment and structure |
| >pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 | Back alignment and structure |
| >pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 | Back alignment and structure |
| >pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 | Back alignment and structure |
| >pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 | Back alignment and structure |
| >pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 | Back alignment and structure |
| >pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 | Back alignment and structure |
| >pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 | Back alignment and structure |
| >pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 | Back alignment and structure |
| >pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 | Back alignment and structure |
| >pdb|2I6I|A Chain A, Crystal Structures Of The Archaeal Sulfolobus Ptp-Fold Phosphatase Length = 161 | Back alignment and structure |
| >pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14 Length = 348 | Back alignment and structure |
| >pdb|2DXP|A Chain A, Crystal Structure Of The Complex Of The Archaeal Sulfolobus Ptp-Fold Phosphatase With Phosphopeptides A-(P)y-R Length = 161 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
Score = 244 bits (625), Expect = 8e-79
Identities = 81/360 (22%), Positives = 128/360 (35%), Gaps = 123/360 (34%)
Query: 12 DKNRYANVIPIPETRVRLCSGGEAASDSEDYINANYVRGPKGEEKFYIACQAPLQNTIED 71
+++R V+P E RV L E + YINA++++ G
Sbjct: 73 ERSRIREVVPYEENRVELIPTKENNTG---YINASHIKVVVG------------------ 111
Query: 72 FWRMIWTHQSKVILMITALFENSGPKGEEKFYIACQAPLQNTIEDFYFGAMKQSLIFAEF 131
G E YIA Q
Sbjct: 112 --------------------------GAEWHYIATQG----------------------- 122
Query: 132 STGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQSKVILMITALFENSVEKCADYLPPSEV 191
PL +T DFW+M+W VI M+TA E K
Sbjct: 123 ----------------PLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTK---------- 156
Query: 192 LDCHRVFGDFQITLKKREVEKCADYLPPSEVLDCHRVFGDFQITLKKREVREKYVISSLQ 251
HR Y P +G F++T K R Y + L+
Sbjct: 157 --SHR-------------------YWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLK 195
Query: 252 IKNLETNLWRELTHVWYTNWPTTGVPNEESSLIAFLIEARAHMK------GAAGREAGPL 305
+K+L + R + H+ YT+WP G P + +++L E ++ + P+
Sbjct: 196 VKHLLSGQERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPI 255
Query: 306 VIHCSPGTGRTGTVLACDILIRHFETSRSVDVPRVVYNIRQCRAGAVATSQQYAFIYRVL 365
V+HCS G GRTG ++ +++I E + V+VP ++ +R+ R + T QY F+Y+VL
Sbjct: 256 VVHCSAGVGRTGVLILSELMIYCLEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVL 315
|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 | Back alignment and structure |
|---|
| >2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 380 | |||
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 100.0 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 100.0 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 100.0 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 100.0 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 100.0 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 100.0 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 100.0 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 100.0 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 100.0 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 100.0 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 100.0 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 100.0 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 100.0 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 100.0 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 100.0 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 100.0 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 100.0 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 100.0 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 100.0 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 100.0 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 100.0 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 100.0 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 100.0 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 100.0 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 100.0 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 100.0 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 100.0 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 100.0 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 100.0 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 100.0 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 100.0 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 100.0 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 100.0 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 100.0 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 100.0 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 100.0 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 100.0 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 100.0 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 100.0 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 100.0 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.96 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.9 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.87 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.74 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.57 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.5 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.45 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.45 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.42 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.37 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.34 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.33 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.31 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.28 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 99.18 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 99.15 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 99.15 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 99.14 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 99.14 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 99.13 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 99.12 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 99.1 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 99.09 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 99.09 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.09 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 99.07 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 99.06 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 99.06 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 99.06 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 99.05 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 99.03 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.02 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.02 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 99.01 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 99.0 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 98.99 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 98.98 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 98.97 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 98.95 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 98.95 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 98.94 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 98.94 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 98.94 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 98.94 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 98.92 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 98.91 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 98.9 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 98.89 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 98.89 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 98.88 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 98.88 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 98.88 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 98.86 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 98.82 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 98.81 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 98.8 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 98.79 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 98.78 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 98.77 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 98.76 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 98.73 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 98.72 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 98.68 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 98.64 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 98.59 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 98.52 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 98.45 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 98.39 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 98.28 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 98.26 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 98.25 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 98.09 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 97.97 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 97.95 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 97.76 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 96.98 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 96.12 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 93.8 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 93.62 | |
| 1zsq_A | 528 | Myotubularin-related protein 2; protein-phospholip | 85.67 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 84.83 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 83.32 | |
| 1lw3_A | 657 | Myotubularin-related protein 2; protein-phosphate | 82.96 |
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-84 Score=664.19 Aligned_cols=332 Identities=32% Similarity=0.594 Sum_probs=286.6
Q ss_pred CCCCCCcCCCCCCCCCCCCCCeeEecCCCCCCCCCCCceeecccCCCCCCCceEEEeCCCCcCCHHHHHHHHHhcCCcEE
Q psy10360 5 ELPPGTEDKNRYANVIPIPETRVRLCSGGEAASDSEDYINANYVRGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQSKVI 84 (380)
Q Consensus 5 ~~~~~n~~kNR~~~i~p~d~sRV~L~~~~~~~~~~~~YINAs~v~~~~~~~~~~I~tQ~P~~~t~~dFW~mi~~~~~~~i 84 (380)
+..|+|..||||.||+|||||||+|.+.++. +++||||||||+|+..+++ ||||||||++|+.|||+||||+++.+|
T Consensus 49 ~~~~~n~~kNRy~~i~p~d~sRV~L~~~~~~--~~~dYINAn~I~~~~~~~~-yIatQgPl~~T~~dFW~MVwe~~~~~I 125 (599)
T 2jjd_A 49 ANKEENREKNRYPNILPNDHSRVILSQLDGI--PCSDYINASYIDGYKEKNK-FIAAQGPKQETVNDFWRMVWEQKSATI 125 (599)
T ss_dssp TTCGGGGGGCSSTTSCCCSSSEEECCCC-CC--TTTTEEEEEEEEETTEEEE-EEEECCCCGGGHHHHHHHHHHTTCCEE
T ss_pred hcChhhhhcCCCCCcCCCcceEEEEecCCCC--CCCCeeEeEecccCCCcce-eEEcCCCChhhHHHHHHHHccCCCCEE
Confidence 4568899999999999999999999876553 4689999999999987644 999999999999999999999999999
Q ss_pred EEeccccccCCCcccccee-------------------------------------------------------------
Q psy10360 85 LMITALFENSGPKGEEKFY------------------------------------------------------------- 103 (380)
Q Consensus 85 v~~~~~~e~~~~~~~~~~~------------------------------------------------------------- 103 (380)
|||+.+.|.++.||++||+
T Consensus 126 VMLt~~~E~g~~kc~~YwP~~~~~~~g~~~v~~~~~~~~~~~~~r~~~v~~~~~~~~~~~r~v~h~~y~~WpD~gvP~~~ 205 (599)
T 2jjd_A 126 VMLTNLKERKEEKCHQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQPQLPDGCKAPRLVSQLHFTSWPDFGVPFTP 205 (599)
T ss_dssp EECSCSEETTEECSCCCSCSSSEEEETTEEEEEEEEEECSSEEEEEEEEBC------CCCEEEEEEEECCCCSSSCCSCS
T ss_pred EEcccceeCCeEhhhhhCCCCCCceeccEEEEEEEEEEecceEEEEEEEEEeccCCCCcceEEEEEEeCCCCCCCCCCCh
Confidence 9999999998888765431
Q ss_pred ----------------------ecccCCCccc--------------------------------------eeeeec----
Q psy10360 104 ----------------------IACQAPLQNT--------------------------------------IEDFYF---- 119 (380)
Q Consensus 104 ----------------------~~~~~~~~~~--------------------------------------~~~~~~---- 119 (380)
|||+||.||| .+||.|
T Consensus 206 ~~~l~~~~~v~~~~~~~~~PivVHCsaGvGRTGtfiaid~~l~~l~~~~~v~v~~~v~~lR~qR~~~Vqt~~Qy~f~y~~ 285 (599)
T 2jjd_A 206 IGMLKFLKKVKTLNPVHAGPIVVHCSAGVGRTGTFIVIDAMMAMMHAEQKVDVFEFVSRIRNQRPQMVQTDMQYTFIYQA 285 (599)
T ss_dssp HHHHHHHHHHHHHSCTTCCCEEEECSSSSSHHHHHHHHHHHHHHHHHHSEECHHHHHHHHHTTSTTCSCCHHHHHHHHHH
T ss_pred HHHHHHHHHHHhhccCCCceEEEEeCCCCcccchhhHHHHHHHHHhccCCcCHHHHHHHHHHhhhccccchHHheeeeee
Confidence 8999999997 001000
Q ss_pred -------c----------------------------------------------------------------------cc
Q psy10360 120 -------G----------------------------------------------------------------------AM 122 (380)
Q Consensus 120 -------~----------------------------------------------------------------------~~ 122 (380)
+ .+
T Consensus 286 l~~~~~~g~TeI~v~~le~hl~~L~~~~~~~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~~N~~KNRy~~i~p~D~sRV~L 365 (599)
T 2jjd_A 286 LLEYYLYGDTELDVSSLEKHLQTMHGTTTHFDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNRVIL 365 (599)
T ss_dssp HHHHHHTCCCCEETTC------------------CHHHHHHHHHTSCCCSTTCHHHHSHHHHTTCSSTTSCCCSSSEEEC
T ss_pred hhhhhcccccccccccccchhhhhcccccccchhHHHHHHHHhhcccccccccccccChhhhhcCCCCCcCCCcCCeEEe
Confidence 0 01
Q ss_pred -------ccceEEeEeecCCCCCcceEEEecCCCCCcHHHHHHHHHhCCCcEEEEcCCCccCCcccccccCCCCcccccc
Q psy10360 123 -------KQSLIFAEFSTGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQSKVILMITALFENSVEKCADYLPPSEVLDCH 195 (380)
Q Consensus 123 -------~~~~i~a~~~~~~~~~~~~yI~tQ~Pl~~T~~dFW~mV~~~~v~~IVmL~~~~E~~~~kc~~YwP~~~~~~~~ 195 (380)
.+.+|||+|++|+.. ++.|||||+|+++|++|||+|||++++++|||||...|.++.||.+|||.+.
T Consensus 366 ~~~~~~~~~dYINAs~I~g~~~-~~~yIatQgPl~~T~~dFW~MVwe~~~~~IVMLt~~~E~g~~kc~~YwP~~~----- 439 (599)
T 2jjd_A 366 SMKRGQEYTDYINASFIDGYRQ-KDYFIATQGPLAHTVEDFWRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEG----- 439 (599)
T ss_dssp CC-----CTTEEEEEEECCSSS-TTCEEEECCCCTTTHHHHHHHHHHTTCCEEEECSCSEETTEECCCCCSCSSS-----
T ss_pred ccCCCCccccccceEEEecccc-cCeEEEeCCCCccchhHHHHhHhhcCCcEEEEecccccCCcccceEEecCCC-----
Confidence 146899999999864 4689999999999999999999999999999999999999999999999642
Q ss_pred ccccceeeeeeccccccccCCCCCCcccccceeecceEEEEEEEEeecceEEEEEEEeecC-----CcceEEEEEEEeCC
Q psy10360 196 RVFGDFQITLKKREVEKCADYLPPSEVLDCHRVFGDFQITLKKREVREKYVISSLQIKNLE-----TNLWRELTHVWYTN 270 (380)
Q Consensus 196 ~~~g~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~V~~~~~~~~~~~~~~~l~v~~~~-----~~~~~~v~h~~y~~ 270 (380)
...+|.|+|++.+......+++|.|.+++.+ .++.|.|+||||++
T Consensus 440 ------------------------------~~~~g~~~V~~~~~~~~~~~~~r~~~v~~~~~~~~~~~~~r~V~h~~y~~ 489 (599)
T 2jjd_A 440 ------------------------------SVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQGEQVRVVRQFHFHG 489 (599)
T ss_dssp ------------------------------EEEETTEEEEEEEEEECSSEEEEEEEEEEC------CTTEEEEEEEEECC
T ss_pred ------------------------------ceEEccEEEEEEEEEecCCEEEEEEEEEECcccccCCCccEEEEEEEECC
Confidence 3578999999999999999999999998765 67889999999999
Q ss_pred CCCCCCCCChhHHHHHHHHHHHHhhhhcCCCCCCEEEEcCCCCChhHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHhcCC
Q psy10360 271 WPTTGVPNEESSLIAFLIEARAHMKGAAGREAGPLVIHCSPGTGRTGTVLACDILIRHFETSRSVDVPRVVYNIRQCRAG 350 (380)
Q Consensus 271 Wpd~~vP~~~~~~l~~i~~v~~~~~~~~~~~~~PivVHCs~GvGRtG~f~al~~~~~~l~~~~~vdv~~~v~~lR~qR~~ 350 (380)
|||+|+|.++..+++|+..+++..... ..+|||||||+|+||||+|||+++++++++.++.+|++++|+.||+||++
T Consensus 490 WPD~gvP~~~~~ll~~i~~v~~~~~~~---~~~PivVHCsaGvGRTGtfiaid~~l~~l~~~~~vdv~~~V~~lR~qR~~ 566 (599)
T 2jjd_A 490 WPEIGIPAEGKGMIDLIAAVQKQQQQT---GNHPITVHCSAGAGRTGTFIALSNILERVKAEGLLDVFQAVKSLRLQRPH 566 (599)
T ss_dssp SCSSSCCSCCHHHHHHHHHHHHHHHHS---TTCCEEEECSSSSSHHHHHHHHHHHHHHHHHHSEECHHHHHHHHHTTSTT
T ss_pred CCCCCCCCChHHHHHHHHHHHHHHhcc---CCCcEEEEeCCCCchHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHhhCcc
Confidence 999999999999999999988764322 36899999999999999999999999999999999999999999999999
Q ss_pred CCCChhHHHHHHHHHHHHHHHhcCCCCC
Q psy10360 351 AVATSQQYAFIYRVLNVYASKLTGGALD 378 (380)
Q Consensus 351 ~V~t~~Qy~fiy~~l~~y~~~~~~~~~~ 378 (380)
||||.+||.|||++|++|+..+.+.+.+
T Consensus 567 mVqt~~QY~F~y~~l~~~l~~~~~~~~~ 594 (599)
T 2jjd_A 567 MVQTLEQYEFCYKVVQDFIDIFSDYAAH 594 (599)
T ss_dssp SSCSHHHHHHHHHHHHHHHC--------
T ss_pred ccCCHHHHHHHHHHHHHHHHhcCccchh
Confidence 9999999999999999999988766543
|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 380 | ||||
| d1p15a_ | 245 | c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { | 3e-45 | |
| d1jlna_ | 297 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 3e-45 | |
| d1lara2 | 249 | c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie | 7e-45 | |
| d1g4us2 | 243 | c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca | 1e-44 | |
| d2f71a1 | 297 | c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho | 2e-44 | |
| d2f71a1 | 297 | c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho | 5e-25 | |
| d2shpa1 | 307 | c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( | 4e-44 | |
| d2shpa1 | 307 | c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( | 4e-21 | |
| d1rpma_ | 278 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 5e-44 | |
| d1wcha_ | 308 | c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re | 8e-44 | |
| d1l8ka_ | 273 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 1e-43 | |
| d1l8ka_ | 273 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 2e-22 | |
| d1lyva_ | 283 | c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c | 6e-43 | |
| d1yfoa_ | 288 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 3e-42 | |
| d1fpra_ | 284 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 8e-42 | |
| d1lara1 | 317 | c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie | 3e-41 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 1e-09 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 2e-09 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 2e-05 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 2e-05 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 3e-09 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 1e-07 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 0.002 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 1e-06 |
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Higher-molecular-weight phosphotyrosine protein phosphatases domain: Protein-tyrosine phosphatase alpha species: Mouse (Mus musculus) [TaxId: 10090]
Score = 153 bits (388), Expect = 3e-45
Identities = 82/361 (22%), Positives = 127/361 (35%), Gaps = 125/361 (34%)
Query: 8 PGTEDKNRYANVIPIPETRVRLCSGGEAASDSEDYINANYVRGPKGEEKFYIACQAPLQN 67
P KNR +IP RV + + ++ DY+NA+++ G + ++
Sbjct: 7 PANMKKNRVLQIIPYEFNRVIIPV--KRGEENTDYVNASFIDGYRQKDS----------- 53
Query: 68 TIEDFWRMIWTHQSKVILMITALFENSGPKGEEKFYIACQAPLQNTIEDFYFGAMKQSLI 127
YIA Q
Sbjct: 54 -----------------------------------YIASQG------------------- 59
Query: 128 FAEFSTGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQSKVILMITALFENSVEKCADYLP 187
PL +TIEDFWRMIW +S I+M+T L E EKCA Y P
Sbjct: 60 --------------------PLLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWP 99
Query: 188 PSEVLDCHRVFGDFQITLKKREVEKCADYLPPSEVLDCHRVFGDFQITLKKREVREKYVI 247
++ +GD + LKK E E Y +
Sbjct: 100 SDGLVS-----------------------------------YGDITVELKKEEECESYTV 124
Query: 248 SSLQIKNLETNLWRELTHVWYTNWPTTGVPNEESSLIAFLIEARAHMKGAAGREAGPLVI 307
L + N N R++ + WP G+P++ +I + + + + P+ +
Sbjct: 125 RDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMINIIAAVQKQQQQSGNH---PITV 181
Query: 308 HCSPGTGRTGTVLACDILIRHFETSRSVDVPRVVYNIRQCRAGAVATSQQYAFIYRVLNV 367
HCS G GRTGT A ++ + +DV + V ++R R V T +QY F Y+V+
Sbjct: 182 HCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQE 241
Query: 368 Y 368
Y
Sbjct: 242 Y 242
|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 380 | |||
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 100.0 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 100.0 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 100.0 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 100.0 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 100.0 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 100.0 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 100.0 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 100.0 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 100.0 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 100.0 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 100.0 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.9 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 99.8 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.62 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.47 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.46 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 99.05 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.02 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 98.92 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 98.87 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 98.85 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 98.84 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 98.8 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 98.79 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 98.79 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 98.78 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.78 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 98.78 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 98.61 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 98.6 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 98.55 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 98.44 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 98.32 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 97.88 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 95.45 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 88.43 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 83.99 |
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Higher-molecular-weight phosphotyrosine protein phosphatases domain: Protein-tyrosine phosphatase alpha species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=5.6e-71 Score=504.34 Aligned_cols=240 Identities=34% Similarity=0.630 Sum_probs=218.4
Q ss_pred CCCCCcCCCCCCCCCCCCCCeeEecCCCCCCCCCCCceeecccCCCCCCCceEEEeCCCCcCCHHHHHHHHHhcCCcEEE
Q psy10360 6 LPPGTEDKNRYANVIPIPETRVRLCSGGEAASDSEDYINANYVRGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQSKVIL 85 (380)
Q Consensus 6 ~~~~n~~kNR~~~i~p~d~sRV~L~~~~~~~~~~~~YINAs~v~~~~~~~~~~I~tQ~P~~~t~~dFW~mi~~~~~~~iv 85 (380)
-+|+|..||||+||+|||||||+|++.++. +++||||||||+|+...++ ||+||+|+++|++|||+|||++++++
T Consensus 5 ~lp~N~~KNRy~di~p~D~sRV~L~~~~~~--~~~dYINAs~V~g~~~~~~-yI~tQ~P~~~T~~dFW~Mv~~~~~~~-- 79 (245)
T d1p15a_ 5 NLPANMKKNRVLQIIPYEFNRVIIPVKRGE--ENTDYVNASFIDGYRQKDS-YIASQGPLLHTIEDFWRMIWEWKSCS-- 79 (245)
T ss_dssp GSTTTSTTCSCSSCCCCTTSBCCCCCCSSS--SSTTCCSEEEECCSSCTTC-EEEECCCCSSSHHHHHHHHHHTTCCE--
T ss_pred cCccccccCCCCCCCCCcCCEEEecCCCCC--CCCceEEEEeecCCCCCCe-eEEECCCCccchhhHhhheecCCCCE--
Confidence 358899999999999999999999876654 5789999999999988755 99999999999999999999999888
Q ss_pred EeccccccCCCccccceeecccCCCccceeeeeccccccceEEeEeecCCCCCcceEEEecCCCCCcHHHHHHHHHhCCC
Q psy10360 86 MITALFENSGPKGEEKFYIACQAPLQNTIEDFYFGAMKQSLIFAEFSTGPKGEEKFYIACQAPLQNTIEDFWRMIWTHQS 165 (380)
Q Consensus 86 ~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~a~~~~~~~~~~~~yI~tQ~Pl~~T~~dFW~mV~~~~v 165 (380)
T Consensus 80 -------------------------------------------------------------------------------- 79 (245)
T d1p15a_ 80 -------------------------------------------------------------------------------- 79 (245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred cEEEEcCCCccCCcccccccCCCCccccccccccceeeeeeccccccccCCCCCCcccccceeecceEEEEEEEEeecce
Q psy10360 166 KVILMITALFENSVEKCADYLPPSEVLDCHRVFGDFQITLKKREVEKCADYLPPSEVLDCHRVFGDFQITLKKREVREKY 245 (380)
Q Consensus 166 ~~IVmL~~~~E~~~~kc~~YwP~~~~~~~~~~~g~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~V~~~~~~~~~~~ 245 (380)
||||++..|.+..+|.+|||.+. ...+|.|+|++.+.+....+
T Consensus 80 --IVmL~~~~e~~~~~~~~y~p~~~-----------------------------------~~~~~~~~v~~~~~~~~~~~ 122 (245)
T d1p15a_ 80 --IVMLTELEERGQEKCAQYWPSDG-----------------------------------LVSYGDITVELKKEEECESY 122 (245)
T ss_dssp --EEECSCSCSSSSCCSCCCSCSSS-----------------------------------CCEETTEECCSCCCEECSSE
T ss_pred --EEEEeccccCCCcccccccCCCC-----------------------------------ceEeccEEEEEEEEEEcCCc
Confidence 88888888999999999999653 45678899998888888999
Q ss_pred EEEEEEEeecCCcceEEEEEEEeCCCCCCCCCCChhHHHHHHHHHHHHhhhhcCCCCCCEEEEcCCCCChhHHHHHHHHH
Q psy10360 246 VISSLQIKNLETNLWRELTHVWYTNWPTTGVPNEESSLIAFLIEARAHMKGAAGREAGPLVIHCSPGTGRTGTVLACDIL 325 (380)
Q Consensus 246 ~~~~l~v~~~~~~~~~~v~h~~y~~Wpd~~vP~~~~~~l~~i~~v~~~~~~~~~~~~~PivVHCs~GvGRtG~f~al~~~ 325 (380)
+.|+|.|...+.++++.|+||||++||++++|.++..+++++..+++.... ...+||||||++|+||||+|||++++
T Consensus 123 ~~r~l~l~~~~~~~~~~v~~~~y~~Wpd~~~P~~~~~~l~~~~~v~~~~~~---~~~~PivVHCs~G~gRsg~f~a~~~~ 199 (245)
T d1p15a_ 123 TVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMINIIAAVQKQQQQ---SGNHPITVHCSAGAGRTGTFCALSTV 199 (245)
T ss_dssp EEEEEEEECSSCCEEEEEEEEEECCSCSSSCCSSSCSHHHHHHHHHHHTTT---TTSCCEEEESSSSSHHHHHHHHHHHH
T ss_pred eEEEEEEEECCCCceEEEEEEEecCCCccCCCCCHHHHHHHHHHHHhhhcc---CCCCCEEEEcCCCCccccHHHHHHHH
Confidence 999999998888899999999999999999999999999999998876432 23689999999999999999999999
Q ss_pred HHHHhhCCCCCHHHHHHHHHHhcCCCCCChhHHHHHHHHHHHHHH
Q psy10360 326 IRHFETSRSVDVPRVVYNIRQCRAGAVATSQQYAFIYRVLNVYAS 370 (380)
Q Consensus 326 ~~~l~~~~~vdv~~~v~~lR~qR~~~V~t~~Qy~fiy~~l~~y~~ 370 (380)
+++++.++.+||+++|+.||+||++||||++||.|||.+|++|+.
T Consensus 200 ~~~l~~~~~vdv~~~v~~lR~qR~~~vqt~~QY~f~y~~l~~yi~ 244 (245)
T d1p15a_ 200 LERVKAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYID 244 (245)
T ss_dssp HHHHHHHSCCCTTHHHHHHHTTSTTSSCSTTTTHHHHHHHHHTTT
T ss_pred HHHHHcCCCcCHHHHHHHHHHhcccccCCHHHHHHHHHHHHHHHh
Confidence 999999999999999999999999999999999999999999974
|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|