Psyllid ID: psy10470
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 209 | ||||||
| 348526830 | 88 | PREDICTED: acyl-CoA-binding protein homo | 0.205 | 0.488 | 0.720 | 5e-10 | |
| 46520169 | 87 | endozepine [Cyprinus carpio] | 0.210 | 0.505 | 0.727 | 5e-10 | |
| 374463484 | 88 | acyl-CoA binding protein [Onychostoma ma | 0.210 | 0.5 | 0.727 | 5e-10 | |
| 325302436 | 87 | diazepam-binding inhibitor [Carassius au | 0.210 | 0.505 | 0.727 | 6e-10 | |
| 260814787 | 87 | hypothetical protein BRAFLDRAFT_98944 [B | 0.210 | 0.505 | 0.704 | 2e-09 | |
| 209489210 | 86 | hypothetical protein Cbre_JD01.002 [Caen | 0.205 | 0.5 | 0.720 | 2e-09 | |
| 17506027 | 86 | Protein ACBP-1 [Caenorhabditis elegans] | 0.210 | 0.511 | 0.681 | 2e-09 | |
| 157137608 | 107 | diazepam binding inhibitor, putative [Ae | 0.220 | 0.429 | 0.673 | 2e-09 | |
| 145348479 | 87 | predicted protein [Ostreococcus lucimari | 0.215 | 0.517 | 0.644 | 3e-09 | |
| 24582714 | 90 | CG8498 [Drosophila melanogaster] gi|7297 | 0.220 | 0.511 | 0.695 | 3e-09 |
| >gi|348526830|ref|XP_003450922.1| PREDICTED: acyl-CoA-binding protein homolog [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
Score = 70.1 bits (170), Expect = 5e-10, Method: Compositional matrix adjust.
Identities = 31/43 (72%), Positives = 38/43 (88%)
Query: 165 KPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYG 207
+PGMLD KGKAKW+AWESRKG SK+DA +AYIAK E+++KYG
Sbjct: 45 RPGMLDLKGKAKWDAWESRKGMSKEDAMSAYIAKAKEVISKYG 87
|
Source: Oreochromis niloticus Species: Oreochromis niloticus Genus: Oreochromis Family: Cichlidae Order: Perciformes Class: Actinopterygii Phylum: Chordata Superkingdom: Eukaryota |
| >gi|46520169|gb|AAT00460.1| endozepine [Cyprinus carpio] | Back alignment and taxonomy information |
|---|
| >gi|374463484|gb|AEZ53129.1| acyl-CoA binding protein [Onychostoma macrolepis] | Back alignment and taxonomy information |
|---|
| >gi|325302436|dbj|BAJ83550.1| diazepam-binding inhibitor [Carassius auratus] | Back alignment and taxonomy information |
|---|
| >gi|260814787|ref|XP_002602095.1| hypothetical protein BRAFLDRAFT_98944 [Branchiostoma floridae] gi|229287401|gb|EEN58107.1| hypothetical protein BRAFLDRAFT_98944 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|209489210|gb|ACI48995.1| hypothetical protein Cbre_JD01.002 [Caenorhabditis brenneri] gi|341883087|gb|EGT39022.1| CBN-ACBP-1 protein [Caenorhabditis brenneri] | Back alignment and taxonomy information |
|---|
| >gi|17506027|ref|NP_491412.1| Protein ACBP-1 [Caenorhabditis elegans] gi|5902716|sp|O01805.1|ACBP1_CAEEL RecName: Full=Acyl-CoA-binding protein homolog 1; Short=ACBP-1; AltName: Full=Diazepam-binding inhibitor homolog; Short=DBI gi|351059713|emb|CCD67306.1| Protein ACBP-1 [Caenorhabditis elegans] | Back alignment and taxonomy information |
|---|
| >gi|157137608|ref|XP_001664028.1| diazepam binding inhibitor, putative [Aedes aegypti] gi|108869663|gb|EAT33888.1| AAEL013844-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|145348479|ref|XP_001418675.1| predicted protein [Ostreococcus lucimarinus CCE9901] gi|144578905|gb|ABO96968.1| predicted protein [Ostreococcus lucimarinus CCE9901] | Back alignment and taxonomy information |
|---|
| >gi|24582714|ref|NP_609187.1| CG8498 [Drosophila melanogaster] gi|7297350|gb|AAF52610.1| CG8498 [Drosophila melanogaster] gi|68051679|gb|AAY85103.1| IP02950p [Drosophila melanogaster] gi|220951202|gb|ACL88144.1| CG8498-PA [synthetic construct] gi|220959924|gb|ACL92505.1| CG8498-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 209 | ||||||
| UNIPROTKB|F1NDC3 | 87 | DBI "Acyl-CoA-binding protein" | 0.296 | 0.712 | 0.555 | 5.6e-13 | |
| UNIPROTKB|F1NF81 | 86 | DBI "Acyl-CoA-binding protein" | 0.296 | 0.720 | 0.555 | 5.6e-13 | |
| UNIPROTKB|Q9PRL8 | 86 | DBI "Acyl-CoA-binding protein" | 0.296 | 0.720 | 0.555 | 5.6e-13 | |
| WB|WBGene00016655 | 86 | acbp-1 [Caenorhabditis elegans | 0.205 | 0.5 | 0.697 | 5.6e-13 | |
| FB|FBgn0031992 | 90 | CG8498 [Drosophila melanogaste | 0.215 | 0.5 | 0.711 | 1.2e-12 | |
| ZFIN|ZDB-GENE-040426-1861 | 87 | dbi "diazepam binding inhibito | 0.210 | 0.505 | 0.681 | 1.2e-12 | |
| UNIPROTKB|P07107 | 87 | DBI "Acyl-CoA-binding protein" | 0.205 | 0.494 | 0.697 | 6.4e-12 | |
| ZFIN|ZDB-GENE-050913-108 | 88 | acbd7 "acyl-Coenzyme A binding | 0.301 | 0.715 | 0.5 | 1.3e-11 | |
| UNIPROTKB|Q8N6N7 | 88 | ACBD7 "Acyl-CoA-binding domain | 0.200 | 0.477 | 0.666 | 2.2e-11 | |
| UNIPROTKB|P07108 | 87 | DBI "Acyl-CoA-binding protein" | 0.205 | 0.494 | 0.674 | 2.8e-11 |
| UNIPROTKB|F1NDC3 DBI "Acyl-CoA-binding protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 171 (65.3 bits), Expect = 5.6e-13, P = 5.6e-13
Identities = 35/63 (55%), Positives = 41/63 (65%)
Query: 145 MLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVA 204
MLD K +A +PGMLDFKGKAKW+AW + KG SK+DA AY+AKV EL
Sbjct: 25 MLDVYSHYK-QATVGDVNTDRPGMLDFKGKAKWDAWNALKGMSKEDAMKAYVAKVEELKG 83
Query: 205 KYG 207
KYG
Sbjct: 84 KYG 86
|
|
| UNIPROTKB|F1NF81 DBI "Acyl-CoA-binding protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9PRL8 DBI "Acyl-CoA-binding protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00016655 acbp-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031992 CG8498 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1861 dbi "diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07107 DBI "Acyl-CoA-binding protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050913-108 acbd7 "acyl-Coenzyme A binding domain containing 7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8N6N7 ACBD7 "Acyl-CoA-binding domain-containing protein 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07108 DBI "Acyl-CoA-binding protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 209 | |||
| cd00435 | 85 | cd00435, ACBP, Acyl CoA binding protein (ACBP) bin | 3e-18 | |
| pfam00887 | 87 | pfam00887, ACBP, Acyl CoA binding protein | 1e-16 | |
| COG4281 | 87 | COG4281, ACB, Acyl-CoA-binding protein [Lipid meta | 2e-13 |
| >gnl|CDD|238248 cd00435, ACBP, Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity | Back alignment and domain information |
|---|
Score = 75.4 bits (186), Expect = 3e-18
Identities = 29/44 (65%), Positives = 34/44 (77%)
Query: 164 SKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYG 207
+PGM D KG+AKW+AW S KG SK+DA AYIAKV EL+AKY
Sbjct: 42 ERPGMFDLKGRAKWDAWNSLKGMSKEDAMKAYIAKVEELIAKYA 85
|
Acyl-CoAs are important intermediates in fatty lipid synthesis and fatty acid degradation and play a role in regulation of intermediary metabolism and gene regulation. The suggested role of ACBP is to act as a intracellular acyl-CoA transporter and pool former. ACBPs are present in a large group of eukaryotic species and several tissue-specific isoforms have been detected. Length = 85 |
| >gnl|CDD|216174 pfam00887, ACBP, Acyl CoA binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226731 COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 209 | |||
| PTZ00458 | 90 | acyl CoA binding protein; Provisional | 99.96 | |
| cd00435 | 85 | ACBP Acyl CoA binding protein (ACBP) binds thiol e | 99.96 | |
| PF00887 | 87 | ACBP: Acyl CoA binding protein; InterPro: IPR00058 | 99.95 | |
| KOG0817|consensus | 142 | 99.93 | ||
| COG4281 | 87 | ACB Acyl-CoA-binding protein [Lipid metabolism] | 99.9 | |
| KOG3878|consensus | 469 | 99.34 | ||
| smart00295 | 207 | B41 Band 4.1 homologues. Also known as ezrin/radix | 96.76 | |
| PF00373 | 126 | FERM_M: FERM central domain; InterPro: IPR019748 T | 95.93 | |
| KOG3530|consensus | 616 | 88.07 |
| >PTZ00458 acyl CoA binding protein; Provisional | Back alignment and domain information |
|---|
Probab=99.96 E-value=8.3e-30 Score=194.69 Aligned_cols=86 Identities=22% Similarity=0.353 Sum_probs=79.9
Q ss_pred HHHHHHHHHHhhhhhccccccCCCCcchhhhHHHhhhcccccCCCCCCCCCCCChhHHHHHHHHhhCCCCCHHHHHHHHH
Q psy10470 117 RVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYI 196 (209)
Q Consensus 117 ~~FeeAvk~a~~~~~~~~~K~g~~s~d~kL~LYALYK~QAT~Gdcn~~kPG~~D~~graKwnAWkqlkgMSkeEAmkeYI 196 (209)
..|++|+..+. +.++.+.++++++|+|||||| |||+|||+.++||+||+++|+||+||++++|||++|||++||
T Consensus 3 ~~F~~A~~~v~-----~~~~~~~~s~d~~L~lYalyK-QAt~G~c~~~~P~~~d~~~raKw~AW~~l~~ms~~eA~~~YI 76 (90)
T PTZ00458 3 DLFEECVSFIN-----SLPKTVNLSVEIKLDLYKYYK-QSTVGNCNIKEPSMFKYQDRKKYEAWKSIENLNREDAKKRYV 76 (90)
T ss_pred HHHHHHHHHHH-----hCCCCCCCCHHHHHHHHHHHh-hhccCCCCCCCCCcccHHHHHHHHHHHHcCCCCHHHHHHHHH
Confidence 45999999987 344556789999999999999 999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhcC
Q psy10470 197 AKVVELVAKYGK 208 (209)
Q Consensus 197 elVeeL~pkyg~ 208 (209)
++|+++.|+|+.
T Consensus 77 ~l~~~l~~~w~~ 88 (90)
T PTZ00458 77 EIVTELFPNWEK 88 (90)
T ss_pred HHHHHHhhcccc
Confidence 999999999975
|
|
| >cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity | Back alignment and domain information |
|---|
| >PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] | Back alignment and domain information |
|---|
| >KOG0817|consensus | Back alignment and domain information |
|---|
| >COG4281 ACB Acyl-CoA-binding protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG3878|consensus | Back alignment and domain information |
|---|
| >smart00295 B41 Band 4 | Back alignment and domain information |
|---|
| >PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 | Back alignment and domain information |
|---|
| >KOG3530|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 209 | ||||
| 1hb6_A | 86 | Structure Of Bovine Acyl-Coa Binding Protein In Ort | 1e-10 | ||
| 2fdq_A | 86 | Crystal Structure Of Acbp From Armadillo Harderian | 2e-10 | ||
| 2cb8_A | 87 | High Resolution Crystal Structure Of Liganded Human | 3e-10 | ||
| 3epy_A | 89 | Crystal Structure Of Human Acyl-Coa Binding Domain | 3e-10 | ||
| 2fj9_A | 86 | High Resolution Crystal Structure Of The Unliganded | 3e-10 | ||
| 1st7_A | 86 | Solution Structure Of Acyl Coenzyme A Binding Prote | 4e-08 | ||
| 3fp5_A | 106 | Crystal Structure Of Acbp From Moniliophthora Perni | 9e-07 | ||
| 2lbb_A | 96 | Solution Structure Of Acyl Coa Binding Protein From | 8e-04 |
| >pdb|1HB6|A Chain A, Structure Of Bovine Acyl-Coa Binding Protein In Orthorhombic Crystal Form Length = 86 | Back alignment and structure |
|
| >pdb|2FDQ|A Chain A, Crystal Structure Of Acbp From Armadillo Harderian Gland Length = 86 | Back alignment and structure |
| >pdb|2CB8|A Chain A, High Resolution Crystal Structure Of Liganded Human L-Acbp Length = 87 | Back alignment and structure |
| >pdb|3EPY|A Chain A, Crystal Structure Of Human Acyl-Coa Binding Domain 7 Complexed With Palmitoyl-Coa Length = 89 | Back alignment and structure |
| >pdb|2FJ9|A Chain A, High Resolution Crystal Structure Of The Unliganded Human Acbp Length = 86 | Back alignment and structure |
| >pdb|1ST7|A Chain A, Solution Structure Of Acyl Coenzyme A Binding Protein From Yeast Length = 86 | Back alignment and structure |
| >pdb|3FP5|A Chain A, Crystal Structure Of Acbp From Moniliophthora Perniciosa Length = 106 | Back alignment and structure |
| >pdb|2LBB|A Chain A, Solution Structure Of Acyl Coa Binding Protein From Babesia Bovis T2bo Length = 96 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 209 | |||
| 3flv_A | 119 | Acyl-COA-binding domain-containing protein 5; lipi | 5e-14 | |
| 3epy_A | 89 | Acyl-COA-binding domain-containing protein 7; acyl | 8e-14 | |
| 2lbb_A | 96 | Acyl COA binding protein; protein binding, structu | 2e-13 | |
| 3fp5_A | 106 | Acyl-COA binding protein; ACBP, cacao disease, fat | 2e-13 | |
| 1st7_A | 86 | ACBP, acyl-COA-binding protein; four helix bundle, | 3e-13 | |
| 1hbk_A | 89 | ACBP, acyl-COA binding protein; fatty acid metabol | 4e-13 | |
| 2cb8_A | 87 | Acyl-COA-binding protein; acyl-coenzyme A binding | 4e-13 | |
| 2cqu_A | 116 | Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi | 1e-12 | |
| 2wh5_A | 106 | Acyl-COA-binding domain-containing protein 4; alte | 2e-12 | |
| 2cop_A | 109 | Acyl-coenzyme A binding domain containing 6; acyl | 3e-12 |
| >3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
Score = 65.1 bits (158), Expect = 5e-14
Identities = 14/47 (29%), Positives = 26/47 (55%)
Query: 163 RSKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYGKK 209
S+PG D G+ KW+AW S +K++A AY+ ++ +++
Sbjct: 68 LSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEMKKIIETMPMT 114
|
| >3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Length = 96 | Back alignment and structure |
|---|
| >3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} Length = 106 | Back alignment and structure |
|---|
| >1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Length = 86 | Back alignment and structure |
|---|
| >1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Length = 89 | Back alignment and structure |
|---|
| >2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Length = 87 | Back alignment and structure |
|---|
| >2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 209 | |||
| 1st7_A | 86 | ACBP, acyl-COA-binding protein; four helix bundle, | 99.97 | |
| 1hbk_A | 89 | ACBP, acyl-COA binding protein; fatty acid metabol | 99.97 | |
| 3epy_A | 89 | Acyl-COA-binding domain-containing protein 7; acyl | 99.97 | |
| 2cb8_A | 87 | Acyl-COA-binding protein; acyl-coenzyme A binding | 99.96 | |
| 2cop_A | 109 | Acyl-coenzyme A binding domain containing 6; acyl | 99.96 | |
| 3fp5_A | 106 | Acyl-COA binding protein; ACBP, cacao disease, fat | 99.96 | |
| 2lbb_A | 96 | Acyl COA binding protein; protein binding, structu | 99.96 | |
| 2wh5_A | 106 | Acyl-COA-binding domain-containing protein 4; alte | 99.96 | |
| 3flv_A | 119 | Acyl-COA-binding domain-containing protein 5; lipi | 99.96 | |
| 2cqu_A | 116 | Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi | 99.95 | |
| 1mix_A | 206 | Talin; focal adhesion, integrin binding, FERM doma | 98.23 | |
| 4f7g_A | 222 | Talin-1; alpha-helix bundle, integrin activation, | 95.77 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 95.54 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 95.43 | |
| 3qij_A | 296 | Protein 4.1; cytoskeleton, structural genomics, st | 95.29 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 94.19 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 93.65 | |
| 3au4_A | 555 | Myosin-X; protein-protein complex, motor protein c | 90.68 | |
| 4dxa_B | 322 | KREV interaction trapped protein 1; GTPase, FERM, | 86.4 |
| >1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.97 E-value=2.3e-31 Score=199.26 Aligned_cols=86 Identities=33% Similarity=0.587 Sum_probs=79.9
Q ss_pred hHHHHHHHHHHHhhhhhccccccCCCCcchhhhHHHhhhcccccCCCCCCCCCCCChhHHHHHHHHhhCCCCCHHHHHHH
Q psy10470 115 LDRVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAA 194 (209)
Q Consensus 115 Le~~FeeAvk~a~~~~~~~~~K~g~~s~d~kL~LYALYK~QAT~Gdcn~~kPG~~D~~graKwnAWkqlkgMSkeEAmke 194 (209)
|+..|++|+..+.+.. ..++++++|+|||||| |||+|||++++||+||++|++||+||++++|||++|||++
T Consensus 1 l~~~F~~A~~~v~~l~-------~~~~~~~~L~lYalyK-QAt~Gd~~~~~Pg~~d~~~raKw~AW~~l~gms~eeA~~~ 72 (86)
T 1st7_A 1 VSQLFEEKAKAVNELP-------TKPSTDELLELYALYK-QATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKE 72 (86)
T ss_dssp CHHHHHHHHHHHTSCS-------SCCCHHHHHHHHHHHH-HHHHCSCCCCCCCSSCHHHHHHHHHHHTTTTTHHHHHHHH
T ss_pred CHHHHHHHHHHHHHcc-------CCcCHHHHHHHHHHHH-HHhhCCCCCCCCCccCHHHHHHHHHHHHcCCCCHHHHHHH
Confidence 4678999999988433 3678999999999999 9999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhhcC
Q psy10470 195 YIAKVVELVAKYGK 208 (209)
Q Consensus 195 YIelVeeL~pkyg~ 208 (209)
||++|++++|+|++
T Consensus 73 YI~~v~~l~~~~~~ 86 (86)
T 1st7_A 73 YIALVDQLIAKYSS 86 (86)
T ss_dssp HHHHHHHHHHHHCC
T ss_pred HHHHHHHHhhhhcC
Confidence 99999999999985
|
| >1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 | Back alignment and structure |
|---|
| >3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1 | Back alignment and structure |
|---|
| >2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A | Back alignment and structure |
|---|
| >2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0 | Back alignment and structure |
|---|
| >2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} | Back alignment and structure |
|---|
| >2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B | Back alignment and structure |
|---|
| >4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A | Back alignment and structure |
|---|
| >4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 209 | ||||
| d1hb6a_ | 86 | a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos t | 6e-14 | |
| d1hbka_ | 89 | a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium | 9e-14 |
| >d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 86 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Acyl-CoA binding protein-like superfamily: Acyl-CoA binding protein family: Acyl-CoA binding protein domain: Acyl-CoA binding protein species: Cow (Bos taurus) [TaxId: 9913]
Score = 62.5 bits (152), Expect = 6e-14
Identities = 30/43 (69%), Positives = 33/43 (76%)
Query: 165 KPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYG 207
+PGMLDFKGKAKW+AW KG SK+DA AYI KV EL KYG
Sbjct: 43 RPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYG 85
|
| >d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Length = 89 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 209 | |||
| d1hbka_ | 89 | Acyl-CoA binding protein {Plasmodium falciparum [T | 99.96 | |
| d1hb6a_ | 86 | Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: | 99.96 | |
| d1mixa1 | 114 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 97.12 | |
| d1h4ra1 | 111 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 97.09 | |
| d1gg3a1 | 106 | Erythroid membrane protein 4.1R {Human (Homo sapie | 97.04 | |
| d1ef1a1 | 111 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 96.94 | |
| d2al6a1 | 123 | Focal adhesion kinase 1 {Chicken (Gallus gallus) [ | 93.29 |
| >d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Acyl-CoA binding protein-like superfamily: Acyl-CoA binding protein family: Acyl-CoA binding protein domain: Acyl-CoA binding protein species: Plasmodium falciparum [TaxId: 5833]
Probab=99.96 E-value=4.1e-30 Score=192.59 Aligned_cols=87 Identities=20% Similarity=0.284 Sum_probs=81.1
Q ss_pred hHHHHHHHHHHHhhhhhccccccCCCCcchhhhHHHhhhcccccCCCCCCCCCCCChhHHHHHHHHhhCCCCCHHHHHHH
Q psy10470 115 LDRVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAA 194 (209)
Q Consensus 115 Le~~FeeAvk~a~~~~~~~~~K~g~~s~d~kL~LYALYK~QAT~Gdcn~~kPG~~D~~graKwnAWkqlkgMSkeEAmke 194 (209)
|+..|++|+..++ +.++..+++++++|+|||||| |||+|||+.++||+||+++++||+||++++|||+++||+.
T Consensus 2 L~~~F~~A~~~v~-----~~~~~~~~~~~~~L~lY~lyK-Qat~G~~~~~~P~~~~~~~~~Kw~AW~~l~gms~~eA~~~ 75 (89)
T d1hbka_ 2 MAQVFEECVSFIN-----GLPRTINLPNELKLDLYKYYK-QSTIGNCNIKEPSAHKYIDRKKYEAWKSVENLNREDAQKR 75 (89)
T ss_dssp HHHHHHHHHHHHH-----HSCTTCCCCHHHHHHHHHHHH-HHHTCSCCSCCCCTTSHHHHHHHHHHHHTTTCCHHHHHHH
T ss_pred hHHHHHHHHHHHH-----hCCCCCCCCHHHHHHHHHHHH-HHhcCCCCCCCCCccCHHHHHHHHHHHHcCCCCHHHHHHH
Confidence 6788999999997 444556789999999999999 9999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhhc
Q psy10470 195 YIAKVVELVAKYG 207 (209)
Q Consensus 195 YIelVeeL~pkyg 207 (209)
||++|++++|+|.
T Consensus 76 Yi~~v~~l~p~w~ 88 (89)
T d1hbka_ 76 YVDIVSEIFPYWQ 88 (89)
T ss_dssp HHHHHHHHCTTTT
T ss_pred HHHHHHHHccccc
Confidence 9999999999984
|
| >d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|