Psyllid ID: psy10470


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MLPPWPRFEPSTSGLRVSALDSLDHSATEVGRTSTWMILIAYTQNSCQLYTKFRGKDSRKERREGERVITSSESKNSTACRRFCQSVGNNFLCSYVGAKISGKDLAYLRANNSGLDRVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYGKK
ccccccccccccccccEEEcccccccccccccccEEEEEHHHccccccHHHHHcccccHHHHHHcccEEccccccccHHHHHHHHHHHHHHHHHHHHcHHccccccHHccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccc
cccccccccccccccEEEccccccccccccccHHHHHHHHHHHccccEEEEEEcccccHHHHccccEEEEEcccccccHHHHHHHccccccEEEEccEEEccHHHHHHHHcccHHHHHHHHHHHHHcccccEHHHHHccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccc
mlppwprfepstsglrvsaldsldhsatevgrTSTWMILIAYTQNSCQLYTKfrgkdsrkerregervitssesknstACRRFCQSVGNNFLCSYVGAKISGKDLAYLRANNSGLDRVFRALSKKLGQHRlscafkskifgkpgmldfkgkAKWEAWesrkgrskpgmldfkgkAKWEAWesrkgqskdDAQAAYIAKVVELVAKYGKK
mlppwprfepstsglrvsaLDSLDHSATEVGRTSTWMILIAYTQNSCQLYtkfrgkdsrkerregervitssesknstacrRFCQSVGNNFLCSYVGAKISGKDLAYLRANNSGLDRVFRALSKKLGQHRlscafkskifgkpgmldfKGKAKWEAwesrkgrskpgmldfkGKAKWEAWEsrkgqskddaqAAYIAKVVELVAKYGKK
MLPPWPRFEPSTSGLRVSALDSLDHSATEVGRTSTWMILIAYTQNSCQLYTKFRGKDSRKERREGERVITSSESKNSTACRRFCQSVGNNFLCSYVGAKISGKDLAYLRANNSGLDRVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYGKK
****************************EVGRTSTWMILIAYTQNSCQLYTKF*************************ACRRFCQSVGNNFLCSYVGAKISGKDLAYLRANNSGLDRVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAW***********************************AAYIAKVVELVAK****
**PPWPRFEPSTSGLRVSALDSLDHSATEVGRTSTWMILIAYTQNSCQLYTK********************************QSVGNNFLCSYVGAKISGK****************************************GMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYG**
MLPPWPRFEPSTSGLRVSALDSLDHSATEVGRTSTWMILIAYTQNSCQLYTKFR*************************CRRFCQSVGNNFLCSYVGAKISGKDLAYLRANNSGLDRVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKW**************QAAYIAKVVELVAKYGKK
*LPPWPRF*PSTSGLRVS*L*SLDHSATEVGRTSTWMILIAYTQNSCQLYTKFRGKD**********VITS**SKNSTACRRFCQSVGNNFLCSYVGAKISGKDLAYLRANNSGLDRVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYGKK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPPWPRFEPSTSGLRVSALDSLDHSATEVGRTSTWMILIAYTQNSCQLYTKFRGKDSRKERREGERVITSSESKNSTACRRFCQSVGNNFLCSYVGAKISGKDLAYLRANNSGLDRVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYGKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
O0180586 Acyl-CoA-binding protein yes N/A 0.210 0.511 0.681 3e-11
Q9PRL886 Acyl-CoA-binding protein yes N/A 0.210 0.511 0.681 3e-10
P0710787 Acyl-CoA-binding protein yes N/A 0.210 0.505 0.681 1e-09
P4588388 Acyl-CoA-binding protein N/A N/A 0.200 0.477 0.642 2e-09
P8293487 Acyl-CoA-binding protein N/A N/A 0.210 0.505 0.659 3e-09
P0710887 Acyl-CoA-binding protein no N/A 0.210 0.505 0.659 3e-09
Q8N6N788 Acyl-CoA-binding domain-c no N/A 0.200 0.477 0.666 4e-09
P45882103 Acyl-CoA-binding protein N/A N/A 0.200 0.407 0.666 6e-09
Q3SZF088 Acyl-CoA-binding domain-c no N/A 0.200 0.477 0.642 2e-08
P1202687 Acyl-CoA-binding protein no N/A 0.210 0.505 0.636 2e-08
>sp|O01805|ACBP1_CAEEL Acyl-CoA-binding protein homolog 1 OS=Caenorhabditis elegans GN=acbp-1 PE=3 SV=1 Back     alignment and function desciption
 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (79%)

Query: 164 SKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYG 207
            KPGM D KGKAKW AW+ +KG +KDDAQ AY+A V EL+AKYG
Sbjct: 42  DKPGMFDLKGKAKWSAWDEKKGLAKDDAQKAYVALVEELIAKYG 85




Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
Caenorhabditis elegans (taxid: 6239)
>sp|Q9PRL8|ACBP_CHICK Acyl-CoA-binding protein OS=Gallus gallus GN=DBI PE=1 SV=1 Back     alignment and function description
>sp|P07107|ACBP_BOVIN Acyl-CoA-binding protein OS=Bos taurus GN=DBI PE=1 SV=2 Back     alignment and function description
>sp|P45883|ACBP_PELRI Acyl-CoA-binding protein homolog OS=Pelophylax ridibundus PE=1 SV=2 Back     alignment and function description
>sp|P82934|ACBP_CHAVI Acyl-CoA-binding protein OS=Chaetophractus villosus GN=DBI PE=1 SV=2 Back     alignment and function description
>sp|P07108|ACBP_HUMAN Acyl-CoA-binding protein OS=Homo sapiens GN=DBI PE=1 SV=2 Back     alignment and function description
>sp|Q8N6N7|ACBD7_HUMAN Acyl-CoA-binding domain-containing protein 7 OS=Homo sapiens GN=ACBD7 PE=1 SV=1 Back     alignment and function description
>sp|P45882|ACBP_ANAPL Acyl-CoA-binding protein OS=Anas platyrhynchos GN=DBI PE=3 SV=1 Back     alignment and function description
>sp|Q3SZF0|ACBD7_BOVIN Acyl-CoA-binding domain-containing protein 7 OS=Bos taurus GN=ACBD7 PE=3 SV=1 Back     alignment and function description
>sp|P12026|ACBP_PIG Acyl-CoA-binding protein OS=Sus scrofa GN=DBI PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
34852683088 PREDICTED: acyl-CoA-binding protein homo 0.205 0.488 0.720 5e-10
4652016987 endozepine [Cyprinus carpio] 0.210 0.505 0.727 5e-10
37446348488 acyl-CoA binding protein [Onychostoma ma 0.210 0.5 0.727 5e-10
32530243687 diazepam-binding inhibitor [Carassius au 0.210 0.505 0.727 6e-10
26081478787 hypothetical protein BRAFLDRAFT_98944 [B 0.210 0.505 0.704 2e-09
20948921086 hypothetical protein Cbre_JD01.002 [Caen 0.205 0.5 0.720 2e-09
1750602786 Protein ACBP-1 [Caenorhabditis elegans] 0.210 0.511 0.681 2e-09
157137608107 diazepam binding inhibitor, putative [Ae 0.220 0.429 0.673 2e-09
14534847987 predicted protein [Ostreococcus lucimari 0.215 0.517 0.644 3e-09
2458271490 CG8498 [Drosophila melanogaster] gi|7297 0.220 0.511 0.695 3e-09
>gi|348526830|ref|XP_003450922.1| PREDICTED: acyl-CoA-binding protein homolog [Oreochromis niloticus] Back     alignment and taxonomy information
 Score = 70.1 bits (170), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%)

Query: 165 KPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYG 207
           +PGMLD KGKAKW+AWESRKG SK+DA +AYIAK  E+++KYG
Sbjct: 45  RPGMLDLKGKAKWDAWESRKGMSKEDAMSAYIAKAKEVISKYG 87




Source: Oreochromis niloticus

Species: Oreochromis niloticus

Genus: Oreochromis

Family: Cichlidae

Order: Perciformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|46520169|gb|AAT00460.1| endozepine [Cyprinus carpio] Back     alignment and taxonomy information
>gi|374463484|gb|AEZ53129.1| acyl-CoA binding protein [Onychostoma macrolepis] Back     alignment and taxonomy information
>gi|325302436|dbj|BAJ83550.1| diazepam-binding inhibitor [Carassius auratus] Back     alignment and taxonomy information
>gi|260814787|ref|XP_002602095.1| hypothetical protein BRAFLDRAFT_98944 [Branchiostoma floridae] gi|229287401|gb|EEN58107.1| hypothetical protein BRAFLDRAFT_98944 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|209489210|gb|ACI48995.1| hypothetical protein Cbre_JD01.002 [Caenorhabditis brenneri] gi|341883087|gb|EGT39022.1| CBN-ACBP-1 protein [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|17506027|ref|NP_491412.1| Protein ACBP-1 [Caenorhabditis elegans] gi|5902716|sp|O01805.1|ACBP1_CAEEL RecName: Full=Acyl-CoA-binding protein homolog 1; Short=ACBP-1; AltName: Full=Diazepam-binding inhibitor homolog; Short=DBI gi|351059713|emb|CCD67306.1| Protein ACBP-1 [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|157137608|ref|XP_001664028.1| diazepam binding inhibitor, putative [Aedes aegypti] gi|108869663|gb|EAT33888.1| AAEL013844-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|145348479|ref|XP_001418675.1| predicted protein [Ostreococcus lucimarinus CCE9901] gi|144578905|gb|ABO96968.1| predicted protein [Ostreococcus lucimarinus CCE9901] Back     alignment and taxonomy information
>gi|24582714|ref|NP_609187.1| CG8498 [Drosophila melanogaster] gi|7297350|gb|AAF52610.1| CG8498 [Drosophila melanogaster] gi|68051679|gb|AAY85103.1| IP02950p [Drosophila melanogaster] gi|220951202|gb|ACL88144.1| CG8498-PA [synthetic construct] gi|220959924|gb|ACL92505.1| CG8498-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
UNIPROTKB|F1NDC387 DBI "Acyl-CoA-binding protein" 0.296 0.712 0.555 5.6e-13
UNIPROTKB|F1NF8186 DBI "Acyl-CoA-binding protein" 0.296 0.720 0.555 5.6e-13
UNIPROTKB|Q9PRL886 DBI "Acyl-CoA-binding protein" 0.296 0.720 0.555 5.6e-13
WB|WBGene0001665586 acbp-1 [Caenorhabditis elegans 0.205 0.5 0.697 5.6e-13
FB|FBgn003199290 CG8498 [Drosophila melanogaste 0.215 0.5 0.711 1.2e-12
ZFIN|ZDB-GENE-040426-186187 dbi "diazepam binding inhibito 0.210 0.505 0.681 1.2e-12
UNIPROTKB|P0710787 DBI "Acyl-CoA-binding protein" 0.205 0.494 0.697 6.4e-12
ZFIN|ZDB-GENE-050913-10888 acbd7 "acyl-Coenzyme A binding 0.301 0.715 0.5 1.3e-11
UNIPROTKB|Q8N6N788 ACBD7 "Acyl-CoA-binding domain 0.200 0.477 0.666 2.2e-11
UNIPROTKB|P0710887 DBI "Acyl-CoA-binding protein" 0.205 0.494 0.674 2.8e-11
UNIPROTKB|F1NDC3 DBI "Acyl-CoA-binding protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 171 (65.3 bits), Expect = 5.6e-13, P = 5.6e-13
 Identities = 35/63 (55%), Positives = 41/63 (65%)

Query:   145 MLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVA 204
             MLD     K +A        +PGMLDFKGKAKW+AW + KG SK+DA  AY+AKV EL  
Sbjct:    25 MLDVYSHYK-QATVGDVNTDRPGMLDFKGKAKWDAWNALKGMSKEDAMKAYVAKVEELKG 83

Query:   205 KYG 207
             KYG
Sbjct:    84 KYG 86


GO:0000062 "fatty-acyl-CoA binding" evidence=IEA
UNIPROTKB|F1NF81 DBI "Acyl-CoA-binding protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PRL8 DBI "Acyl-CoA-binding protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00016655 acbp-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0031992 CG8498 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1861 dbi "diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P07107 DBI "Acyl-CoA-binding protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-108 acbd7 "acyl-Coenzyme A binding domain containing 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N6N7 ACBD7 "Acyl-CoA-binding domain-containing protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P07108 DBI "Acyl-CoA-binding protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y7Z3ACBP_SCHPONo assigned EC number0.62220.21530.5172yesN/A
Q9PRL8ACBP_CHICKNo assigned EC number0.68180.21050.5116yesN/A
P07107ACBP_BOVINNo assigned EC number0.68180.21050.5057yesN/A
P31787ACBP_YEASTNo assigned EC number0.51110.21530.5172yesN/A
O01805ACBP1_CAEELNo assigned EC number0.68180.21050.5116yesN/A
Q9D258ACBD7_MOUSENo assigned EC number0.64280.20090.4772yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
cd0043585 cd00435, ACBP, Acyl CoA binding protein (ACBP) bin 3e-18
pfam0088787 pfam00887, ACBP, Acyl CoA binding protein 1e-16
COG428187 COG4281, ACB, Acyl-CoA-binding protein [Lipid meta 2e-13
>gnl|CDD|238248 cd00435, ACBP, Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity Back     alignment and domain information
 Score = 75.4 bits (186), Expect = 3e-18
 Identities = 29/44 (65%), Positives = 34/44 (77%)

Query: 164 SKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYG 207
            +PGM D KG+AKW+AW S KG SK+DA  AYIAKV EL+AKY 
Sbjct: 42  ERPGMFDLKGRAKWDAWNSLKGMSKEDAMKAYIAKVEELIAKYA 85


Acyl-CoAs are important intermediates in fatty lipid synthesis and fatty acid degradation and play a role in regulation of intermediary metabolism and gene regulation. The suggested role of ACBP is to act as a intracellular acyl-CoA transporter and pool former. ACBPs are present in a large group of eukaryotic species and several tissue-specific isoforms have been detected. Length = 85

>gnl|CDD|216174 pfam00887, ACBP, Acyl CoA binding protein Back     alignment and domain information
>gnl|CDD|226731 COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
PTZ0045890 acyl CoA binding protein; Provisional 99.96
cd0043585 ACBP Acyl CoA binding protein (ACBP) binds thiol e 99.96
PF0088787 ACBP: Acyl CoA binding protein; InterPro: IPR00058 99.95
KOG0817|consensus142 99.93
COG428187 ACB Acyl-CoA-binding protein [Lipid metabolism] 99.9
KOG3878|consensus 469 99.34
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 96.76
PF00373126 FERM_M: FERM central domain; InterPro: IPR019748 T 95.93
KOG3530|consensus 616 88.07
>PTZ00458 acyl CoA binding protein; Provisional Back     alignment and domain information
Probab=99.96  E-value=8.3e-30  Score=194.69  Aligned_cols=86  Identities=22%  Similarity=0.353  Sum_probs=79.9

Q ss_pred             HHHHHHHHHHhhhhhccccccCCCCcchhhhHHHhhhcccccCCCCCCCCCCCChhHHHHHHHHhhCCCCCHHHHHHHHH
Q psy10470        117 RVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYI  196 (209)
Q Consensus       117 ~~FeeAvk~a~~~~~~~~~K~g~~s~d~kL~LYALYK~QAT~Gdcn~~kPG~~D~~graKwnAWkqlkgMSkeEAmkeYI  196 (209)
                      ..|++|+..+.     +.++.+.++++++|+|||||| |||+|||+.++||+||+++|+||+||++++|||++|||++||
T Consensus         3 ~~F~~A~~~v~-----~~~~~~~~s~d~~L~lYalyK-QAt~G~c~~~~P~~~d~~~raKw~AW~~l~~ms~~eA~~~YI   76 (90)
T PTZ00458          3 DLFEECVSFIN-----SLPKTVNLSVEIKLDLYKYYK-QSTVGNCNIKEPSMFKYQDRKKYEAWKSIENLNREDAKKRYV   76 (90)
T ss_pred             HHHHHHHHHHH-----hCCCCCCCCHHHHHHHHHHHh-hhccCCCCCCCCCcccHHHHHHHHHHHHcCCCCHHHHHHHHH
Confidence            45999999987     344556789999999999999 999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhcC
Q psy10470        197 AKVVELVAKYGK  208 (209)
Q Consensus       197 elVeeL~pkyg~  208 (209)
                      ++|+++.|+|+.
T Consensus        77 ~l~~~l~~~w~~   88 (90)
T PTZ00458         77 EIVTELFPNWEK   88 (90)
T ss_pred             HHHHHHhhcccc
Confidence            999999999975



>cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity Back     alignment and domain information
>PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] Back     alignment and domain information
>KOG0817|consensus Back     alignment and domain information
>COG4281 ACB Acyl-CoA-binding protein [Lipid metabolism] Back     alignment and domain information
>KOG3878|consensus Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 Back     alignment and domain information
>KOG3530|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
1hb6_A86 Structure Of Bovine Acyl-Coa Binding Protein In Ort 1e-10
2fdq_A86 Crystal Structure Of Acbp From Armadillo Harderian 2e-10
2cb8_A87 High Resolution Crystal Structure Of Liganded Human 3e-10
3epy_A89 Crystal Structure Of Human Acyl-Coa Binding Domain 3e-10
2fj9_A86 High Resolution Crystal Structure Of The Unliganded 3e-10
1st7_A86 Solution Structure Of Acyl Coenzyme A Binding Prote 4e-08
3fp5_A106 Crystal Structure Of Acbp From Moniliophthora Perni 9e-07
2lbb_A96 Solution Structure Of Acyl Coa Binding Protein From 8e-04
>pdb|1HB6|A Chain A, Structure Of Bovine Acyl-Coa Binding Protein In Orthorhombic Crystal Form Length = 86 Back     alignment and structure

Iteration: 1

Score = 63.2 bits (152), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 30/44 (68%), Positives = 33/44 (75%) Query: 164 SKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYG 207 +PGMLDFKGKAKW+AW KG SK+DA AYI KV EL KYG Sbjct: 42 ERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYG 85
>pdb|2FDQ|A Chain A, Crystal Structure Of Acbp From Armadillo Harderian Gland Length = 86 Back     alignment and structure
>pdb|2CB8|A Chain A, High Resolution Crystal Structure Of Liganded Human L-Acbp Length = 87 Back     alignment and structure
>pdb|3EPY|A Chain A, Crystal Structure Of Human Acyl-Coa Binding Domain 7 Complexed With Palmitoyl-Coa Length = 89 Back     alignment and structure
>pdb|2FJ9|A Chain A, High Resolution Crystal Structure Of The Unliganded Human Acbp Length = 86 Back     alignment and structure
>pdb|1ST7|A Chain A, Solution Structure Of Acyl Coenzyme A Binding Protein From Yeast Length = 86 Back     alignment and structure
>pdb|3FP5|A Chain A, Crystal Structure Of Acbp From Moniliophthora Perniciosa Length = 106 Back     alignment and structure
>pdb|2LBB|A Chain A, Solution Structure Of Acyl Coa Binding Protein From Babesia Bovis T2bo Length = 96 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
3flv_A119 Acyl-COA-binding domain-containing protein 5; lipi 5e-14
3epy_A89 Acyl-COA-binding domain-containing protein 7; acyl 8e-14
2lbb_A96 Acyl COA binding protein; protein binding, structu 2e-13
3fp5_A106 Acyl-COA binding protein; ACBP, cacao disease, fat 2e-13
1st7_A86 ACBP, acyl-COA-binding protein; four helix bundle, 3e-13
1hbk_A89 ACBP, acyl-COA binding protein; fatty acid metabol 4e-13
2cb8_A87 Acyl-COA-binding protein; acyl-coenzyme A binding 4e-13
2cqu_A116 Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi 1e-12
2wh5_A106 Acyl-COA-binding domain-containing protein 4; alte 2e-12
2cop_A109 Acyl-coenzyme A binding domain containing 6; acyl 3e-12
>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Length = 119 Back     alignment and structure
 Score = 65.1 bits (158), Expect = 5e-14
 Identities = 14/47 (29%), Positives = 26/47 (55%)

Query: 163 RSKPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYGKK 209
            S+PG  D  G+ KW+AW S    +K++A  AY+ ++ +++      
Sbjct: 68  LSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEMKKIIETMPMT 114


>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Length = 96 Back     alignment and structure
>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} Length = 106 Back     alignment and structure
>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Length = 86 Back     alignment and structure
>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Length = 89 Back     alignment and structure
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Length = 87 Back     alignment and structure
>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Length = 106 Back     alignment and structure
>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
1st7_A86 ACBP, acyl-COA-binding protein; four helix bundle, 99.97
1hbk_A89 ACBP, acyl-COA binding protein; fatty acid metabol 99.97
3epy_A89 Acyl-COA-binding domain-containing protein 7; acyl 99.97
2cb8_A87 Acyl-COA-binding protein; acyl-coenzyme A binding 99.96
2cop_A109 Acyl-coenzyme A binding domain containing 6; acyl 99.96
3fp5_A106 Acyl-COA binding protein; ACBP, cacao disease, fat 99.96
2lbb_A96 Acyl COA binding protein; protein binding, structu 99.96
2wh5_A106 Acyl-COA-binding domain-containing protein 4; alte 99.96
3flv_A119 Acyl-COA-binding domain-containing protein 5; lipi 99.96
2cqu_A116 Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi 99.95
1mix_A206 Talin; focal adhesion, integrin binding, FERM doma 98.23
4f7g_A222 Talin-1; alpha-helix bundle, integrin activation, 95.77
1ef1_A294 Moesin; membrane, FERM domain, tail domain, membra 95.54
1h4r_A314 Merlin; FERM, neurofibromatosis, NF2, structural p 95.43
3qij_A296 Protein 4.1; cytoskeleton, structural genomics, st 95.29
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 94.19
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 93.65
3au4_A 555 Myosin-X; protein-protein complex, motor protein c 90.68
4dxa_B322 KREV interaction trapped protein 1; GTPase, FERM, 86.4
>1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.97  E-value=2.3e-31  Score=199.26  Aligned_cols=86  Identities=33%  Similarity=0.587  Sum_probs=79.9

Q ss_pred             hHHHHHHHHHHHhhhhhccccccCCCCcchhhhHHHhhhcccccCCCCCCCCCCCChhHHHHHHHHhhCCCCCHHHHHHH
Q psy10470        115 LDRVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAA  194 (209)
Q Consensus       115 Le~~FeeAvk~a~~~~~~~~~K~g~~s~d~kL~LYALYK~QAT~Gdcn~~kPG~~D~~graKwnAWkqlkgMSkeEAmke  194 (209)
                      |+..|++|+..+.+..       ..++++++|+|||||| |||+|||++++||+||++|++||+||++++|||++|||++
T Consensus         1 l~~~F~~A~~~v~~l~-------~~~~~~~~L~lYalyK-QAt~Gd~~~~~Pg~~d~~~raKw~AW~~l~gms~eeA~~~   72 (86)
T 1st7_A            1 VSQLFEEKAKAVNELP-------TKPSTDELLELYALYK-QATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKE   72 (86)
T ss_dssp             CHHHHHHHHHHHTSCS-------SCCCHHHHHHHHHHHH-HHHHCSCCCCCCCSSCHHHHHHHHHHHTTTTTHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHcc-------CCcCHHHHHHHHHHHH-HHhhCCCCCCCCCccCHHHHHHHHHHHHcCCCCHHHHHHH
Confidence            4678999999988433       3678999999999999 9999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhcC
Q psy10470        195 YIAKVVELVAKYGK  208 (209)
Q Consensus       195 YIelVeeL~pkyg~  208 (209)
                      ||++|++++|+|++
T Consensus        73 YI~~v~~l~~~~~~   86 (86)
T 1st7_A           73 YIALVDQLIAKYSS   86 (86)
T ss_dssp             HHHHHHHHHHHHCC
T ss_pred             HHHHHHHHhhhhcC
Confidence            99999999999985



>1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 Back     alignment and structure
>3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1 Back     alignment and structure
>2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A Back     alignment and structure
>2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0 Back     alignment and structure
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Back     alignment and structure
>2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} Back     alignment and structure
>3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} Back     alignment and structure
>2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Back     alignment and structure
>4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d1hb6a_86 a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos t 6e-14
d1hbka_89 a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium 9e-14
>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 86 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl-CoA binding protein-like
superfamily: Acyl-CoA binding protein
family: Acyl-CoA binding protein
domain: Acyl-CoA binding protein
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 62.5 bits (152), Expect = 6e-14
 Identities = 30/43 (69%), Positives = 33/43 (76%)

Query: 165 KPGMLDFKGKAKWEAWESRKGQSKDDAQAAYIAKVVELVAKYG 207
           +PGMLDFKGKAKW+AW   KG SK+DA  AYI KV EL  KYG
Sbjct: 43  RPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYG 85


>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1hbka_89 Acyl-CoA binding protein {Plasmodium falciparum [T 99.96
d1hb6a_86 Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 99.96
d1mixa1114 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 97.12
d1h4ra1111 Merlin {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1gg3a1106 Erythroid membrane protein 4.1R {Human (Homo sapie 97.04
d1ef1a1111 Moesin {Human (Homo sapiens) [TaxId: 9606]} 96.94
d2al6a1123 Focal adhesion kinase 1 {Chicken (Gallus gallus) [ 93.29
>d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
class: All alpha proteins
fold: Acyl-CoA binding protein-like
superfamily: Acyl-CoA binding protein
family: Acyl-CoA binding protein
domain: Acyl-CoA binding protein
species: Plasmodium falciparum [TaxId: 5833]
Probab=99.96  E-value=4.1e-30  Score=192.59  Aligned_cols=87  Identities=20%  Similarity=0.284  Sum_probs=81.1

Q ss_pred             hHHHHHHHHHHHhhhhhccccccCCCCcchhhhHHHhhhcccccCCCCCCCCCCCChhHHHHHHHHhhCCCCCHHHHHHH
Q psy10470        115 LDRVFRALSKKLGQHRLSCAFKSKIFGKPGMLDFKGKAKWEAWESRKGRSKPGMLDFKGKAKWEAWESRKGQSKDDAQAA  194 (209)
Q Consensus       115 Le~~FeeAvk~a~~~~~~~~~K~g~~s~d~kL~LYALYK~QAT~Gdcn~~kPG~~D~~graKwnAWkqlkgMSkeEAmke  194 (209)
                      |+..|++|+..++     +.++..+++++++|+|||||| |||+|||+.++||+||+++++||+||++++|||+++||+.
T Consensus         2 L~~~F~~A~~~v~-----~~~~~~~~~~~~~L~lY~lyK-Qat~G~~~~~~P~~~~~~~~~Kw~AW~~l~gms~~eA~~~   75 (89)
T d1hbka_           2 MAQVFEECVSFIN-----GLPRTINLPNELKLDLYKYYK-QSTIGNCNIKEPSAHKYIDRKKYEAWKSVENLNREDAQKR   75 (89)
T ss_dssp             HHHHHHHHHHHHH-----HSCTTCCCCHHHHHHHHHHHH-HHHTCSCCSCCCCTTSHHHHHHHHHHHHTTTCCHHHHHHH
T ss_pred             hHHHHHHHHHHHH-----hCCCCCCCCHHHHHHHHHHHH-HHhcCCCCCCCCCccCHHHHHHHHHHHHcCCCCHHHHHHH
Confidence            6788999999997     444556789999999999999 9999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhc
Q psy10470        195 YIAKVVELVAKYG  207 (209)
Q Consensus       195 YIelVeeL~pkyg  207 (209)
                      ||++|++++|+|.
T Consensus        76 Yi~~v~~l~p~w~   88 (89)
T d1hbka_          76 YVDIVSEIFPYWQ   88 (89)
T ss_dssp             HHHHHHHHCTTTT
T ss_pred             HHHHHHHHccccc
Confidence            9999999999984



>d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure