Psyllid ID: psy10487


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610
MLAVVVILLAACLGTTGSPDWTDCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLLNLQRIYLKNSGIREVHRDTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPITELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSKLYSHPLSCTEPGMLQTKHWDDVKAQEFACPPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQVLHNSSFDLLEEEEGDALFEKSVSITLFNVTDLDAGEYTCYAENIRGNASGEISLDLPEINLATTLSKTDSWYMLVLGISVCVVSVIVSIGMSFCVCRAHEHKNKRRKRKGKMKQSVSFNDQEKKLLDVSITTTDRHTGSCEALGSQPDMELIEQSLAMEQPPVHITIESHAVDPQVSVFPPPPEFSSNHLPTSTYGNIFISVSVSQEPPGSDPPKYPDLIDMPHRSVSVGTGPGTNPAYFATLPRRPRSKVIEPSSLVRVGPKYDNMGPRVTAGGASILSLPDATSTEDIPSPPPPPTLCTPLGVEYVSL
cHHHHHHHHHHHHHHcccccccccccccEEcccccccEEEccccccccccccccccccEEEccccccccccHHcccccccccccEEEEccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccEEEccccEEEcccccEEEEEEEEEccccEEEEEEccEEcccccccEEEEccccEEEEEEEEEEEccccccccEEEEEEEEcccccEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEccccccccccccccEEEcccccccEEEcccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHcccccccccccEEEEEccccEEEEEccccccccccccccccEEEEccccccccccHHHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEcccccEEccHHHHHHHHHHHHcccEEcccEEEEcHHHcccEEEEccHHHccccccEEEccccEEEEcccEEEEEEEEEcccccEEEEEEccEEEccccEEEEEEEccEEEEEcccEEEEEcccHHHcEEEEEEEEcccccEEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEccccccEEEEEEccccccccEEEEEEcccccEEEEccEEEEEccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccEEEEEcc
MLAVVVILLAACLgttgspdwtdcpdtcrckwtlgkksalckdanftalpstldsdiqvldlnnnkiSYLTKEAFKSIGLLNLQRIylknsgirevhrDTFKYLTILVEVDLSDNQIAWLhqdtflgndrlkvlylngnpitelragqfpklpylktielqhCQIHSVHKDALIHLTALESLNLNgnrlkhlsesvffptpnlktlsldgnpwccdchlrSFRNWLLKSKlyshplsctepgmlqtkhwddvkaqefacppnvtikeSMVIREAGGNVtmscyvygdpeptILWLLNgqvlhnssfdlleeeegdaLFEKSVSITlfnvtdldageytcyaenirgnasgeisldlpeinlattlsktdSWYMLVLGISVCVVSVIVSIGMSFCVCrahehknkrrkrkgkmkqsvsfndqekklLDVSItttdrhtgscealgsqpdmELIEQSlameqppvhitieshavdpqvsvfppppefssnhlptstygnIFISVsvsqeppgsdppkypdlidmphrsvsvgtgpgtnpayfatlprrprskviepsslvrvgpkydnmgprvtaggasilslpdatstedipsppppptlctplgveyvsl
MLAVVVILLAAClgttgspdwtdcpDTCRCKWTLGKKSALCKDANFTALpstldsdiqvLDLNNNKISYLTKEAFKSIGLLNLQRIYLknsgirevHRDTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPITELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSKLYSHPLSCTEPGMLQTKHWDDVKAQEFACPPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQVLHNSSFDLLEEEEGDALFEKSVSITLFNVTDLDAGEYTCYAENIRGNASGEISLDLPEINLATTLSKTDSWYMLVLGISVCVVSVIVSIGMSFCVCrahehknkrrkrkgkmkqsvsfndqekklldVSITTTDRHTGSCEALGSQPDMELIEQSLAMEQPPVHITIESHAVDPQVSVFPPPPEFSSNHLPTSTYGNIFISVSVSQEPPGSDPPKYPDLIDMPHRSVSVGTGPGTNPAyfatlprrprskviepsslvrvgpkydnmgpRVTAGGASILSLPDATStedipsppppptlctplgveyvsl
MlavvvillaaCLGTTGSPDWTDCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLLNLQRIYLKNSGIREVHRDTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPITELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSKLYSHPLSCTEPGMLQTKHWDDVKAQEFACPPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQVLHNSSFDLLEEEEGDALFEKSVSITLFNVTDLDAGEYTCYAENIRGNASGEISLDLPEINLATTLSKTDSWYMLVLGisvcvvsvivsiGMSFCVCRAHEHknkrrkrkgkmkQSVSFNDQEKKLLDVSITTTDRHTGSCEALGSQPDMELIEQSLAMEQPPVHITIESHAvdpqvsvfppppefssNHLPTSTYGNIFISVSVSQEPPGSDPPKYPDLIDMPHRSVSVGTGPGTNPAYFATLPRRPRSKVIEPSSLVRVGPKYDNMGPRVTAGGASILSLPDATSTEDIpsppppptlctplGVEYVSL
*LAVVVILLAACLGTTGSPDWTDCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLLNLQRIYLKNSGIREVHRDTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPITELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSKLYSHPLSCTEPGMLQTKHWDDVKAQEFACPPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQVLHN****************KSVSITLFNVTDLDAGEYTCYAENIRGNASGEISLDLPEINLATTLSKTDSWYMLVLGISVCVVSVIVSIGMSFCVCRA***********************************************************************************************TYGNIFISV************************************************************************************************************
MLAVVVILLAACLGTTGSPDWTDCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLLNLQRIYLKNSGIREVHRDTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPITELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSKLYSHPLSCTEPGMLQTKHWDDVKAQEFACP****IKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQVLH***************FEKSVSITLFNVTDLDAGEYTCYAENIRGNASGEISLDLPEIN*******T*SWYMLVLGISVCVVSVIVSIGMSFCVC*************************************************************************************************************************************************************************NMGPRVTAGGASI*******************************L
MLAVVVILLAACLGTTGSPDWTDCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLLNLQRIYLKNSGIREVHRDTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPITELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSKLYSHPLSCTEPGMLQTKHWDDVKAQEFACPPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQVLHNSSFDLLEEEEGDALFEKSVSITLFNVTDLDAGEYTCYAENIRGNASGEISLDLPEINLATTLSKTDSWYMLVLGISVCVVSVIVSIGMSFCVCRAH******************FNDQEKKLLDVSITTTDRHTGSCEALGSQPDMELIEQSLAMEQPPVHITIESHAVDPQVSVFPPPPEFSSNHLPTSTYGNIFISVSV********PPKYPDLIDMPHRSVSVGTGPGTNPAYFATLPRRPRSKVIEPSSLVRVGPKYDNMGPRVTAGGASILSLPD**********PPPPTLCTPLGVEYVSL
MLAVVVILLAACLGTTGSPDWTDCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLLNLQRIYLKNSGIREVHRDTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPITELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSKLYSHPLSCTEPGMLQTKHWDDVKAQEFACPPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQVLHNSSFDLLEEEEGDALFEKSVSITLFNVTDLDAGEYTCYAENIRGNASGEISLDLPEINLATTLSKTDSWYMLVLGISVCVVSVIVSIGMSFCVCRAHEHKNKRR*RKGKMKQSVSFNDQEKKLLDVSITTTDRHTGSCEALGSQPDMELIEQSLAMEQPPVHITIESHAVDPQVSVFPPPPEFSSNHLPTSTYGNIFISVSVSQEPPGSDPPKYPDLIDMPHRSVSVGTGPGTNPAYF*TLPRRPRSKVIEPSSLVRVGPKYDNMGPRVTAGGASILSLPDA*STEDIPSPPPPPTLCTPLGVEYVSL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAVVVILLAACLGTTGSPDWTDCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLLNLQRIYLKNSGIREVHRDTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPITELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSKLYSHPLSCTEPGMLQTKHWDDVKAQEFACPPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQVLHNSSFDLLEEEEGDALFEKSVSITLFNVTDLDAGEYTCYAENIRGNASGEISLDLPEINLATTLSKTDSWYMLVLGISVCVVSVIVSIGMSFCVCRAHEHKNKRRKRKGKMKQSVSFNDQEKKLLDVSITTTDRHTGSCEALGSQPDMELIEQSLAMEQPPVHITIESHAVDPQVSVFPPPPEFSSNHLPTSTYGNIFISVSVSQEPPGSDPPKYPDLIDMPHRSVSVGTGPGTNPAYFATLPRRPRSKVIEPSSLVRVGPKYDNMGPRVTAGGASILSLPDATSTEDIPSPPPPPTLCTPLGVEYVSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query610 2.2.26 [Sep-21-2011]
Q8BHA1521 Leucine-rich repeat-conta yes N/A 0.526 0.616 0.282 2e-27
O94898 1065 Leucine-rich repeats and yes N/A 0.506 0.290 0.283 1e-26
Q50LG9513 Leucine-rich repeat-conta no N/A 0.519 0.617 0.291 2e-26
Q9VZZ4 1527 Peroxidasin OS=Drosophila no N/A 0.467 0.186 0.302 5e-26
Q52KR2 1054 Leucine-rich repeats and no N/A 0.506 0.293 0.280 1e-25
P0C7J6 766 Leucine-rich repeat and f no N/A 0.516 0.411 0.253 8e-24
Q2WF71 766 Leucine-rich repeat and f no N/A 0.516 0.411 0.253 8e-24
Q9P244 771 Leucine-rich repeat and f no N/A 0.518 0.409 0.253 1e-23
Q6P1C6 1117 Leucine-rich repeats and no N/A 0.508 0.277 0.257 1e-22
D4A1J9719 Leucine-rich repeat and f no N/A 0.506 0.429 0.258 5e-22
>sp|Q8BHA1|LRC24_MOUSE Leucine-rich repeat-containing protein 24 OS=Mus musculus GN=Lrrc24 PE=2 SV=1 Back     alignment and function desciption
 Score =  124 bits (312), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 96/340 (28%), Positives = 157/340 (46%), Gaps = 19/340 (5%)

Query: 22  TDCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLL 81
           T CP  CRC       +  C       +P  +    Q L L +N I++L + +     L 
Sbjct: 29  TGCPAACRCY----SATVECGALRLRVVPPGIPPGTQTLFLQDNSIAHLEQGSLAP--LA 82

Query: 82  NLQRIYLKNSGIREVHRDTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPI 141
            L+ +YL N+ +R +    F+    L+E+ L+ N++  L    F+G  +L+VLYL GN +
Sbjct: 83  ALRHLYLHNNTLRALESGAFRAQPRLLELALTGNRLRGLRGGAFVGLVQLRVLYLAGNQL 142

Query: 142 TELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTP 201
            +L    F  LP L+ + LQ   I  +   AL  L++L  L+L+ N+L  +S+    P  
Sbjct: 143 AKLLDFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISKEALQPLS 202

Query: 202 NLKTLSLDGNPWCCDCHLRSFRNWLLKS--KLYS---HPLSCTEPGMLQTKHWDDVKAQE 256
           +L+ L L  NPW CDC L    +W+ +   +L S     ++C EP  L  +   +V    
Sbjct: 203 SLQVLRLTENPWRCDCALHWLGSWIKEGGRRLLSSRDKKITCAEPPRLALQSLLEVSGGS 262

Query: 257 FAC-PPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWL-----LNGQVLHNSSFDLLE 310
             C PP+V ++        G ++ ++C   G P+P ++W       +G+    +  +   
Sbjct: 263 LICIPPSVNVEPPEFTANLGEDLQVACQASGYPQPLVVWRKVPQPRDGKPQAQAQLEGGA 322

Query: 311 EEEGDALFEKSVSITLF--NVTDLDAGEYTCYAENIRGNA 348
              G      + S  LF  N+T   AG+Y C A N  G A
Sbjct: 323 PGLGGHGTRDTGSGMLFLTNITLAHAGKYECEAANAGGKA 362





Mus musculus (taxid: 10090)
>sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 Back     alignment and function description
>sp|Q50LG9|LRC24_HUMAN Leucine-rich repeat-containing protein 24 OS=Homo sapiens GN=LRRC24 PE=2 SV=2 Back     alignment and function description
>sp|Q9VZZ4|PXDN_DROME Peroxidasin OS=Drosophila melanogaster GN=Pxn PE=1 SV=1 Back     alignment and function description
>sp|Q52KR2|LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus GN=Lrig2 PE=2 SV=1 Back     alignment and function description
>sp|P0C7J6|LRFN1_RAT Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Rattus norvegicus GN=Lrfn1 PE=1 SV=1 Back     alignment and function description
>sp|Q2WF71|LRFN1_MOUSE Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Mus musculus GN=Lrfn1 PE=1 SV=1 Back     alignment and function description
>sp|Q9P244|LRFN1_HUMAN Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Homo sapiens GN=LRFN1 PE=1 SV=2 Back     alignment and function description
>sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 Back     alignment and function description
>sp|D4A1J9|LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus GN=Lrfn5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query610
328719738624 PREDICTED: immunoglobulin superfamily co 0.926 0.905 0.531 1e-172
242008917648 Amphoterin-induced protein 2 precursor, 0.957 0.901 0.497 1e-160
91080929561 PREDICTED: similar to kek1 [Tribolium ca 0.880 0.957 0.525 1e-156
340717421664 PREDICTED: leucine-rich repeats and immu 0.936 0.859 0.429 1e-134
350407431664 PREDICTED: leucine-rich repeats and immu 0.972 0.893 0.423 1e-133
48137906660 PREDICTED: leucine-rich repeat-containin 0.934 0.863 0.425 1e-130
307198227672 Leucine-rich repeat-containing protein 2 0.904 0.821 0.427 1e-129
380030594662 PREDICTED: leucine-rich repeats and immu 0.934 0.861 0.425 1e-129
332018256680 Leucine-rich repeat-containing protein 2 0.944 0.847 0.417 1e-125
307168304676 Leucine-rich repeat-containing protein 2 0.937 0.846 0.409 1e-122
>gi|328719738|ref|XP_003246846.1| PREDICTED: immunoglobulin superfamily containing leucine-rich repeat protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  611 bits (1575), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 315/593 (53%), Positives = 417/593 (70%), Gaps = 28/593 (4%)

Query: 2   LAVVVILLAACLGTTGSPDWTDCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLD 61
           + ++V++L  C  T G  DW DCP  C+CKW+ GKK+ALCKDA+FT +P +LD+D+QVLD
Sbjct: 7   VQLIVMVLVYCGTTFG--DWADCPTPCQCKWSSGKKTALCKDADFTDIPLSLDADMQVLD 64

Query: 62  LNNNKISYLTKEAFKSIGLLNLQRIYLKNSGIREVHRDTFKYLTILVEVDLSDNQIAWLH 121
           L++N + +L ++AFK +GLLNLQR++L+  GI  VH+D F+ L ILVE+DLSDN I  LH
Sbjct: 65  LSSNNLRHLPEDAFKKVGLLNLQRVFLRGCGIHNVHKDAFRELKILVELDLSDNLIGSLH 124

Query: 122 QDTFLGNDRLKVLYLNGNPITELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALES 181
           Q+TF GN+RL+VLYLNGNP+TE++  QFP L +L+T+ELQHCQI  +H+DA +HL++LES
Sbjct: 125 QETFQGNERLRVLYLNGNPLTEIKEVQFPVLQHLRTLELQHCQIKRIHRDAFLHLSSLES 184

Query: 182 LNLNGNRLKHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSKLYSHPLSCTEP 241
           LNLNGN LK LSE+VF P   LKTLSLDGNPW CDCHLRSFRNW + S LYSHPLSC EP
Sbjct: 185 LNLNGNLLKWLSETVFLPISKLKTLSLDGNPWVCDCHLRSFRNWFVSSNLYSHPLSCIEP 244

Query: 242 GMLQTKHWDDVKAQEFACPPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQVL 301
            +L    W+++K  EFACPP V I  + V+ +A GN+T +C V GDPEP + W  NG  +
Sbjct: 245 NVLSGSRWENIKPPEFACPPVVKIDRNSVLEDA-GNITFTCKVTGDPEPEVSWYFNGHSI 303

Query: 302 HNSSFDLLEEEEGDALFEKSVSITLFNVTDLDAGEYTCYAENIRGNASGEISLDLPEINL 361
            N +  + E            ++ +FNV+D+ AGE+TC A N RG  S  +SL LPE+ +
Sbjct: 304 DNYTDRMDENRTWLDNNRMWSALHIFNVSDVVAGEFTCEARNSRGQMSANVSLALPEVAV 363

Query: 362 ATTLSKTDSWYMLVLGISVCVVSVIVSIGMSFCVCRAHEHKNKRRKRKGKMKQSVSFNDQ 421
           ATTLSK+ S Y++++ ++     ++  IG++ CVC+  +    RR  K   K S SF+D 
Sbjct: 364 ATTLSKSKSMYLVIVCVAASATVLLFVIGLTCCVCQV-KKSGGRRDSKTNFKGSTSFSDA 422

Query: 422 EKKLLDVSITTTDRHTGSCEALG--SQPDMELIEQSL-------AMEQPPVHITIESHAV 472
           +K+LLD SI+TT    GSCE LG  S  D+ELIEQSL         +Q PVHITIESH  
Sbjct: 423 DKRLLDASISTT--QAGSCEMLGGSSCQDLELIEQSLQNIPLAAVCDQQPVHITIESHDP 480

Query: 473 DPQVSVFPPPPEFSSNHLPT-STYGNIFISVSVSQEPPGSDP-PKYPDLIDMPHR---SV 527
           +  +S++PPPPEFS++ LP+ S +GNIFISVSVSQEPP  DP  +YPDL+DM HR   SV
Sbjct: 481 NSSLSLYPPPPEFSTSILPSVSGFGNIFISVSVSQEPP--DPESRYPDLLDMKHRQKQSV 538

Query: 528 SVGTGPGTN--PA--YFATLPRRPRSKVIEPSSLVRVGPKYDNMGPRVTAGGA 576
           SVGT    +  PA  Y+AT+PR+ R  +I+  S+  V P YDNMGPR+TA G+
Sbjct: 539 SVGTSSTHHIPPASSYYATMPRKKR--IIDHQSIKSVMPHYDNMGPRITATGS 589




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242008917|ref|XP_002425241.1| Amphoterin-induced protein 2 precursor, putative [Pediculus humanus corporis] gi|212508982|gb|EEB12503.1| Amphoterin-induced protein 2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91080929|ref|XP_974068.1| PREDICTED: similar to kek1 [Tribolium castaneum] gi|270005942|gb|EFA02390.1| hypothetical protein TcasGA2_TC008070 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340717421|ref|XP_003397182.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains protein 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350407431|ref|XP_003488086.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains protein 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|48137906|ref|XP_396829.1| PREDICTED: leucine-rich repeat-containing protein 24 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|307198227|gb|EFN79232.1| Leucine-rich repeat-containing protein 24 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380030594|ref|XP_003698929.1| PREDICTED: leucine-rich repeats and immunoglobulin-like domains protein 3-like [Apis florea] Back     alignment and taxonomy information
>gi|332018256|gb|EGI58861.1| Leucine-rich repeat-containing protein 24 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307168304|gb|EFN61510.1| Leucine-rich repeat-containing protein 24 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query610
FB|FBgn0039862 836 kek6 "kek6" [Drosophila melano 0.736 0.537 0.434 1.3e-109
FB|FBgn0031016 931 kek5 "kekkon5" [Drosophila mel 0.588 0.385 0.347 1.5e-64
FB|FBgn0015400 894 kek2 "kekkon-2" [Drosophila me 0.534 0.364 0.345 4.1e-51
FB|FBgn0028370 1021 kek3 "kekkon-3" [Drosophila me 0.463 0.277 0.364 2.5e-49
FB|FBgn0015399 880 kek1 "kekkon-1" [Drosophila me 0.536 0.371 0.350 1e-47
FB|FBgn0032484649 kek4 "kekkon4" [Drosophila mel 0.473 0.445 0.352 6.2e-46
MGI|MGI:3605040521 Lrrc24 "leucine rich repeat co 0.531 0.621 0.285 7.5e-28
UNIPROTKB|Q50LG9513 LRRC24 "Leucine-rich repeat-co 0.522 0.621 0.295 1.2e-27
ZFIN|ZDB-GENE-060503-496594 lrrc24 "leucine rich repeat co 0.434 0.446 0.299 3.4e-27
UNIPROTKB|Q6WRI0 2623 IGSF10 "Immunoglobulin superfa 0.340 0.079 0.286 2.3e-22
FB|FBgn0039862 kek6 "kek6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 945 (337.7 bits), Expect = 1.3e-109, Sum P(3) = 1.3e-109
 Identities = 206/474 (43%), Positives = 278/474 (58%)

Query:    12 CL-GTTGSPDWT-DCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISY 69
             CL   T + DW+  C   C CKWT GKKSA+C     T +P+TL +++QVL LN+N I Y
Sbjct:    24 CLVAWTVADDWSLSCASNCTCKWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNHIPY 83

Query:    70 LTKEAFKSIGLLNLQRIYLKNSGIREVHRDTFKYLTILVEVDLSDNQIAWLHQDTFLGND 129
             L +E F ++GLLNLQRIYLK S ++ +H+++F+ L ILVE+DLSDN++  L +DTF+GND
Sbjct:    84 LNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGND 143

Query:   130 RLKVLYLNGNPITELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRL 189
             RL++LYLNGNP+  L A QFP LP+L+T+++  C I  +   +L +L  LE LNL  N L
Sbjct:   144 RLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKNNLL 203

Query:   190 KHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSKLYSHPLSCTEPGMLQTKHW 249
             + LSE VF    NLKTLSL+ NPW C+C LR FR W + S+L S  L C  P   + + W
Sbjct:   204 ESLSEYVFQHMANLKTLSLEENPWQCNCKLRKFRGWYVNSRLSSVSLVCKGPPAQKDRTW 263

Query:   250 DDVKAQEFACPPNVTIKESMVIR--EAGGNVTMSCYVYGDPEPTILWLLNGQVLHNSSFD 307
             D V  + F CPP V I  +  ++  + G N T SC VYGDP P + W LNG++L N +  
Sbjct:   264 DSVDDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAWELNGKILDNDN-- 321

Query:   308 LLEEEEGDALFEKSVSITLFNVTDLDAGEYTCYAENIRGNASGEISLDLPEINLATTLSK 367
             +L E E  A  +   ++T+FNVT LDAG Y C   N  G+ +  IS+ L EI +   L K
Sbjct:   322 VLFESESIASDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNISIYLSEI-VQHVLEK 380

Query:   368 TDS--WYM-LVLGXXXXXXXXXXXXGMSFCVC----RAHEHXXXXXXXXXXXXQSVSFND 420
             T    WY  L++G             +  C+C    R H H             SVSFND
Sbjct:   381 TPETFWYFGLIMGIFGTVFLLISISFV-VCLCKRTTRQHRHANKAGVKS-----SVSFND 434

Query:   421 QEKKLLDVSITTTDRHTGSCEALGSQPD---MELIEQS-LAMEQPPVHITIESH 470
             QEKKLLD S+TTT    G    + +QP    M   + + +   Q  +H  +ESH
Sbjct:   435 QEKKLLDSSVTTTTNDRGDSYGIDNQPTSIGMNKGDSAGMGFNQIEIH-AVESH 487


GO:0005887 "integral to plasma membrane" evidence=ISM
GO:0042059 "negative regulation of epidermal growth factor receptor signaling pathway" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
FB|FBgn0031016 kek5 "kekkon5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015400 kek2 "kekkon-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0028370 kek3 "kekkon-3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015399 kek1 "kekkon-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032484 kek4 "kekkon4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:3605040 Lrrc24 "leucine rich repeat containing 24" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q50LG9 LRRC24 "Leucine-rich repeat-containing protein 24" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-496 lrrc24 "leucine rich repeat containing 24" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6WRI0 IGSF10 "Immunoglobulin superfamily member 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query610
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 3e-14
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-13
smart0041085 smart00410, IG_like, Immunoglobulin like 1e-12
smart0040985 smart00409, IG, Immunoglobulin 1e-12
cd0573095 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig 8e-12
cd0009674 cd00096, Ig, Immunoglobulin domain 1e-11
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 7e-11
cd0496973 cd04969, Ig5_Contactin_like, Fifth Ig domain of co 1e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-09
cd0572569 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like 4e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
cd0573792 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglob 3e-08
cd0585273 cd05852, Ig5_Contactin-1, Fifth Ig domain of conta 5e-08
cd0497876 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin 5e-08
cd0589192 cd05891, Ig_M-protein_C, C-terminal immunoglobulin 3e-07
smart0008251 smart00082, LRRCT, Leucine rich repeat C-terminal 5e-07
cd0585890 cd05858, Ig3_FGFR-2, Third immunoglobulin (Ig)-lik 7e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-07
cd0574792 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin 3e-06
pfam0004762 pfam00047, ig, Immunoglobulin domain 3e-06
cd0585188 cd05851, Ig3_Contactin-1, Third Ig domain of conta 8e-06
cd0496888 cd04968, Ig3_Contactin_like, Third Ig domain of co 1e-05
cd0576474 cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) 1e-05
cd0572885 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of 1e-05
cd0586997 cd05869, Ig5_NCAM-1, Fifth immunoglobulin (Ig)-lik 3e-05
cd0573171 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-05
cd0497290 cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobul 7e-05
cd0572985 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) 7e-05
cd0497490 cd04974, Ig3_FGFR, Third immunoglobulin (Ig)-like 7e-05
cd0572371 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)- 1e-04
cd07693100 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like 2e-04
cd0574378 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)- 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
cd0574669 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I 6e-04
cd0587671 cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-lik 7e-04
cd0585682 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (I 7e-04
pfam1389580 pfam13895, Ig_2, Immunoglobulin domain 7e-04
cd0585785 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like 9e-04
cd0497181 cd04971, Ig_TrKABC_d5, Fifth domain (immunoglobuli 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
cd0573676 cd05736, Ig2_Follistatin_like, Second immunoglobul 0.002
cd0574874 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d 0.002
cd0573296 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
cd0496791 cd04967, Ig1_Contactin, First Ig domain of contact 0.004
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
 Score = 68.4 bits (168), Expect = 3e-14
 Identities = 31/95 (32%), Positives = 45/95 (47%), Gaps = 13/95 (13%)

Query: 260 PPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQVLHNSSFDLLEEEEGDALFE 319
           P +V ++E       G +   +C V GDP+PT+ W  +GQ L +S    +  E G     
Sbjct: 7   PKDVEVQE-------GESARFTCTVTGDPDPTVSWFKDGQPLRSSDRFKVTYEGGTY--- 56

Query: 320 KSVSITLFNVTDLDAGEYTCYAENIRGNASGEISL 354
              ++T+ NV   D G+YTC A N  G A     L
Sbjct: 57  ---TLTISNVQPDDEGKYTCVATNSAGEAEASAEL 88


Length = 90

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|143214 cd05737, Ig_Myomesin_like_C, C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>gnl|CDD|143260 cd05852, Ig5_Contactin-1, Fifth Ig domain of contactin-1 Back     alignment and domain information
>gnl|CDD|143179 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>gnl|CDD|143299 cd05891, Ig_M-protein_C, C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>gnl|CDD|214507 smart00082, LRRCT, Leucine rich repeat C-terminal domain Back     alignment and domain information
>gnl|CDD|143266 cd05858, Ig3_FGFR-2, Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|143224 cd05747, Ig5_Titin_like, M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>gnl|CDD|215677 pfam00047, ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143259 cd05851, Ig3_Contactin-1, Third Ig domain of contactin-1 Back     alignment and domain information
>gnl|CDD|143169 cd04968, Ig3_Contactin_like, Third Ig domain of contactin Back     alignment and domain information
>gnl|CDD|143241 cd05764, Ig_2, Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>gnl|CDD|143277 cd05869, Ig5_NCAM-1, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>gnl|CDD|143208 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|143173 cd04972, Ig_TrkABC_d4, Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>gnl|CDD|143175 cd04974, Ig3_FGFR, Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>gnl|CDD|212460 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>gnl|CDD|143220 cd05743, Ig_Perlecan_D2_like, Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>gnl|CDD|143284 cd05876, Ig3_L1-CAM, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>gnl|CDD|143264 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143265 cd05857, Ig2_FGFR, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>gnl|CDD|143172 cd04971, Ig_TrKABC_d5, Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>gnl|CDD|143209 cd05732, Ig5_NCAM-1_like, Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|143168 cd04967, Ig1_Contactin, First Ig domain of contactin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 610
KOG4194|consensus873 100.0
KOG4194|consensus873 100.0
KOG4237|consensus498 99.97
KOG3513|consensus 1051 99.89
KOG3513|consensus 1051 99.74
KOG4237|consensus498 99.7
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.65
KOG4222|consensus 1281 99.65
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.62
KOG4221|consensus 1381 99.61
KOG4221|consensus 1381 99.56
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.55
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.55
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.54
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.54
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.54
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.53
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.53
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.53
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.52
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.52
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.52
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.52
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.52
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.52
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.51
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.51
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.51
PHA02785326 IL-beta-binding protein; Provisional 99.51
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.5
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.5
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.5
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.5
PHA02785326 IL-beta-binding protein; Provisional 99.48
KOG0444|consensus 1255 99.48
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.48
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.47
KOG4222|consensus 1281 99.47
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.47
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.47
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.46
KOG0617|consensus264 99.46
PHA02826227 IL-1 receptor-like protein; Provisional 99.46
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.46
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.46
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.45
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.45
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.44
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.44
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.44
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.43
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.43
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.42
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.41
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.41
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.41
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.4
KOG0444|consensus 1255 99.4
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.39
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.39
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.39
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.39
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.39
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.38
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.38
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.38
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.38
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.38
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.38
KOG0618|consensus 1081 99.37
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.37
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.37
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.37
KOG0617|consensus264 99.37
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.36
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.36
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.36
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.35
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.35
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.35
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.35
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.35
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.35
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.35
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.34
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.33
KOG0472|consensus565 99.32
KOG0472|consensus565 99.31
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.3
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.29
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.28
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.28
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.27
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.27
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.25
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.25
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.24
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 99.24
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.23
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.23
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.22
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.22
KOG0618|consensus 1081 99.21
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.2
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.19
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.19
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 99.15
KOG1259|consensus490 99.15
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 99.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.13
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 99.11
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.09
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 99.07
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 99.04
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 99.02
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 99.01
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.97
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 98.96
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.93
PHA02826227 IL-1 receptor-like protein; Provisional 98.9
smart0040863 IGc2 Immunoglobulin C-2 Type. 98.9
KOG1259|consensus490 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 98.88
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 98.86
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.85
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.85
KOG0532|consensus722 98.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.8
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.78
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.76
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.76
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.76
smart0040986 IG Immunoglobulin. 98.76
PLN03150623 hypothetical protein; Provisional 98.76
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.75
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 98.75
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.75
PLN032101153 Resistant to P. syringae 6; Provisional 98.7
KOG0532|consensus 722 98.69
PLN03150623 hypothetical protein; Provisional 98.68
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.65
PLN032101153 Resistant to P. syringae 6; Provisional 98.63
KOG1859|consensus 1096 98.59
KOG3207|consensus505 98.56
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.54
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.52
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.52
KOG3207|consensus505 98.49
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.49
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.42
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 98.41
KOG1644|consensus233 98.39
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.38
KOG0531|consensus414 98.37
KOG1859|consensus 1096 98.37
KOG0531|consensus414 98.37
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 98.36
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.35
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 98.35
KOG4579|consensus177 98.33
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.32
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 98.31
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 98.31
KOG1909|consensus382 98.31
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 98.29
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 98.29
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.28
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 98.28
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.27
KOG1644|consensus233 98.26
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 98.25
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.25
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.25
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.23
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 98.22
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 98.21
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 98.21
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 98.2
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.19
KOG4579|consensus177 98.18
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 98.17
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 98.17
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 98.17
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 98.15
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 98.14
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 98.14
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 98.13
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.12
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 98.12
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 98.12
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 98.1
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.09
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 98.09
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 98.08
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.07
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 98.07
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 98.05
KOG4658|consensus889 98.05
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 98.04
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 98.02
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 98.0
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 98.0
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 98.0
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 97.99
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 97.99
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 97.99
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 97.99
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 97.98
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 97.98
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 97.98
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 97.97
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 97.97
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 97.96
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 97.96
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 97.96
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 97.95
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 97.95
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 97.95
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 97.93
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 97.93
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 97.92
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 97.92
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 97.92
smart0040775 IGc1 Immunoglobulin C-Type. 97.92
KOG1909|consensus382 97.91
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 97.9
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 97.9
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 97.9
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 97.89
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 97.88
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 97.88
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 97.87
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 97.86
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 97.86
PHA02987189 Ig domain OX-2-like protein; Provisional 97.86
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 97.84
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 97.83
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 97.82
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 97.82
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 97.82
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 97.79
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 97.78
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 97.78
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 97.77
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 97.77
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 97.75
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 97.75
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 97.73
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 97.73
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 97.71
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 97.7
cd0577093 IgC_beta2m Class I major histocompatibility comple 97.68
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 97.68
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 97.67
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 97.65
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 97.65
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 97.65
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 97.63
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 97.63
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 97.63
KOG3515|consensus 741 97.62
KOG4658|consensus889 97.61
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 97.61
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 97.61
KOG2982|consensus418 97.6
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 97.6
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 97.57
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 97.56
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 97.56
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 97.55
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 97.53
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 97.51
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 97.5
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 97.5
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 97.48
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 97.47
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 97.46
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 97.45
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 97.43
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 97.4
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 97.39
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 97.39
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 97.39
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 97.38
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 97.37
KOG3515|consensus 741 97.36
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 97.34
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 97.34
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 97.33
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 97.32
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 97.31
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 97.3
PRK15386426 type III secretion protein GogB; Provisional 97.29
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.27
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 97.26
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 97.24
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 97.22
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 97.22
KOG3665|consensus699 97.22
KOG2982|consensus418 97.22
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 97.21
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 97.2
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 97.19
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 97.19
KOG2123|consensus388 97.18
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 97.18
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.15
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 97.14
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 97.13
PF0146228 LRRNT: Leucine rich repeat N-terminal domain; Inte 97.13
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 97.11
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 97.11
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 97.1
KOG2739|consensus260 97.1
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 97.08
smart0001333 LRRNT Leucine rich repeat N-terminal domain. 97.08
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 97.05
KOG3665|consensus699 96.94
PRK15386426 type III secretion protein GogB; Provisional 96.92
KOG2120|consensus419 96.92
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 96.91
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 96.86
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 96.82
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 96.81
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 96.76
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 96.75
KOG2739|consensus260 96.73
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 96.73
KOG2123|consensus388 96.7
PHA03376221 BARF1; Provisional 96.65
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 96.65
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 96.56
smart0040681 IGv Immunoglobulin V-Type. 96.52
KOG1026|consensus 774 96.49
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 96.43
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 96.41
KOG2120|consensus419 96.37
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.32
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 96.2
PHA0263363 hypothetical protein; Provisional 96.18
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 96.13
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 96.03
KOG4597|consensus560 95.88
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 95.87
PHA0263363 hypothetical protein; Provisional 95.8
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 95.79
smart0040863 IGc2 Immunoglobulin C-2 Type. 95.76
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 95.69
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 95.56
PHA03376221 BARF1; Provisional 95.54
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 95.51
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 95.51
KOG1480|consensus 909 95.31
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 95.3
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 95.3
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 95.12
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 95.11
PF0004764 ig: Immunoglobulin domain The Prosite family only 95.08
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 94.92
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 94.85
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 94.68
smart0040986 IG Immunoglobulin. 94.65
smart0041086 IG_like Immunoglobulin like. IG domains that canno 94.65
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 94.56
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 94.56
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 94.54
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 94.49
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 94.42
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 94.3
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 94.26
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 93.73
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 93.54
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.43
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.38
PF0579080 C2-set: Immunoglobulin C2-set domain; InterPro: IP 93.36
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 93.3
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 93.02
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 93.02
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 92.9
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.71
smart0037026 LRR Leucine-rich repeats, outliers. 92.71
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 92.66
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 92.45
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 92.4
PHA03042286 CD47-like protein; Provisional 92.22
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 92.17
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 92.1
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 92.08
smart0037026 LRR Leucine-rich repeats, outliers. 91.84
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.84
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.27
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 91.24
KOG3864|consensus221 90.88
PHA02865338 MHC-like TNF binding protein; Provisional 90.7
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 90.45
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 90.3
KOG0473|consensus326 88.92
KOG0473|consensus326 88.32
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 88.05
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 87.51
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 87.26
cd0589098 Ig2_Nectin-1_like Second immunoglobulin (Ig) domai 87.06
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 86.98
KOG3864|consensus221 86.51
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 86.32
PHA02982251 hypothetical protein; Provisional 86.24
KOG1480|consensus 909 85.73
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 84.65
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 84.46
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 83.3
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 83.01
PHA03270466 envelope glycoprotein C; Provisional 82.06
>KOG4194|consensus Back     alignment and domain information
Probab=100.00  E-value=5.7e-48  Score=390.48  Aligned_cols=332  Identities=22%  Similarity=0.347  Sum_probs=228.8

Q ss_pred             CCCCccEEEccCccccccCHHHhhcCccccccccccccccccCcccccCCCcccEEecCCCcccccCCchhhHHHHhhcc
Q psy10487        151 KLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSK  230 (610)
Q Consensus       151 ~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~l~l~~N~~~c~c~l~~~~~~l~~~~  230 (610)
                      .|++|+.|+|.+|+|+.|...+|..+..|++|||.+|.|.++.+++|.++ +|++|.+..-.|-|||++.|+..|+...+
T Consensus       390 gl~~LrkL~l~gNqlk~I~krAfsgl~~LE~LdL~~NaiaSIq~nAFe~m-~Lk~Lv~nSssflCDCql~Wl~qWl~~~~  468 (873)
T KOG4194|consen  390 GLPSLRKLRLTGNQLKSIPKRAFSGLEALEHLDLGDNAIASIQPNAFEPM-ELKELVMNSSSFLCDCQLKWLAQWLYRRK  468 (873)
T ss_pred             cchhhhheeecCceeeecchhhhccCcccceecCCCCcceeecccccccc-hhhhhhhcccceEEeccHHHHHHHHHhcc
Confidence            34444444444444444444444455555555555555555555555544 45555555555799999999999999888


Q ss_pred             CCCC-CCCCCCCCccCCCcccccccccccC----CCceeeeecceEeecCceEEEEEEEEe--cCCCeEEEEeCCEEecc
Q psy10487        231 LYSH-PLSCTEPGMLQTKHWDDVKAQEFAC----PPNVTIKESMVIREAGGNVTMSCYVYG--DPEPTILWLLNGQVLHN  303 (610)
Q Consensus       231 l~~~-~~~C~a~~~l~g~~~~~v~~~~~~c----~P~i~~~~~~~~v~~G~~v~l~C~~~g--~P~p~v~W~~~g~~l~~  303 (610)
                      ++.. ...|..|..+.+..+..+...++.|    +|.|...|..+.+..|++++|+|.|.+  .-+-++.|.++......
T Consensus       469 lq~sv~a~CayPe~Lad~~i~svd~~~lvC~DspkpqI~~qPe~~~al~g~nirftC~a~sssasplsi~WR~dnevq~r  548 (873)
T KOG4194|consen  469 LQSSVIAKCAYPEPLADQSIVSVDTANLVCDDSPKPQIVTQPETVSALIGENIRFTCNAYSSSASPLSIEWRKDNEVQPR  548 (873)
T ss_pred             cccceeeeccCCcccccceeEeechhhceecCCCCcceecCchHhhhhhccceEEEEEeccCCCCCceeEeeeccccCcc
Confidence            7643 4589999999999999999999998    488999999999999999999999987  55668999997663221


Q ss_pred             ---CCcc----ceeeccCCceeeeeeEEEEEecCCCCCeEEEEEeecCCcce-eEEEEEEcCccccccccccCCcceeeh
Q psy10487        304 ---SSFD----LLEEEEGDALFEKSVSITLFNVTDLDAGEYTCYAENIRGNA-SGEISLDLPEINLATTLSKTDSWYMLV  375 (610)
Q Consensus       304 ---~~~~----~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~a~N~~G~~-~~~~~L~V~~~~~~p~~~~~~~~~~~~  375 (610)
                         .++.    +...+..+....+.+.|.+.+|+..|+|.|+|++.|..|+. +..+.|+|   ...|.+.+.|....+.
T Consensus       549 v~ved~a~~~~q~r~~~~~e~~~~~~~L~L~nVt~td~grYQCVvtN~FGStysqk~KltV---~~~PsFtktP~dltl~  625 (873)
T KOG4194|consen  549 VDVEDFATFLSQNRNGTFGEREEYTAILHLDNVTFTDEGRYQCVVTNHFGSTYSQKAKLTV---NQAPSFTKTPEDLTLR  625 (873)
T ss_pred             cchhcchhhhhhhccCccchhhhhhheeeeeeeecccCceEEEEEecccCcchhheeEEEe---eccCccccCcccceee
Confidence               1110    11111112223556799999999999999999999999986 55888988   6778999999999988


Q ss_pred             hhhHHHHHHHHHhheeEEEEEEeeecc-cccccccCCccccccccccccceeeeeeeeccCcceeeeecCCCcceeeeee
Q psy10487        376 LGISVCVVSVIVSIGMSFCVCRAHEHK-NKRRKRKGKMKQSVSFNDQEKKLLDVSITTTDRHTGSCEALGSQPDMELIEQ  454 (610)
Q Consensus       376 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~A~N~~G~~~~~~~  454 (610)
                      .+..+-+.|.+.+-+-+.+.|.+.+.+ .+.     -...++.+..++..+.|.+|+.+|+|.|+|.|.|.+|+.+..+.
T Consensus       626 tg~mArl~CaAtG~P~PeIawqkdggtdFPA-----A~eRRl~Vmpedd~f~Itnvk~eD~GiYtC~A~n~AG~isanAt  700 (873)
T KOG4194|consen  626 TGQMARLECAATGHPRPEIAWQKDGGTDFPA-----ARERRLHVMPEDDVFFITNVKIEDQGIYTCTAQNVAGQISANAT  700 (873)
T ss_pred             cccceeeeeeccCCCCcceeehhcCCCCCch-----hhhheeeecCCCCEEEEecccccccceeEEeeeccccceeeceE
Confidence            877776544444444333333333222 000     01122344566677999999999999999999999999999999


Q ss_pred             cccccCCCcceeEecC---CCCCc-----ccccCCCc--ccccCCCC
Q psy10487        455 SLAMEQPPVHITIESH---AVDPQ-----VSVFPPPP--EFSSNHLP  491 (610)
Q Consensus       455 l~v~~~pp~~i~ie~~---~~~~l-----~~~~P~pp--ef~~~~~p  491 (610)
                      |+|.|.|...+-.|..   .++++     +++.|+-|  +|...--|
T Consensus       701 L~V~e~p~f~~PL~~~~V~~get~vlqC~a~~~~a~pr~~W~k~d~p  747 (873)
T KOG4194|consen  701 LTVLETPSFSIPLEDQLVVVGETLVLQCLAEGAPADPRLEWFKEDKP  747 (873)
T ss_pred             EEEecCCcccccccceEEEecceEEEEEecCCCCCCccccccCCCCc
Confidence            9999986544332221   12333     77777744  88865433



>KOG4194|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>PF01462 LRRNT: Leucine rich repeat N-terminal domain; InterPro: IPR000372 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>smart00013 LRRNT Leucine rich repeat N-terminal domain Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query610
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 8e-21
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 4e-18
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 8e-18
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 1e-17
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-17
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-17
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 3e-17
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 4e-17
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 8e-17
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 3e-16
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 8e-16
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 1e-15
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 1e-15
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 4e-15
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 1e-13
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 3e-12
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 3e-12
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 1e-11
3a79_A580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 7e-11
2z81_A549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 7e-11
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 8e-11
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 1e-10
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 1e-10
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 1e-10
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 1e-10
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 1e-10
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 1e-10
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 2e-10
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 2e-10
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-10
2xot_A361 Crystal Structure Of Neuronal Leucine Rich Repeat P 4e-10
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 4e-10
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 5e-10
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 4e-09
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 5e-07
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 4e-09
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 9e-09
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 3e-08
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 3e-08
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 6e-08
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 7e-08
1qz1_A291 Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam 8e-08
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 2e-07
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 6e-07
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 6e-07
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 8e-07
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 9e-07
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-06
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 1e-06
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-06
2v5t_A189 Crystal Structure Of Ncam2 Ig2-3 Length = 189 2e-06
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 4e-06
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 5e-06
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 5e-06
2wim_A291 Crystal Structure Of Ncam2 Ig1-3 Length = 291 5e-06
2xy1_A192 Crystal Structure Of Ncam2 Ig3-4 Length = 192 7e-06
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 8e-06
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 2e-05
3oja_B597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 2e-05
2ifg_A347 Structure Of The Extracellular Segment Of Human Trk 2e-05
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 3e-05
3b43_A570 I-band Fragment I65-i70 From Titin Length = 570 3e-05
2rik_A284 I-Band Fragment I67-I69 From Titin Length = 284 5e-05
3ojm_B231 Crystal Structure Of Fgf1 Complexed With The Ectodo 7e-05
3oj2_C231 Crystal Structure Of Fgf1 Complexed With The Ectodo 7e-05
1nun_B230 Crystal Structure Analysis Of The Fgf10-fgfr2b Comp 8e-05
2rjm_A284 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat 1e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 1e-04
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 2e-04
2om5_A381 N-Terminal Fragment Of Human Tax1 Length = 381 2e-04
1nct_A106 Titin Module M5, N-Terminally Extended, Nmr Length 2e-04
1tnm_A100 Tertiary Structure Of An Immunoglobulin-Like Domain 2e-04
3ojv_C226 Crystal Structure Of Fgf1 Complexed With The Ectodo 2e-04
3s97_C201 Ptprz Cntn1 Complex Length = 201 2e-04
3p3y_A404 Crystal Structure Of Neurofascin Homophilic Adhesio 2e-04
1cvs_C225 Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex L 3e-04
1evt_C225 Crystal Structure Of Fgf1 In Complex With The Extra 3e-04
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 3e-04
1e07_A642 Model Of Human Carcinoembryonic Antigen By Homology 3e-04
3laf_A403 Structure Of Dcc, A Netrin-1 Receptor Length = 403 3e-04
3pxj_A210 Tandem Ig Repeats Of Dlar Length = 210 3e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 3e-04
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 4e-04
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 4e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 4e-04
2yd1_A212 Crystal Structure Of The N-Terminal Ig1-2 Module Of 4e-04
2kdg_A100 Solution Structure Of The 1st Ig Domain Of Myotilin 4e-04
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 4e-04
1u2h_A99 X-Ray Structure Of The N-Terminally Truncated Human 4e-04
2dm3_A110 Solution Structure Of The Second Ig Domain Of Human 5e-04
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure

Iteration: 1

Score = 99.0 bits (245), Expect = 8e-21, Method: Compositional matrix adjust. Identities = 84/338 (24%), Positives = 155/338 (45%), Gaps = 41/338 (12%) Query: 46 FTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLLNLQRIYLKNSGIREVHRDTFKYLT 105 F LPS + L+L +N+++ + +AF+ + L+ ++L+N+ I + F + Sbjct: 79 FNGLPS-----LNTLELFDNRLTTVPTQAFEYLS--KLRELWLRNNPIESIPSYAFNRVP 131 Query: 106 ILVEVDLSD-NQIAWLHQDTFLG--------------ND--------RLKVLYLNGNPIT 142 L +DL + ++ ++ + F G D RL+ L L+GN + Sbjct: 132 SLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLD 191 Query: 143 ELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPN 202 +R G F L L+ + L H Q+ ++ ++A L +LE LNL+ N L L +F P Sbjct: 192 LIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPLHR 251 Query: 203 LKTLSLDGNPWCCDCHLRSFRNWLLKSKLYSHPLSCTE---PGMLQTKHWDDVKAQEFAC 259 L+ + L+ NPW C+C + + +W LK + S+ C P L+ ++ ++ F C Sbjct: 252 LERVHLNHNPWHCNCDVL-WLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFTC 310 Query: 260 PPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWLL-NGQVLHNSSFDLLEEEEGDALF 318 V ++ + G G ++ WL NG ++ + S+ + L Sbjct: 311 YAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRV----RISVLH 366 Query: 319 EKSVSITLFNVTDLDAGEYTCYAENIRGNASGEISLDL 356 + +++ T NVT D G+YTC N GN + +L++ Sbjct: 367 DGTLNFT--NVTVQDTGQYTCMVTNSAGNTTASATLNV 402
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|1QZ1|A Chain A, Crystal Structure Of The Ig 1-2-3 Fragment Of Ncam Length = 291 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|2V5T|A Chain A, Crystal Structure Of Ncam2 Ig2-3 Length = 189 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|2WIM|A Chain A, Crystal Structure Of Ncam2 Ig1-3 Length = 291 Back     alignment and structure
>pdb|2XY1|A Chain A, Crystal Structure Of Ncam2 Ig3-4 Length = 192 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|2IFG|A Chain A, Structure Of The Extracellular Segment Of Human Trka In Complex With Nerve Growth Factor Length = 347 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3B43|A Chain A, I-band Fragment I65-i70 From Titin Length = 570 Back     alignment and structure
>pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 Back     alignment and structure
>pdb|3OJM|B Chain B, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring P253r Apert Mutation Length = 231 Back     alignment and structure
>pdb|3OJ2|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr2b Harboring The A172f Pfeiffer Syndrome Mutation Length = 231 Back     alignment and structure
>pdb|1NUN|B Chain B, Crystal Structure Analysis Of The Fgf10-fgfr2b Complex Length = 230 Back     alignment and structure
>pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 Back     alignment and structure
>pdb|1NCT|A Chain A, Titin Module M5, N-Terminally Extended, Nmr Length = 106 Back     alignment and structure
>pdb|1TNM|A Chain A, Tertiary Structure Of An Immunoglobulin-Like Domain From The Muscle Protein Titin: A New Member Of The I Set Length = 100 Back     alignment and structure
>pdb|3OJV|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr1c Exhibiting An Ordered Ligand Specificity-Determining Betac'-Betae Loop Length = 226 Back     alignment and structure
>pdb|3S97|C Chain C, Ptprz Cntn1 Complex Length = 201 Back     alignment and structure
>pdb|3P3Y|A Chain A, Crystal Structure Of Neurofascin Homophilic Adhesion Complex In Space Group P6522 Length = 404 Back     alignment and structure
>pdb|1CVS|C Chain C, Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex Length = 225 Back     alignment and structure
>pdb|1EVT|C Chain C, Crystal Structure Of Fgf1 In Complex With The Extracellular Ligand Binding Domain Of Fgf Receptor 1 (Fgfr1) Length = 225 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|1E07|A Chain A, Model Of Human Carcinoembryonic Antigen By Homology Modelling And Curve-Fitting To Experimental Solution Scattering Data Length = 642 Back     alignment and structure
>pdb|3LAF|A Chain A, Structure Of Dcc, A Netrin-1 Receptor Length = 403 Back     alignment and structure
>pdb|3PXJ|A Chain A, Tandem Ig Repeats Of Dlar Length = 210 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2YD1|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Drosophila Receptor Protein Tyrosine Phosphatase Dlar Length = 212 Back     alignment and structure
>pdb|2KDG|A Chain A, Solution Structure Of The 1st Ig Domain Of Myotilin Length = 100 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|1U2H|A Chain A, X-Ray Structure Of The N-Terminally Truncated Human Apep-1 Length = 99 Back     alignment and structure
>pdb|2DM3|A Chain A, Solution Structure Of The Second Ig Domain Of Human Palladin Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query610
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-88
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-72
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-50
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-71
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-44
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-35
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-70
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-48
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-51
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-47
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-35
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-47
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-44
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-40
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-42
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-39
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-38
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-38
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-37
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-38
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-33
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-19
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-37
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-37
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-37
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-36
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-29
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-37
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-23
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-36
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-36
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-35
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-28
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-28
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-35
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-33
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-32
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-30
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-34
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-34
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-34
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-31
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-30
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-27
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-26
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-33
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-33
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 1e-18
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 2e-05
1wwb_X103 Protein (brain derived neurotrophic factor recepto 5e-18
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 6e-18
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-17
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 3e-17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-10
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 4e-17
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 4e-17
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 5e-17
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 4e-10
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 6e-17
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 8e-17
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 1e-16
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 1e-16
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 1e-16
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 1e-14
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 2e-16
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 3e-10
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 6e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-16
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-11
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 3e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 4e-16
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 6e-13
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 4e-16
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 1e-13
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 5e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-11
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 7e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 8e-16
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 1e-13
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 9e-16
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 9e-16
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 1e-15
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 9e-14
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-15
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 4e-12
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 1e-15
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 2e-15
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 2e-13
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 2e-15
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 7e-12
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 7e-11
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 2e-15
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 1e-12
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 2e-15
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 2e-15
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-15
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-13
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 1e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-12
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 4e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 4e-15
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 1e-13
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 5e-15
1he7_A126 High affinity nerve growth factor receptor; transf 5e-15
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-15
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 7e-15
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 3e-14
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 7e-15
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 3e-14
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 8e-15
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-14
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-11
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-11
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 4e-11
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 9e-11
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 7e-08
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-06
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 8e-15
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 8e-15
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 9e-15
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 5e-06
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 1e-14
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 1e-13
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 1e-14
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 1e-11
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 5e-10
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 1e-09
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 6e-09
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 1e-05
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 2e-05
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 2e-14
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 2e-14
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 2e-14
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 3e-13
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 2e-14
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 3e-14
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 3e-14
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 4e-14
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 4e-14
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-13
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 3e-13
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 3e-13
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 5e-13
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 4e-14
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 5e-14
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 4e-13
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 2e-12
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 5e-14
2ens_A96 Advanced glycosylation END product-specific recept 6e-14
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 7e-14
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 7e-14
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 7e-14
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 3e-12
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 9e-14
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 9e-11
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 3e-09
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-04
3mjg_X289 Beta-type platelet-derived growth factor receptor; 1e-13
3mjg_X289 Beta-type platelet-derived growth factor receptor; 2e-05
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-13
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-11
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 4e-11
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 2e-05
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 1e-13
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 9e-11
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 1e-13
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 1e-07
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 5e-06
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-13
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 9e-11
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 6e-10
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 1e-06
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-13
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-13
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 5e-11
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 1e-09
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 2e-13
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 2e-07
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 6e-06
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 3e-13
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-11
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 2e-11
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 5e-07
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 4e-13
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-12
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 2e-09
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-06
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 5e-13
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 7e-13
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 6e-13
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 1e-12
2v9t_A117 Roundabout homolog 1; structural protein-receptor 7e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-12
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 8e-11
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 3e-10
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-06
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 1e-12
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 1e-12
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 5e-12
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 5e-12
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 1e-10
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 4e-08
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-12
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 5e-12
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 4e-11
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 5e-11
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-10
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-09
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 4e-06
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 1e-12
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 9e-08
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 2e-04
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 2e-12
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 5e-12
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 2e-12
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 2e-12
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 2e-10
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 2e-12
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 7e-06
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 4e-05
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 3e-12
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 3e-11
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 3e-12
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 1e-10
1gl4_B98 Basement membrane-specific heparan sulfate proteog 3e-12
2fbo_J250 V1V2;, variable region-containing chitin-binding p 5e-12
2fbo_J250 V1V2;, variable region-containing chitin-binding p 6e-06
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 6e-12
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 1e-11
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 9e-12
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-11
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 4e-11
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 5e-06
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-04
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 9e-12
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 1e-07
3s35_X122 Vascular endothelial growth factor receptor 2; ant 1e-11
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 1e-11
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 1e-11
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-11
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 1e-10
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 1e-10
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-09
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 3e-11
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 4e-09
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 4e-11
1waa_A93 Titin; metal binding protein, calmodulin-binding, 5e-11
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 5e-11
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 6e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-08
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 5e-11
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 2e-05
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 8e-11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-09
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 8e-11
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 8e-11
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 1e-10
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 8e-11
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 7e-06
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 9e-11
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 9e-11
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 6e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-05
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 1e-10
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 1e-10
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 3e-06
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 1e-10
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 3e-04
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-10
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 2e-10
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 3e-07
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 2e-10
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 2e-10
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 3e-10
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 6e-05
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 5e-10
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 5e-10
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 4e-09
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 5e-04
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 5e-10
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 1e-07
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 1e-04
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 6e-10
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 7e-10
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 1e-09
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-09
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 1e-09
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 3e-06
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 1e-09
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 1e-09
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 7e-09
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 2e-09
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 2e-09
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 6e-06
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 3e-09
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 3e-09
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 8e-06
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 3e-09
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 4e-08
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 6e-04
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 5e-09
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 3e-08
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 5e-09
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 8e-09
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 9e-09
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 9e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-05
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 2e-08
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 2e-08
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 2e-08
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 3e-08
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 7e-08
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 4e-08
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 7e-08
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 2e-06
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 9e-08
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 7e-07
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 9e-08
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 2e-07
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 2e-07
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 5e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 3e-07
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 9e-07
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 3e-07
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 5e-07
1pko_A139 Myelin oligodendrocyte glycoprotein; IGV-domain, i 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 8e-07
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 9e-07
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 9e-07
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 9e-06
3bn3_B196 ICAM-5, intercellular adhesion molecule 5, telence 1e-06
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 1e-06
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 3e-05
1eaj_A126 Coxsackie virus and adenovirus receptor; virus/vir 1e-06
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 1e-06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 4e-06
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 6e-06
2wy3_A319 MHC class I polypeptide-related sequence B; immune 1e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
1xiw_A105 T-cell surface glycoprotein CD3 epsilon chain; CD3 2e-05
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 2e-05
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 4e-04
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 2e-05
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 3e-05
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 6e-05
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 3e-05
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 4e-05
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 4e-05
3shs_A304 HOC head outer capsid protein; immunoglobulin-like 4e-04
1zxq_A192 ICAM-2, intercellular adhesion molecule-2; immunog 8e-05
3eow_R221 Poliovirus receptor; immunoglobulin super family, 9e-05
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 9e-05
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 1e-04
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 2e-04
2or8_A116 Hepatitis A virus cellular receptor 1 homolog; bet 2e-04
3bia_X116 T-cell immunoglobulin and mucin domain- containing 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
1olz_A663 Semaphorin 4D; developmental protein, CD100, beta- 5e-04
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 8e-04
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
 Score =  276 bits (707), Expect = 7e-88
 Identities = 78/341 (22%), Positives = 122/341 (35%), Gaps = 29/341 (8%)

Query: 24  CPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLLNL 83
           CP  C C          C       +P +L S   +LDL++N +S L  E   +  L NL
Sbjct: 12  CPANCLC----ASNILSCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPT-RLTNL 66

Query: 84  QRIYLKNSGIREVHRDTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPITE 143
             + L ++ +  +  + F  +  L  +DLS N +  L +  F     L+VL L  N I  
Sbjct: 67  HSLLLSHNHLNFISSEAFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVV 126

Query: 144 LRAGQFPKLPYLKTIELQHCQIHSVHKDA---LIHLTALESLNLNGNRLKHLSESVFFPT 200
           +    F  +  L+ + L   QI     +       L  L  L+L+ N+LK L  +     
Sbjct: 127 VDRNAFEDMAQLQKLYLSQNQISRFPVELIKDGNKLPKLMLLDLSSNKLKKLPLTDLQKL 186

Query: 201 PNLK--TLSLDGNPWCCDCHLRSFRNWLLKSKL-----YSHPLSCTEPGMLQTKHWDDVK 253
           P      L L  NP  CDC L    +     +L     +   L C     L      D  
Sbjct: 187 PAWVKNGLYLHNNPLECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLD-- 244

Query: 254 AQEFACPPNVTIKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQVLHNSSFDLLEEEE 313
              F C      KES      G  +T+ C         +    + + + +          
Sbjct: 245 --FFNCSEY---KESAWEAHLGDTLTIRCDTKQQGMTKVWVSPSNEQVLSQG-------S 292

Query: 314 GDALFEKSVSITLFNVTDLDAGEYTCYAENIRGNASGEISL 354
             ++  ++  +    V   D G YTCYA     N +  + L
Sbjct: 293 NGSVSVRNGDLFFKKVQVEDGGVYTCYAMGETFNETLSVEL 333


>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Length = 176 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Length = 193 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Length = 139 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Length = 226 Back     alignment and structure
>3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Length = 196 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 Back     alignment and structure
>1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B Length = 126 Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Length = 117 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>2wy3_A MHC class I polypeptide-related sequence B; immune system-viral protein complex, immune response, innate immunity, structural mimicry; HET: NAG PEU; 1.80A {Homo sapiens} PDB: 1je6_A 1hyr_C 1b3j_A* Length = 319 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>1xiw_A T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon, CD3-delta, UCHT1-SCFV, immunoglobulin fold, antibody-antigen complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 105 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Length = 171 Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 291 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Length = 180 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 Back     alignment and structure
>1zxq_A ICAM-2, intercellular adhesion molecule-2; immunoglobulin fold, cell adhesion, glycoprotein, transmembr; HET: NAG; 2.20A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Length = 192 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 Back     alignment and structure
>2or8_A Hepatitis A virus cellular receptor 1 homolog; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 2.50A {Mus musculus} Length = 116 Back     alignment and structure
>3bia_X T-cell immunoglobulin and mucin domain- containing protein 4; beta barrel, immunoglobulin fold, IGV domain, TIM, glycoprotein; HET: TLA; 2.20A {Mus musculus} PDB: 3bi9_X* 3bib_X* Length = 116 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1olz_A Semaphorin 4D; developmental protein, CD100, beta-propeller, PSI domain, IG-like domain, extracellular receptor, neurogenesis; 2.0A {Homo sapiens} SCOP: b.1.1.4 b.69.12.1 g.16.2.1 PDB: 3ol2_A* Length = 663 Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Length = 198 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query610
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 100.0
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 100.0
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 100.0
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.97
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.96
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.96
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.93
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.91
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.91
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.83
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.82
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.82
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.82
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.81
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.81
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.81
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 99.8
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 99.79
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.78
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 99.78
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.78
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.78
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.78
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.77
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.77
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.77
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.77
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.76
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.76
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.76
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.76
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.76
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.76
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.76
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.76
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.75
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.75
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.75
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.75
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.75
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.74
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.74
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.74
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.74
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.74
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.73
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.73
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.73
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.73
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.73
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.72
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.72
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.72
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.72
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.72
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.72
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.72
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.72
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.72
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.71
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.71
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.71
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.71
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 99.7
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.7
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.7
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.7
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 99.7
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.7
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.7
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.7
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.7
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.7
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.7
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.7
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.7
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.69
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.69
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.69
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.69
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.69
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.69
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 99.68
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.68
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.68
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.68
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.67
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 99.67
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.67
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.67
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.67
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.67
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.67
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.66
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.66
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.66
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.66
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.66
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.66
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.66
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.66
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.66
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.66
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.66
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.65
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.65
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.65
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.65
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.65
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 99.65
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.65
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 99.65
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.65
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.65
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.64
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.64
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.64
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.64
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.64
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.63
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 99.63
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.63
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.63
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.63
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 99.63
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.63
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.63
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.63
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.62
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.62
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 99.62
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.62
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.62
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.62
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.62
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.61
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.61
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.61
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 99.61
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.61
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.61
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.61
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.6
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.6
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 99.6
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.6
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.59
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.59
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.59
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.58
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.57
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.57
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.57
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.56
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.55
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.55
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.55
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.55
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.55
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 99.55
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.54
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.54
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.54
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.54
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.54
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.54
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.54
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.54
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.54
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.54
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.53
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.53
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.52
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.52
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.52
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 99.52
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.52
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.51
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.51
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.51
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.51
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.51
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.51
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.51
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.5
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.5
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.5
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.5
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.5
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.5
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.5
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.5
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.49
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.49
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.49
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.49
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.49
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.49
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.49
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.49
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.49
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.48
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.48
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.48
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.48
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.48
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.48
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.47
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 99.47
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.47
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.47
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.47
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.46
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.46
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.46
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.46
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.46
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 99.46
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 99.45
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.45
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.45
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.45
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.45
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.45
1he7_A126 High affinity nerve growth factor receptor; transf 99.45
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.45
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.45
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.45
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.45
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.45
3sob_L237 Antibody light chain; beta propeller, protein bind 99.45
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.44
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.44
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.44
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.44
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.44
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.43
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.43
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.43
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.43
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.43
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.43
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 99.43
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.43
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.43
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.42
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.42
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.42
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.42
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.42
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 99.42
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.41
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 99.41
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.41
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 99.41
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.41
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.4
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.4
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.4
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.4
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.39
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.39
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.39
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.38
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.38
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.38
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.38
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.38
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.38
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.38
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 99.37
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.37
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 99.37
3umt_A256 SCFV heavy chain and light chain; stability engine 99.37
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.37
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.36
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.36
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.36
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.36
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.36
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.36
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 99.36
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.36
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.35
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.35
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.35
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.35
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.35
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.35
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.35
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.34
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.34
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.34
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.34
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.34
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 99.33
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.33
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.33
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.32
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.31
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.31
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.31
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.3
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.3
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.3
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 99.3
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 99.3
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 99.3
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.29
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.29
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.29
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 99.28
2v9t_A117 Roundabout homolog 1; structural protein-receptor 99.28
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 99.28
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 99.28
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.28
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.27
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 99.27
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.27
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 99.27
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.26
1gl4_B98 Basement membrane-specific heparan sulfate proteog 99.26
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.26
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.25
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.25
3s35_X122 Vascular endothelial growth factor receptor 2; ant 99.25
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 99.25
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 99.25
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 99.24
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 99.24
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.24
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.24
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 99.23
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.23
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 99.23
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.23
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.23
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.23
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 99.23
2ens_A96 Advanced glycosylation END product-specific recept 99.23
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.22
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 99.22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.22
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.22
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.22
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.22
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 99.22
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.22
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.21
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.21
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 99.21
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 99.21
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.2
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.2
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.2
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.19
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.19
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.19
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 99.19
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.19
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.18
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.18
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.18
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.18
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.18
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.17
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.17
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.17
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 99.17
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.16
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 99.16
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 99.15
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.15
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 99.15
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 99.15
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 99.15
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.14
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.14
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 99.14
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 99.13
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.13
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.13
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 99.13
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 99.12
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.12
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.12
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.12
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.12
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.12
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 99.11
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 99.11
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.1
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.1
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.1
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.1
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.1
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.1
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.1
1c5d_H215 Monoclonal antibody against the main immunogenic t 99.09
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.08
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.08
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.06
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.06
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.06
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.06
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.05
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.05
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.05
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.05
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 99.04
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.04
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.03
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 99.02
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.01
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 99.01
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.0
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.0
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 98.99
4acp_A240 IG gamma-1 chain C region; immune system, antibody 98.99
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 98.99
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 98.99
1ypz_E207 T cell receptor delta, beta-2-microglobulin; H2-T2 98.99
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 98.98
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 98.98
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 98.97
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 98.97
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 98.97
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 98.97
3to4_D253 NKT vbeta2 (mouse variable domain, human constant; 98.96
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 98.96
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 98.96
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 98.96
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 98.95
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 98.95
3u2s_H248 PG9 heavy chain; greek KEY, immunoglobulin, immune 98.95
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=8.6e-45  Score=389.24  Aligned_cols=332  Identities=23%  Similarity=0.459  Sum_probs=252.1

Q ss_pred             CCCCCCCCCCeeCccCCCcEEEcCCCCCCccCcccCCCccEEEeecCCCCCCChhhhcccCCCCccEEEcccCCCcccch
Q psy10487         19 PDWTDCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLLNLQRIYLKNSGIREVHR   98 (610)
Q Consensus        19 ~~~~~Cp~~C~C~~~~~~~~~~C~~~~l~~lP~~l~~~L~~L~L~~n~i~~l~~~~~~~~~l~~L~~L~L~~n~l~~i~~   98 (610)
                      .....||..|.|...  ...++|.+.+|+++|..++.+++.|+|++|+|+.+....|.  ++.+|++|+|++|.|..+.+
T Consensus        30 ~~~~~Cp~~C~C~~~--~~~v~c~~~~l~~iP~~~~~~l~~L~L~~n~i~~~~~~~~~--~l~~L~~L~Ls~n~i~~i~~  105 (440)
T 3zyj_A           30 GSAQTCPSVCSCSNQ--FSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFK--HLRHLEILQLSRNHIRTIEI  105 (440)
T ss_dssp             ---CCCCSSSEECTT--SCEEECCSCCCSSCCSCCCTTCSEEECCSCCCCEECTTTTS--SCSSCCEEECCSSCCCEECG
T ss_pred             cccccCCCCCEeCCC--CCEEEeCCCCcCcCCCCCCCCCcEEEccCCcCCeeCHHHhh--CCCCCCEEECCCCcCCccCh
Confidence            344589999999854  36899999999999999999999999999999999888887  68888888888888888887


Q ss_pred             hhhcCCCCCcEEEccCCCCCCCCcccccCCCCCcEEEeeCccccccCc--------------------------------
Q psy10487         99 DTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPITELRA--------------------------------  146 (610)
Q Consensus        99 ~~f~~l~~L~~LdLs~n~l~~l~~~~f~~l~~L~~L~Ls~N~l~~l~~--------------------------------  146 (610)
                      .+|.++++|++|+|++|+|..+++..|.++++|++|+|++|.++.+..                                
T Consensus       106 ~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~~~~~l~~L~~L~l~~~~~l~~i~~~~~~~l~  185 (440)
T 3zyj_A          106 GAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLS  185 (440)
T ss_dssp             GGGTTCSSCCEEECCSSCCSSCCTTTSCSCSSCCEEECCSCCCCEECTTTTTTCTTCCEEECCCCTTCCEECTTTTTTCS
T ss_pred             hhccCCccCCEEECCCCcCCeeCHhHhhccccCceeeCCCCcccccCHHHhhhCcccCEeCCCCCCCcceeCcchhhccc
Confidence            788888888888888888777776666666666666666665554432                                


Q ss_pred             ---------------------------------------CcCCCCCCccEEEccCccccccCHHHhhcCccccccccccc
Q psy10487        147 ---------------------------------------GQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGN  187 (610)
Q Consensus       147 ---------------------------------------~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n  187 (610)
                                                             ..|.++++|+.|+|++|+|+.+.+..|..+++|+.|+|++|
T Consensus       186 ~L~~L~L~~n~l~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N  265 (440)
T 3zyj_A          186 NLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHN  265 (440)
T ss_dssp             SCCEEECTTSCCSSCCCCTTCSSCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCCCCEECTTSSTTCTTCCEEECTTS
T ss_pred             ccCeecCCCCcCccccccCCCcccCEEECCCCccCccChhhhccCccCCEEECCCCceeEEChhhhcCCCCCCEEECCCC
Confidence                                                   22333333444444444444444445556677778888888


Q ss_pred             cccccCcccccCCCcccEEecCCCcccccCCchhhHHHHhhccC--CCCCCCCCCCCccCCCcccccccccccCC-Ccee
Q psy10487        188 RLKHLSESVFFPTPNLKTLSLDGNPWCCDCHLRSFRNWLLKSKL--YSHPLSCTEPGMLQTKHWDDVKAQEFACP-PNVT  264 (610)
Q Consensus       188 ~l~~~~~~~~~~~~~L~~l~l~~N~~~c~c~l~~~~~~l~~~~l--~~~~~~C~a~~~l~g~~~~~v~~~~~~c~-P~i~  264 (610)
                      +++.++...|..+++|+.|++++|+|.|||.+.|+..|+.....  ......|..|..+.|+.+.++....+.|. |.+.
T Consensus       266 ~l~~~~~~~~~~l~~L~~L~L~~Np~~CdC~l~~l~~~~~~~~~~~~~~~~~C~~P~~l~g~~l~~l~~~~~~C~~P~i~  345 (440)
T 3zyj_A          266 NLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIV  345 (440)
T ss_dssp             CCCCCCTTTTSSCTTCCEEECCSSCEECSSTTHHHHHHHHTTSCSSCSCCCBEEESTTTTTCBCC----CCSCCCCCCEE
T ss_pred             CCCccChhHhccccCCCEEEcCCCCccCCCCchHHHHHHHhccccCCccccCCCChhHhcCccHhHhhhhhccCCCCccc
Confidence            88888888888899999999999999999999999999986532  23457899999999999999999999995 7777


Q ss_pred             eeecceEeecCceEEEEEEEEecCCCeEEEEeCCEE-eccCCccceeeccCCceeeeeeEEEEEecCCCCCeEEEEEeec
Q psy10487        265 IKESMVIREAGGNVTMSCYVYGDPEPTILWLLNGQV-LHNSSFDLLEEEEGDALFEKSVSITLFNVTDLDAGEYTCYAEN  343 (610)
Q Consensus       265 ~~~~~~~v~~G~~v~l~C~~~g~P~p~v~W~~~g~~-l~~~~~~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~a~N  343 (610)
                      ..+....+.+|++++|.|.+ +.|.|.+.|++++.. +.........      .....++|+|.+++.+|+|.|+|+|.|
T Consensus       346 ~~~~~~~v~~G~~v~L~C~~-~~p~p~i~W~~~~~~~~~~~~~~~~~------~~~~~~~L~I~~v~~~D~G~Y~C~a~N  418 (440)
T 3zyj_A          346 EPPADLNVTEGMAAELKCRA-STSLTSVSWITPNGTVMTHGAYKVRI------AVLSDGTLNFTNVTVQDTGMYTCMVSN  418 (440)
T ss_dssp             ECCCCEEECTTSCCEECCEE-SSTTSEEEEECTTSCEEESSSCCSSE------EECTTCCEEESSCCSTTCEEEEEEEEC
T ss_pred             ccccceeeccCceEEEEeec-CCCCCceEEEeCCCceeeccCCCceE------EEccCCeEEEccCChhhCEEEEEEEEc
Confidence            78889999999999999999 679999999995543 3322211111      112235899999999999999999999


Q ss_pred             CCcceeEEEEEEcCcccc
Q psy10487        344 IRGNASGEISLDLPEINL  361 (610)
Q Consensus       344 ~~G~~~~~~~L~V~~~~~  361 (610)
                      ..|.+++++.+.|.+.+.
T Consensus       419 ~~G~~~~~~~~~v~~~~~  436 (440)
T 3zyj_A          419 SVGNTTASATLNVTGTHH  436 (440)
T ss_dssp             SSCEEEEEEEEEEC----
T ss_pred             CCCcEEEEEEEEEecccc
Confidence            999999999999965443



>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 610
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-31
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-24
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-23
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 7e-17
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 1e-12
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 4e-12
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 2e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 7e-11
d1f97a2110 b.1.1.4 (A:129-238) Junction adhesion molecule, JA 1e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 4e-10
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 9e-10
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 2e-09
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 2e-09
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-09
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-04
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 1e-08
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-05
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 3e-08
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 3e-08
d1epfa292 b.1.1.4 (A:98-189) Neural cell adhesion molecule ( 5e-08
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 6e-08
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-08
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-05
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 1e-07
d1he7a_107 b.1.1.4 (A:) High affinity nerve growth factor rec 1e-07
d1wwbx_103 b.1.1.4 (X:) Ligand binding domain of trkB recepto 1e-07
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 2e-07
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 2e-07
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 2e-07
d1ccza193 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter 5e-07
d1zxqa1106 b.1.1.3 (A:87-192) Intercellular cell adhesion mol 5e-07
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 7e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-04
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 2e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1pd6a_94 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 3e-06
d1iama1103 b.1.1.3 (A:83-185) Intercellular cell adhesion mol 3e-06
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 3e-06
d1biha194 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropi 4e-06
d1pkoa_126 b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein ( 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1f97a1102 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM 1e-05
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 1e-05
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 2e-05
d2dava1113 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t 3e-05
d1n26a193 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai 3e-05
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 4e-05
d1nbqa1105 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM 5e-05
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 5e-05
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 6e-05
d1eaja_124 b.1.1.1 (A:) Coxsackie virus and adenovirus recept 6e-05
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 1e-04
d2ifga192 b.1.1.4 (A:192-283) High affinity nerve growth fac 2e-04
d1wwca_105 b.1.1.4 (A:) NT3 binding domain of trkC receptor { 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1hnga198 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus no 4e-04
d1iray1101 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1de4a194 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, a 0.003
d2nxyb197 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Ho 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1cs6a2105 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gall 0.004
d1iray2103 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor 0.004
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  121 bits (303), Expect = 2e-31
 Identities = 68/281 (24%), Positives = 105/281 (37%), Gaps = 48/281 (17%)

Query: 24  CPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLL-- 81
           CP  C C +   K +  C      A+P  + +  Q + L+ N+IS++   +F++   L  
Sbjct: 2   CPGACVC-YNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRISHVPAASFRACRNLTI 60

Query: 82  ---------------------------------------------NLQRIYLKNSGIREV 96
                                                         L  ++L   G++E+
Sbjct: 61  LWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQEL 120

Query: 97  HRDTFKYLTILVEVDLSDNQIAWLHQDTFLGNDRLKVLYLNGNPITELRAGQFPKLPYLK 156
               F+ L  L  + L DN +  L  DTF     L  L+L+GN I+ +    F  L  L 
Sbjct: 121 GPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRGLHSLD 180

Query: 157 TIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPNLKTLSLDGNPWCCD 216
            + L   ++  VH  A   L  L +L L  N L  L      P   L+ L L+ NPW CD
Sbjct: 181 RLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWVCD 240

Query: 217 CHLRSFRNWLLKSKLYSHPLSCTEPGMLQTKHWDDVKAQEF 257
           C  R    WL K +  S  + C+ P  L  +    + A + 
Sbjct: 241 CRARPLWAWLQKFRGSSSEVPCSLPQRLAGRDLKRLAANDL 281


>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 94 Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 98 Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 105 Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query610
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.97
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.96
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.79
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.76
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.62
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.61
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.59
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.59
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.59
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.58
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.57
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.56
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.56
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.55
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.51
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.5
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.5
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.49
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.49
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.46
d2avga1110 Cardiac myosin binding protein C, different domain 99.45
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.45
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.45
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.45
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.44
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.44
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.43
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.43
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.43
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.43
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.42
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.42
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.41
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.41
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.4
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.39
d1gxea_130 Cardiac myosin binding protein C, different domain 99.39
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.38
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.38
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.36
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.36
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.35
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.34
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.34
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.33
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.3
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.29
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.29
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.28
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.27
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.25
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.23
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.23
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.22
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.21
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.21
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.18
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.17
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 99.13
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.12
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.12
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.09
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.05
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.96
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.87
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.82
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.71
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.68
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 98.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.47
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.47
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.31
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 98.24
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 98.23
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.18
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 98.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.14
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.12
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.09
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 98.07
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 98.07
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.06
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.06
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 98.05
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 98.05
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 98.05
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 98.04
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 98.02
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.02
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.01
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.0
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 97.99
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.99
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 97.97
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.96
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 97.95
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 97.95
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 97.95
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 97.94
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 97.93
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 97.93
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 97.92
d1gxea_130 Cardiac myosin binding protein C, different domain 97.91
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.9
d1q0xl2102 Immunoglobulin light chain lambda constant domain, 97.9
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 97.89
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 97.88
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 97.87
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 97.86
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 97.86
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.86
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 97.84
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 97.83
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.82
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.82
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 97.81
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 97.81
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 97.78
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 97.76
d1jhll_108 Immunoglobulin light chain kappa variable domain, 97.76
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.75
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 97.75
d1ospl1107 Immunoglobulin light chain kappa variable domain, 97.75
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 97.75
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.74
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 97.74
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 97.74
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.73
d2ifga192 High affinity nerve growth factor receptor TrkA, d 97.73
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 97.73
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 97.73
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 97.73
d2avga1110 Cardiac myosin binding protein C, different domain 97.71
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.71
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 97.69
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 97.68
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 97.64
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 97.64
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.64
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 97.63
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 97.63
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 97.62
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.62
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 97.61
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 97.61
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 97.6
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 97.58
d1o0va1104 Immunoglobulin heavy chain epsilon constant domain 97.57
d1mexl1107 Immunoglobulin light chain kappa variable domain, 97.57
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 97.57
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 97.56
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.56
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 97.54
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 97.54
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 97.54
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 97.52
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 97.51
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.51
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 97.5
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 97.5
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 97.49
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 97.49
d1d5il1107 Immunoglobulin light chain kappa variable domain, 97.49
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 97.48
d1op3k1106 Immunoglobulin light chain kappa variable domain, 97.48
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 97.48
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 97.47
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 97.46
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 97.46
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 97.44
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 97.44
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 97.42
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 97.41
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 97.41
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.41
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 97.4
d1mjul2107 Immunoglobulin light chain kappa constant domain, 97.4
d8faba1103 Immunoglobulin light chain lambda variable domain, 97.4
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.39
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.39
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.38
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 97.37
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.37
d1nfde2104 Immunoglobulin light chain lambda constant domain, 97.37
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 97.35
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 97.35
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 97.33
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 97.32
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 97.31
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 97.31
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.29
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 97.26
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 97.26
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 97.26
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.26
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 97.26
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 97.25
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 97.24
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 97.24
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 97.23
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 97.22
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 97.22
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 97.2
d2gsia1111 Immunoglobulin light chain kappa variable domain, 97.19
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 97.18
d1cqka_101 Immunoglobulin heavy chain gamma constant domain 3 97.17
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 97.17
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 97.17
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 97.16
d1l6xa2102 Immunoglobulin heavy chain gamma constant domain 3 97.16
d1w72l1109 Immunoglobulin light chain lambda variable domain, 97.15
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 97.15
d1oaql_110 Immunoglobulin light chain lambda variable domain, 97.15
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 97.14
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.11
d2rhea_114 Immunoglobulin light chain lambda variable domain, 97.11
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.1
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 97.1
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.1
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.09
d1igtb4102 Immunoglobulin heavy chain gamma constant domain 3 97.09
d1i1ca2102 Immunoglobulin heavy chain gamma constant domain 3 97.08
d1lgva1112 Immunoglobulin light chain lambda variable domain, 97.07
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 97.07
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.05
d1j05a_111 Immunoglobulin light chain kappa variable domain, 97.05
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 97.05
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.04
d1mjul1112 Immunoglobulin light chain kappa variable domain, 97.02
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 97.02
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.02
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.01
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.0
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 97.0
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 96.99
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.99
d1hyrc194 Class I MHC homolog, alpha-3 domain {Human (Homo s 96.98
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 96.98
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 96.94
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 96.91
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 96.88
d1dn0b2105 Immunoglobulin heavy chain mu constant domain 1, C 96.88
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.87
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 96.86
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 96.84
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 96.84
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 96.83
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 96.83
d1nfde1108 Immunoglobulin light chain lambda variable domain, 96.81
d1kcvh2101 Immunoglobulin heavy chain gamma constant domain 1 96.8
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 96.78
d1ogae2127 T-cell antigen receptor {Human (Homo sapiens), bet 96.78
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 96.77
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 96.72
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 96.71
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 96.69
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 96.66
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 96.66
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 96.58
d1hxmb2107 T-cell antigen receptor {Human (Homo sapiens), del 96.56
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 96.52
d1mjuh2102 Immunoglobulin heavy chain gamma constant domain 1 96.51
d1igtb3119 Immunoglobulin heavy chain gamma constant domain 2 96.41
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 96.28
d1fltx_95 Second domain of the Flt-1 receptor {Human (Homo s 96.25
d1l6xa1105 Immunoglobulin heavy chain gamma constant domain 2 96.24
d2fbjh2102 Immunoglobulin heavy chain alpha constant domain 1 96.2
d1c5ch2103 Immunoglobulin heavy chain gamma constant domain 1 96.19
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 96.18
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.17
d1pd6a_94 Cardiac myosin binding protein C, different domain 96.16
d1u58a198 Immunomodulatory protein m144, alpha-3 domain {Mur 96.13
d1xiwa_91 CD3 epsilon chain ectodomain fragment {Human (Homo 96.06
d1i1ca1103 Immunoglobulin heavy chain gamma constant domain 2 96.04
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.03
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 96.02
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 96.0
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 95.99
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 95.99
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 95.87
d1ow0a1101 Immunoglobulin heavy chain alpha constant domain 2 95.83
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 95.82
d1fp5a1103 Immunoglobulin heavy chain epsilon constant domain 95.78
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 95.77
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 95.53
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 95.51
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 95.5
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 95.47
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 95.47
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 95.46
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 95.46
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 95.45
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 95.44
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 95.33
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 95.33
d1jbja2100 CD3 epsilon chain ectodomain fragment {Mouse (Mus 95.3
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 95.26
d1rhhb1130 Immunoglobulin heavy chain variable domain, VH {Hu 95.25
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 95.23
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 95.22
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 95.21
d1rz7h1119 Immunoglobulin heavy chain variable domain, VH {Hu 95.2
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 95.18
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 95.11
d1i3ua_127 Camelid IG heavy chain variable domain, VHh {Llama 95.11
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 95.08
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 95.06
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 95.05
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 95.04
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 95.01
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 94.98
d1n0xh1127 Immunoglobulin heavy chain variable domain, VH {Hu 94.96
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 94.96
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 94.93
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 94.92
d1nfdf1121 Immunoglobulin heavy chain variable domain, VH {Ha 94.85
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 94.83
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 94.83
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 94.83
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 94.8
d1dlfh_120 Immunoglobulin heavy chain variable domain, VH {Mo 94.76
d1hnfa1101 CD2, first domain {Human (Homo sapiens) [TaxId: 96 94.75
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 94.73
d1ad9b1120 Immunoglobulin heavy chain variable domain, VH {En 94.68
d1pfca_111 Immunoglobulin heavy chain gamma constant domain 3 94.66
d2fx7h1127 Immunoglobulin heavy chain variable domain, VH {Hu 94.64
d2p49b1121 Camelid IG heavy chain variable domain, VHh {Camel 94.64
d1lmka1126 Immunoglobulin heavy chain variable domain, VH {Mo 94.62
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 94.59
d1yedb1124 Immunoglobulin heavy chain variable domain, VH {Mo 94.57
d1q9rb1122 Immunoglobulin heavy chain variable domain, VH {Mo 94.56
d1fn4b1116 Immunoglobulin heavy chain variable domain, VH {Ra 94.55
d2nxyd1128 Immunoglobulin heavy chain variable domain, VH {Hu 94.5
d2b1hh1124 Immunoglobulin heavy chain variable domain, VH {En 94.49
d1op3h1125 Immunoglobulin heavy chain variable domain, VH {En 94.39
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 94.29
d1lo4h1118 Immunoglobulin heavy chain variable domain, VH {Mo 94.27
d3c2ah1131 Immunoglobulin heavy chain variable domain, VH {Hu 94.24
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 94.23
d3cx5j1127 Immunoglobulin heavy chain variable domain, VH {Mo 94.21
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 94.16
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 93.95
d3d85d187 The p40 domain of interleukin-12 (IL-12 beta chain 93.95
d1rzfh1133 Immunoglobulin heavy chain variable domain, VH {Hu 93.93
d1hxma286 T-cell antigen receptor {Human (Homo sapiens), gam 93.86
d1rzga1130 Immunoglobulin heavy chain variable domain, VH {Hu 93.86
d2fb4h1127 Immunoglobulin heavy chain variable domain, VH {Hu 93.63
d1sy6a181 CD3 gamma chain ectodomain fragment {Human (Homo s 92.66
d1jbja186 CD3 gamma chain ectodomain fragment {Mouse (Mus mu 92.65
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 92.56
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 92.14
d1b2wh1117 Immunoglobulin heavy chain variable domain, VH {En 92.05
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 91.67
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 91.24
d1igyb3116 Immunoglobulin heavy chain gamma constant domain 2 91.23
d1xiwb_74 CD3 delta chain ectodomain fragment {Human (Homo s 90.2
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 84.67
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 83.32
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 80.8
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 80.73
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 80.17
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=2.9e-30  Score=257.36  Aligned_cols=232  Identities=29%  Similarity=0.494  Sum_probs=192.8

Q ss_pred             CCCCCCeeCccCCCcEEEcCCCCCCccCcccCCCccEEEeecCCCCCCChhhhcccCCCCccEEEcccCCCccc------
Q psy10487         23 DCPDTCRCKWTLGKKSALCKDANFTALPSTLDSDIQVLDLNNNKISYLTKEAFKSIGLLNLQRIYLKNSGIREV------   96 (610)
Q Consensus        23 ~Cp~~C~C~~~~~~~~~~C~~~~l~~lP~~l~~~L~~L~L~~n~i~~l~~~~~~~~~l~~L~~L~L~~n~l~~i------   96 (610)
                      +||..|.|.. .....|+|.+.+|+++|..+|.++++|+|++|+|+.+++..|.  ++.+|++|++++|.|..+      
T Consensus         1 ~cp~~C~C~~-~~~~~v~c~~~~L~~iP~~ip~~~~~L~Ls~N~i~~i~~~~f~--~l~~L~~L~ls~n~l~~i~~~~~~   77 (284)
T d1ozna_           1 PCPGACVCYN-EPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRISHVPAASFR--ACRNLTILWLHSNVLARIDAAAFT   77 (284)
T ss_dssp             CCCTTCEEEC-SSSCEEECCSSCCSSCCTTCCTTCSEEECTTSCCCEECTTTTT--TCTTCCEEECCSSCCCEECTTTTT
T ss_pred             CcCCCCEEcC-CCCeEEEcCCCCCCccCCCCCCCCCEEECcCCcCCCCCHHHhh--cccccccccccccccccccccccc
Confidence            5999999963 3357899999999999999999999999999999999998887  677777777776665422      


Q ss_pred             -------------------chhhhcCCCCCcEEEcc------------------------CCCCCCCCcccccCCCCCcE
Q psy10487         97 -------------------HRDTFKYLTILVEVDLS------------------------DNQIAWLHQDTFLGNDRLKV  133 (610)
Q Consensus        97 -------------------~~~~f~~l~~L~~LdLs------------------------~n~l~~l~~~~f~~l~~L~~  133 (610)
                                         .+.+|+++++|++|+++                        +|+|+.+++..|..+.+|+.
T Consensus        78 ~~~~~~~l~~~~~~~~~~l~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~L~~l~l~~N~l~~i~~~~f~~~~~L~~  157 (284)
T d1ozna_          78 GLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTH  157 (284)
T ss_dssp             TCTTCCEEECCSCTTCCCCCTTTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCTTCCE
T ss_pred             ccccccccccccccccccccchhhcccccCCEEecCCcccccccccccchhcccchhhhccccccccChhHhccccchhh
Confidence                               23344555555555555                        44555555666777778888


Q ss_pred             EEeeCccccccCcCcCCCCCCccEEEccCccccccCHHHhhcCccccccccccccccccCcccccCCCcccEEecCCCcc
Q psy10487        134 LYLNGNPITELRAGQFPKLPYLKTIELQHCQIHSVHKDALIHLTALESLNLNGNRLKHLSESVFFPTPNLKTLSLDGNPW  213 (610)
Q Consensus       134 L~Ls~N~l~~l~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~L~~l~l~~N~~  213 (610)
                      |+|++|.++.+.+..|.++++|+.|++++|++..+.+..|..+++|+.|++++|.+..+.+..|..+.+|+.|++++|+|
T Consensus       158 L~l~~N~l~~l~~~~f~~l~~L~~l~l~~N~l~~i~~~~f~~l~~L~~L~l~~N~i~~~~~~~~~~~~~L~~L~l~~N~l  237 (284)
T d1ozna_         158 LFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPW  237 (284)
T ss_dssp             EECCSSCCCEECTTTTTTCTTCCEEECCSSCCCEECTTTTTTCTTCCEEECCSSCCSCCCHHHHTTCTTCCEEECCSSCE
T ss_pred             cccccCcccccchhhhccccccchhhhhhccccccChhHhhhhhhcccccccccccccccccccccccccCEEEecCCCC
Confidence            88888888888888888888888888888888888888888888999999999999999888899999999999999999


Q ss_pred             cccCCchhhHHHHhhccCCCCCCCCCCCCccCCCcccccccccc
Q psy10487        214 CCDCHLRSFRNWLLKSKLYSHPLSCTEPGMLQTKHWDDVKAQEF  257 (610)
Q Consensus       214 ~c~c~l~~~~~~l~~~~l~~~~~~C~a~~~l~g~~~~~v~~~~~  257 (610)
                      .|+|.+.|+..|++........+.|..|..+.|+.+.++...++
T Consensus       238 ~C~C~~~~l~~~l~~~~~~~~~~~C~~p~~l~g~~l~~l~~~~l  281 (284)
T d1ozna_         238 VCDCRARPLWAWLQKFRGSSSEVPCSLPQRLAGRDLKRLAANDL  281 (284)
T ss_dssp             ECSGGGHHHHHHHHHCCSEECCCBEEESGGGTTCBGGGSCGGGS
T ss_pred             CCCccchHHHHHHHhCcCCCCceEeCCchHHcCCccccCCHHHC
Confidence            99999999999999888888899999999999998888887776



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c5ch2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} Back     information, alignment and structure
>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1ow0a1 b.1.1.2 (A:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin heavy chain variable domain, VH {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1fn4b1 b.1.1.1 (B:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} Back     information, alignment and structure
>d3c2ah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d3d85d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1sy6a1 b.1.1.4 (A:1-81) CD3 gamma chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbja1 b.1.1.4 (A:101-186) CD3 gamma chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b2wh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igyb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure