Psyllid ID: psy10545


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------143
MNFEKNYYWDFILIGAGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQTVLSSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKLSWINLKFQFGVGYPNTNQGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQNDISSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGINNFLFNNKTVEIITPTSIRINNKKIINANCIIDGRGLKNSQFDGIYQIFLGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLFDLSKNRMENYVNLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNYSKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNSLFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISIYVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSNSLFVIYFGLSEQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGCSTFYALIPVPNLSNSSINWSEESIKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDVLGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSSAIKLFDPVIRYKVLMLYAWCRYCDDVIDNQICGNRSKFLKKNVSMKHKLKILRIKTKRACIGFKMKEPAFLALQKIISIHSFPVHLLFEHLDGFEMDVMERTYITLDETLGYCYHVAGTIGLIIAHLIGVKEKDTLNCARNLGIAFQLTNISRDVIDDFYVGRCYLPLDWLRNEGLNKSNFVLAENRKKLFKVVTRILDVAEFYYSSSLVKLNTLPLRSTLAIVTSWSIYREI
cccccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEEccccccccEEEccccccccccHHcccccccccccccEEEccccccccccccccccccHHHHHHHHHHcccccccccccccccEEEEcccccccccEEEEEEcccccccEEEEcccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEcccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHccccccccHHHHcccccccHHHHHHHHHHccccccccccccccEEEEEEEEccccEEEEcccHHHHHHHHHHHHHccccEEEEEEccccccccEEEcccccccHHHHHHHcHHHcccccccEEEcccccccccccccccccHHHHHHHHHHcccccEEEcccEEEEEcccEEEEccccEEEccEEEEccccccccccccccEEcccEEEEcccccccccEEEEcccccccccEEEEEEcccccccEEEEcccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEcccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccccccccccEEEEEcccccHHHHHHHHHcccccEEEEcccccccccEEEEEEcccEEcccccccccHHHHHHHHHHccccccccEEcEEcccccEEEcccccEEEEcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccHHHHHHcccccHHHHHHHccccccccccccccHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHHcccEEEcccccEEEEEEccEEEEEEEccccEEEccEEEEcccHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccccccEEEccccHHHHHHHHHccccccccccEEEEccccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHccccccccccccccccccccccccccccccccEEEcccccccccHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcc
ccccHcccHHEEEEHHHHHHHHHHHHHHHHccccEEEEEEccccccccEEEEccccccHHHHHHHccEEEEcccccEEEccHHccEccccEEEEEccccccccEEEEEEEEEEccccccccEEEEEccccHccccEEEEEEcccccccEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEcHccccEEEEEccccccccccccEccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHcccccccHEEEEEccccHHHHHHHHHHHcccEEEEEcccccEEccccEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEccccccccccEcccccccHHHHHHHHHHHHccccccEEEEccccccccccccEEcHHHHHHHHHHHHcccccEEEcEEEEEEcccEEEEcccEEEEEEEEEEccccccccccccEEEEEEEEEEEccccccccEEEEEccHHHcccccEEEEEccccccEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEcHHcccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHcccEEEEEEEcccccccEEEEEccccEEccccEEEccHHHHHHHHHHHcccHHHcEEEEEcccEEEEEEccccEEEccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHcccccccHHHHHHHHHHHHHHcccEEcccHHHHHHHHHHHHHHHcccEEEEcccEEEEEEEccEEEEEEEccccEEEccEEEEcccHHHHHHHHccccccccccHHHHHHccccccEEEEEEcccccccccccEEEEEcHHHHHHHHHHHHccccccccEEEEEcccccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHEEEEEEEcHHHHHHHHcccccccccccccEEEEccEcccccccccccEEEEEccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccHHHHHcccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHccccccHHHHEEEHHHHHHHHHc
mnfeknyyWDFILIGAGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQTVLSSSQYMlikplityswpsyqvkfpkfnrkifSGYYSICSKHLNSYLIRALGQqwnlssphgldipiimdatvnqkndeyhfiytlpltpnslmiedtrytkkpflKIDMLKKSIKDYAIKNRWKLkniereeigsipialknekIIKFKKTICVGLRANLlhattgyslPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNrlfflsnsrchlDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKLSWINLKFqfgvgypntnqgLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHqndisssqymlikplityswpsyqvkfpkfnrkifSGYYSICSKHLNSYLIRALGInnflfnnktveiitptsirinnkkiinanciidgrglknsqfdGIYQIFLGqqwnlssphgldipiimdatvnqkndeyhfiytlpltpnslmiedtrytkkpflKIDMLKKSIKDYAIKNRWKLkniereeigsipialknekIIKFKKTICVGLRANLlhattgyslPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNrlfflsnsrchlDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEqrdkpggrayvykqdgfifdagptvitdpnsIKLLFDLSKNRMENYvnllpikpfyrlywgkekflnYEDNIKDLEKQIAKFNLNDIKGYRLFLNYSKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYlkqafsfnslfiggnpfstsSIYTLIHALEYewgiwfpkggVGALIKALIKLFQNLGGNLILNSQVISIYVnnnkvnkvhlkngqifdadiiVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSNSLFVIYFGLSeqythlahhtiffpsnyKKSIENIFgknfsrdnlsiylhspsvtdlslaptgcstfyalipvpnlsnssinwsEESIKLKNIVFMYLEQYCIPNLRKKLITqriftpndfKDVLGSYlgsafsfaplltqsawfrphnrdknltnlyfvgagthpgaANKIIKAGSKSFSSAIKLFDPVIRYKVLMLYAWCRYCddvidnqicgnrskFLKKNVSMKHKLKILRIKTKRACIGFKMKEPAFLALQKIISIHSFPVHLLFEHLDGFEMDVMERTYITLDETLGYCYHVAGTIGLIIAHLigvkekdtLNCARNLGIAFqltnisrdviddfyvgrcylpldwlrneglnksnFVLAENRKKLFKVVTRILDVAEFYYSsslvklntlplrstlaIVTSWSIYREI
MNFEKNYYWDFILIGAGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQTVLSSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTlpltpnslmiEDTRYTKKPFLKIDMLKKSikdyaiknrwklkniereeigsipialknekiIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKLSWINLKFQFGVGYPNTNQGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQNDISSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGINNFLFNNKTVEiitptsirinnkkiiNANCIIDGRGLKNSQFDGIYQIFLGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTlpltpnslmiEDTRYTKKPFLKIDMLKKSikdyaiknrwklkniereeigsipialknekiIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIfdagptvitdpnSIKLLFDLSKNRMENYVNLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNYSKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNSLFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISIYVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSNSLFVIYFGLSEQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGCSTFYALIPVPNLSNSSINWSEESIKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDVLGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSSAIKLFDPVIRYKVLMLYAWCRYCDDVIDNQICGNRSkflkknvsmkhklkilriKTKRACIGFKMKEPAFLALQKIISIHSFPVHLLFEHLDGFEMDVMERTYITLDETLGYCYHVAGTIGLIIAHLIGVKEKDTLNCARNLGIafqltnisrdvidDFYVGRCYLPLDWLRNEGLNKSNFVLAENRKKLFKVVTRILDVAEFYYSSslvklntlplrstlaivtswsiyrei
MNFEKNYYWDFILIGAGLWNSIIAWYLKQYNPklnvlllelsssvknHIWSFHQTVLSSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSgagiggialaiRLQTAGISTIILEQRDKLSWINLKFQFGVGYPNTNQGLWNSIIAWYLKQYNPklnvlllelsssvknHIWSFHQNDISSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGINNFLFNNKTVEIITPTSirinnkkiinanciiDGRGLKNSQFDGIYQIFLGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSgagiggialaiRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLFDLSKNRMENYVNLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNYSKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNSLFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISIYvnnnkvnkvhlknGQIFDADIIVSNADIINTYRNLLGQYAFGkkkymnlikkkMSNSLFVIYFGLSEQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGCSTFYALIPVPNLsnssinwseesiKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDVLGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSSAIKLFDPVIRYKVLMLYAWCRYCDDVIDNQICGNRSKFLKKNVSMKHKLKILRIKTKRACIGFKMKEPAFLALQKIISIHSFPVHLLFEHLDGFEMDVMERTYITLDETLGYCYHVAGTIGLIIAHLIGVKEKDTLNCARNLGIAFQLTNISRDVIDDFYVGRCYLPLDWLRNEGLNKSNFVLAENRKKLFKVVTRILDVAEFYYSSSLVKLNTLPLRSTLAIVTSWSIYREI
****KNYYWDFILIGAGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQTVLSSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKLSWINLKFQFGVGYPNTNQGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQNDISSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGINNFLFNNKTVEIITPTSIRINNKKIINANCIIDGRGLKNSQFDGIYQIFLGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLFDLSKNRMENYVNLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNYSKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNSLFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISIYVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSNSLFVIYFGLSEQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGCSTFYALIPVPNLSNSSINWSEESIKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDVLGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSSAIKLFDPVIRYKVLMLYAWCRYCDDVIDNQICGNRSKFLKKNVSMKHKLKILRIKTKRACIGFKMKEPAFLALQKIISIHSFPVHLLFEHLDGFEMDVMERTYITLDETLGYCYHVAGTIGLIIAHLIGVKEKDTLNCARNLGIAFQLTNISRDVIDDFYVGRCYLPLDWLRNEGLNKSNFVLAENRKKLFKVVTRILDVAEFYYSSSLVKLNTLPLRSTLAIVTSWSIY***
****KNYYWDFILIGAGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQTVLSSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTA*********RDKLSWINLKFQFGVGYPNTNQGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQNDISSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGINNFLFNNKTVEIITPTSIRINNKKIINANCIIDGRGLKNSQFDGIYQIFLGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYA*****FDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLFDLSKNRMENYVNLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNYSKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNSLFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISIYVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQ**************KMSNSLFVIYFGLSEQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGCSTFYALIPVPNLSNSSINWSEESIKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDVLGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSSAIKLFDPVIRYKVLMLYAWCRYCDDVIDNQIC****************LKILRIKTKRACIGFKMKEPAFLALQKIISIHSFPVHLLFEHLDGFEMDVMERTYITLDETLGYCYHVAGTIGLIIAHLIGVKEKDTLNCARNLGIAFQLTNISRDVIDDFYVGRCYLPLDWLRNEGLNKSNFVLAENRKKLFKVVTRILDVAEFYYSSSLVKLNTLPLRSTLAIVTSWSIYREI
MNFEKNYYWDFILIGAGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQTVLSSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKLSWINLKFQFGVGYPNTNQGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQNDISSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGINNFLFNNKTVEIITPTSIRINNKKIINANCIIDGRGLKNSQFDGIYQIFLGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLFDLSKNRMENYVNLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNYSKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNSLFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISIYVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSNSLFVIYFGLSEQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGCSTFYALIPVPNLSNSSINWSEESIKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDVLGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSSAIKLFDPVIRYKVLMLYAWCRYCDDVIDNQICGNRSKFLKKNVSMKHKLKILRIKTKRACIGFKMKEPAFLALQKIISIHSFPVHLLFEHLDGFEMDVMERTYITLDETLGYCYHVAGTIGLIIAHLIGVKEKDTLNCARNLGIAFQLTNISRDVIDDFYVGRCYLPLDWLRNEGLNKSNFVLAENRKKLFKVVTRILDVAEFYYSSSLVKLNTLPLRSTLAIVTSWSIYREI
*NFEKNYYWDFILIGAGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQTVLSSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKLSWINLKFQFGVGYPNTNQGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQNDISSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGINNFLFNNKTVEIITPTSIRINNKKIINANCIIDGRGLKNSQFDGIYQIFLGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLFDLSKNRMENYVNLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNYSKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNSLFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISIYVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSNSLFVIYFGLSEQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGCSTFYALIPVPNLSNSSINWSEESIKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDVLGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSSAIKLFDPVIRYKVLMLYAWCRYCDDVIDNQICGNRSKFLKKNVSMKHKLKILRIKTKRACIGFKMKEPAFLALQKIISIHSFPVHLLFEHLDGFEMDVMERTYITLDETLGYCYHVAGTIGLIIAHLIGVKEKDTLNCARNLGIAFQLTNISRDVIDDFYVGRCYLPLDWLRNEGLNKSNFVLAENRKKLFKVVTRILDVAEFYYSSSLVKLNTLPLRSTLAIVTSWSIYREI
iiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFEKNYYWDFILIGAGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQTVLSSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKLSWINLKFQFGVGYPNTNQGLWNSIIAWYLKQYNPKLNVLLLELSSSVKNHIWSFHQNDISSSQYMLIKPLITYSWPSYQVKFPKFNRKIFSGYYSICSKHLNSYLIRALGINNFLFNNKTVEIITPTSIRINNKKIINANCIIDGRGLKNSQFDGIYQIFLGQQWNLSSPHGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIEREEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSITTNQINSTVLFKLVKKFIINHQKKQRFFCMLNRLFFLSNSRCHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLFDLSKNRMENYVNLLPIKPFYRLYWGKEKxxxxxxxxxxxxxxxxxxxxxDIKGYRLFLNYSKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNSLFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISIYVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSNSLFVIYFGLSEQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGCSTFYALIPVPNLSNSSINWSEESIKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDVLGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSSAIKLFDPVIRYKVLMLYAWCRYCDDVIDNQICGNRSKFLKKNVSMKHKLKILRIKTKRACIGFKMKEPAFLALQKIISIHSFPVHLLFEHLDGFEMDVMERTYITLDETLGYCYHVAGTIGLIIAHLIGVKEKDTLNCARNLGIAFQLTNISRDVIDDFYVGRCYLPLDWLRNEGLNKSNFVLAENRKKLFKVVTRILDVAEFYYSSSLVKLNTLPLRSTLAIVTSWSIYREI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1428 2.2.26 [Sep-21-2011]
P22871492 Phytoene desaturase (lyco N/A N/A 0.331 0.961 0.575 1e-175
P21685492 Phytoene desaturase (lyco yes N/A 0.338 0.981 0.547 1e-167
P54978501 Phytoene desaturase (lyco N/A N/A 0.347 0.990 0.482 1e-144
P17054524 Phytoene desaturase (neur yes N/A 0.317 0.866 0.362 3e-88
P54980518 Phytoene desaturase (neur yes N/A 0.324 0.895 0.356 1e-84
Q01331386 Lycopene cyclase OS=Esche N/A N/A 0.242 0.898 0.427 1e-81
P21687382 Lycopene cyclase OS=Panto no N/A 0.242 0.908 0.403 2e-74
P21683309 Phytoene synthase OS=Pant no N/A 0.172 0.796 0.489 3e-65
P54979517 zeta-carotene-forming phy no N/A 0.310 0.858 0.285 1e-63
P22872309 Phytoene synthase OS=Esch N/A N/A 0.172 0.796 0.477 6e-63
>sp|P22871|CRTI_ESCVU Phytoene desaturase (lycopene-forming) OS=Escherichia vulneris GN=crtI PE=3 SV=1 Back     alignment and function desciption
 Score =  617 bits (1590), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 275/478 (57%), Positives = 367/478 (76%)

Query: 718  GAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLF 777
            GAG GG+ALAIRLQ AGI T++LEQRDKPGGRAYV+   GF FDAGPTVITDP +++ LF
Sbjct: 8    GAGFGGLALAIRLQAAGIPTVLLEQRDKPGGRAYVWHDQGFTFDAGPTVITDPTALEALF 67

Query: 778  DLSKNRMENYVNLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNY 837
             L+  RME+YV LLP+KPFYRL W   K L+Y ++  +LE QI +FN  D++GYR FL Y
Sbjct: 68   TLAGRRMEDYVRLLPVKPFYRLCWESGKTLDYANDSAELEAQITQFNPRDVEGYRRFLAY 127

Query: 838  SKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNS 897
            S+ VF+EGYL   S  FL+  DML   P+L+K++AW+SVY  VS+FI++++L+QAFSF+S
Sbjct: 128  SQAVFQEGYLRLGSVPFLSFRDMLRAGPQLLKLQAWQSVYQSVSRFIEDEHLRQAFSFHS 187

Query: 898  LFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISI 957
            L +GGNPF+TSSIYTLIHALE EWG+WFP+GG GAL+  ++KLF +LGG + LN++V  +
Sbjct: 188  LLVGGNPFTTSSIYTLIHALEREWGVWFPEGGTGALVNGMVKLFTDLGGEIELNARVEEL 247

Query: 958  YVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSNSLF 1017
             V +N+V++V L +G+IFD D + SNAD++NTY+ LLG +  G+K+   L +K MSNSLF
Sbjct: 248  VVADNRVSQVRLADGRIFDTDAVASNADVVNTYKKLLGHHPVGQKRAAALERKSMSNSLF 307

Query: 1018 VIYFGLSEQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGC 1077
            V+YFGL++ ++ LAHHTI F   Y++ I+ IF  +   D+ S+YLHSP VTD SLAP GC
Sbjct: 308  VLYFGLNQPHSQLAHHTICFGPRYRELIDEIFTGSALADDFSLYLHSPCVTDPSLAPPGC 367

Query: 1078 STFYALIPVPNLSNSSINWSEESIKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDV 1137
            ++FY L PVP+L N+ ++W++E  KL++ +F YLE+  +P LR +L+TQRIFTP DF D 
Sbjct: 368  ASFYVLAPVPHLGNAPLDWAQEGPKLRDRIFDYLEERYMPGLRSQLVTQRIFTPADFHDT 427

Query: 1138 LGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSS 1195
            L ++LGSAFS  PLLTQSAWFRPHNRD ++ NLY VGAGTHPGA    + A +K+ +S
Sbjct: 428  LDAHLGSAFSIEPLLTQSAWFRPHNRDSDIANLYLVGAGTHPGAGIPGVVASAKATAS 485




This enzyme converts phytoene into lycopene via the intermediaries of phytofluene, zeta-carotene and neurosporene by the introduction of four double bonds.
Escherichia vulneris (taxid: 566)
EC: 1EC: .EC: 1EC: 4EC: .EC: 9EC: 9EC: .EC: -
>sp|P21685|CRTI_PANAN Phytoene desaturase (lycopene-forming) OS=Pantoea ananas GN=crtI PE=1 SV=1 Back     alignment and function description
>sp|P54978|CRTI_PARSN Phytoene desaturase (lycopene-forming) OS=Paracoccus sp. (strain N81106 / MBIC 01143) GN=crtI PE=3 SV=2 Back     alignment and function description
>sp|P17054|CRTI_RHOCB Phytoene desaturase (neurosporene-forming) OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtI PE=1 SV=1 Back     alignment and function description
>sp|P54980|CRTI_RHOS4 Phytoene desaturase (neurosporene-forming) OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=crtI PE=3 SV=2 Back     alignment and function description
>sp|Q01331|CRTY_ESCVU Lycopene cyclase OS=Escherichia vulneris GN=crtY PE=4 SV=1 Back     alignment and function description
>sp|P21687|CRTY_PANAN Lycopene cyclase OS=Pantoea ananas GN=crtY PE=4 SV=1 Back     alignment and function description
>sp|P21683|CRTB_PANAN Phytoene synthase OS=Pantoea ananas GN=crtB PE=3 SV=2 Back     alignment and function description
>sp|P54979|CRTJ_MYXXA zeta-carotene-forming phytoene desaturase OS=Myxococcus xanthus GN=carA2 PE=1 SV=1 Back     alignment and function description
>sp|P22872|CRTB_ESCVU Phytoene synthase OS=Escherichia vulneris GN=crtB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1428
551855486 phytoene dehydrogenase [Pantoea agglomer 0.331 0.973 0.575 1e-173
117514492 RecName: Full=Phytoene desaturase (lycop 0.331 0.961 0.575 1e-173
377578871492 phytoene dehydrogenase [Escherichia herm 0.329 0.955 0.56 1e-167
254262299497 Phytoene dehydrogenase crtI [Enterobacte 0.334 0.961 0.560 1e-167
254262245497 Phytoene dehydrogenase crtI [Enterobacte 0.334 0.961 0.556 1e-166
72536062493 phytoene desaturase [Enterobacteriaceae 0.332 0.963 0.538 1e-165
378769593492 phytoene dehydrogenase CrtI [Pantoea ana 0.338 0.981 0.549 1e-165
117515492 RecName: Full=Phytoene desaturase (lycop 0.338 0.981 0.547 1e-165
386018482492 phytoene dehydrogenase CrtI [Pantoea ana 0.338 0.981 0.547 1e-165
390434747492 phytoene dehydrogenase [Pantoea agglomer 0.338 0.981 0.543 1e-165
>gi|551855|gb|AAA64981.1| phytoene dehydrogenase [Pantoea agglomerans] Back     alignment and taxonomy information
 Score =  617 bits (1590), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 275/478 (57%), Positives = 367/478 (76%)

Query: 718  GAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLF 777
            GAG GG+ALAIRLQ AGI T++LEQRDKPGGRAYV+   GF FDAGPTVITDP +++ LF
Sbjct: 8    GAGFGGLALAIRLQAAGIPTVLLEQRDKPGGRAYVWHDQGFTFDAGPTVITDPTALEALF 67

Query: 778  DLSKNRMENYVNLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNY 837
             L+  RME+YV LLP+KPFYRL W   K L+Y ++  +LE QI +FN  D++GYR FL Y
Sbjct: 68   TLAGRRMEDYVRLLPVKPFYRLCWESGKTLDYANDSAELEAQITQFNPRDVEGYRRFLAY 127

Query: 838  SKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNS 897
            S+ VF+EGYL   S  FL+  DML   P+L+K++AW+SVY  VS+FI++++L+QAFSF+S
Sbjct: 128  SQAVFQEGYLRLGSVPFLSFRDMLRAGPQLLKLQAWQSVYQSVSRFIEDEHLRQAFSFHS 187

Query: 898  LFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISI 957
            L +GGNPF+TSSIYTLIHALE EWG+WFP+GG GAL+  ++KLF +LGG + LN++V  +
Sbjct: 188  LLVGGNPFTTSSIYTLIHALEREWGVWFPEGGTGALVNGMVKLFTDLGGEIELNARVEEL 247

Query: 958  YVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSNSLF 1017
             V +N+V++V L +G+IFD D + SNAD++NTY+ LLG +  G+K+   L +K MSNSLF
Sbjct: 248  VVADNRVSQVRLADGRIFDTDAVASNADVVNTYKKLLGHHPVGQKRAAALERKSMSNSLF 307

Query: 1018 VIYFGLSEQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGC 1077
            V+YFGL++ ++ LAHHTI F   Y++ I+ IF  +   D+ S+YLHSP VTD SLAP GC
Sbjct: 308  VLYFGLNQPHSQLAHHTICFGPRYRELIDEIFTGSALADDFSLYLHSPCVTDPSLAPPGC 367

Query: 1078 STFYALIPVPNLSNSSINWSEESIKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDV 1137
            ++FY L PVP+L N+ ++W++E  KL++ +F YLE+  +P LR +L+TQRIFTP DF D 
Sbjct: 368  ASFYVLAPVPHLGNAPLDWAQEGPKLRDRIFDYLEERYMPGLRSQLVTQRIFTPADFHDT 427

Query: 1138 LGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSS 1195
            L ++LGSAFS  PLLTQSAWFRPHNRD ++ NLY VGAGTHPGA    + A +K+ +S
Sbjct: 428  LDAHLGSAFSIEPLLTQSAWFRPHNRDSDIANLYLVGAGTHPGAGIPGVVASAKATAS 485




Source: Pantoea agglomerans

Species: Pantoea agglomerans

Genus: Pantoea

Family: Enterobacteriaceae

Order: Enterobacteriales

Class: Gammaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi|117514|sp|P22871.1|CRTI_ESCVU RecName: Full=Phytoene desaturase (lycopene-forming); AltName: Full=4-step phytoene desaturase; AltName: Full=Phytoene dehydrogenase gi|148402|gb|AAA24820.1| phytoene dehydrogenase [Pantoea agglomerans] Back     alignment and taxonomy information
>gi|377578871|ref|ZP_09807845.1| phytoene dehydrogenase [Escherichia hermannii NBRC 105704] gi|377539732|dbj|GAB53010.1| phytoene dehydrogenase [Escherichia hermannii NBRC 105704] Back     alignment and taxonomy information
>gi|254262299|emb|CAZ90623.1| Phytoene dehydrogenase crtI [Enterobacter pulveris] Back     alignment and taxonomy information
>gi|254262245|emb|CAZ90572.1| Phytoene dehydrogenase crtI [Enterobacter helveticus] Back     alignment and taxonomy information
>gi|72536062|gb|AAZ73130.1| phytoene desaturase [Enterobacteriaceae bacterium DC260] Back     alignment and taxonomy information
>gi|378769593|ref|YP_005198070.1| phytoene dehydrogenase CrtI [Pantoea ananatis LMG 5342] gi|386076655|ref|YP_005990738.1| phytoene dehydrogenase CrtI [Pantoea ananatis PA13] gi|354685523|gb|AER34890.1| phytoene dehydrogenase CrtI [Pantoea ananatis PA13] gi|365189084|emb|CCF12033.1| phytoene dehydrogenase CrtI [Pantoea ananatis LMG 5342] Back     alignment and taxonomy information
>gi|117515|sp|P21685.1|CRTI_PANAN RecName: Full=Phytoene desaturase (lycopene-forming); AltName: Full=4-step phytoene desaturase; AltName: Full=Phytoene dehydrogenase gi|216685|dbj|BAA14127.1| crtI [Pantoea ananatis] gi|325559608|gb|ADZ30890.1| phytoene dehydrogenase [MoClo level 2 destination vector pL2-1] gi|325559619|gb|ADZ30898.1| phytoene dehydrogenase [MoClo end-linker vector pELR-1] Back     alignment and taxonomy information
>gi|386018482|ref|YP_005941088.1| phytoene dehydrogenase CrtI [Pantoea ananatis AJ13355] gi|327396569|dbj|BAK13990.1| phytoene dehydrogenase CrtI [Pantoea ananatis AJ13355] Back     alignment and taxonomy information
>gi|390434747|ref|ZP_10223285.1| phytoene dehydrogenase [Pantoea agglomerans IG1] gi|429485115|gb|AFZ89042.1| CrtI [Pantoea agglomerans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1428
UNIPROTKB|P21685492 crtI "Phytoene desaturase (lyc 0.330 0.959 0.520 2.4e-138
UNIPROTKB|P17054524 crtI "Phytoene desaturase (neu 0.321 0.875 0.343 1.4e-70
UNIPROTKB|P54979517 carA2 "zeta-carotene-forming p 0.313 0.864 0.274 6.1e-51
UNIPROTKB|Q02861529 carC "All-trans-zeta-carotene 0.313 0.844 0.252 1.7e-42
UNIPROTKB|Q67GI0582 carB "Phytoene dehydrogenase" 0.324 0.795 0.232 2.1e-39
UNIPROTKB|Q8X0Z0570 carB "Phytoene dehydrogenase" 0.25 0.626 0.283 4.8e-38
UNIPROTKB|Q6ED64421 Q6ED64 "Phytoene synthase 1" [ 0.164 0.558 0.270 1e-12
TAIR|locus:2167225437 PSY "PHYTOENE SYNTHASE" [Arabi 0.149 0.487 0.278 1.1e-11
UNIPROTKB|P37295602 al-2 "Bifunctional lycopene cy 0.077 0.182 0.322 2.5e-11
UNIPROTKB|Q67GH9608 carRA "Bifunctional lycopene c 0.129 0.304 0.287 5.8e-10
UNIPROTKB|P21685 crtI "Phytoene desaturase (lycopene-forming)" [Pantoea ananatis (taxid:553)] Back     alignment and assigned GO terms
 Score = 1314 (467.6 bits), Expect = 2.4e-138, Sum P(2) = 2.4e-138
 Identities = 246/473 (52%), Positives = 330/473 (69%)

Query:   729 RLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLFDLSKNRMENYV 788
             RLQ AGI  ++LEQRDKPGGRAYVY+  GF FDAGPTVITDP++I+ LF L+  +++ YV
Sbjct:    19 RLQAAGIPVLLLEQRDKPGGRAYVYEDQGFTFDAGPTVITDPSAIEELFALAGKQLKEYV 78

Query:   789 NLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNYSKKVFKEGYLS 848
              LLP+ PFYRL W   K  NY+++   LE QI +FN  D++GYR FL+YS+ VFKEGYL 
Sbjct:    79 ELLPVTPFYRLCWESGKVFNYDNDQTRLEAQIQQFNPRDVEGYRQFLDYSRAVFKEGYLK 138

Query:   849 FASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNSLFIGGNPFSTS 908
               +  FL+  DML   P+L K++AW+SVYS V+ +I++++L+QAFSF+SL +GGNPF+TS
Sbjct:   139 LGTVPFLSFRDMLRAAPQLAKLQAWRSVYSKVASYIEDEHLRQAFSFHSLLVGGNPFATS 198

Query:   909 SIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISIYXXXXXXXXXX 968
             SIYTLIHALE EWG+WFP+GG GAL++ +IKLFQ+LGG ++LN++V  +           
Sbjct:   199 SIYTLIHALEREWGVWFPRGGTGALVQGMIKLFQDLGGEVVLNARVSHMETTGNKIEAVH 258

Query:   969 XXXGQIFDADIIVSNADIINTYRNLLGQYAFGXXXXXXXXXXXMSNSLFVIYFGLSEQYT 1028
                G+ F    + SNAD+++TYR+LL Q+              MSNSLFV+YFGL+  + 
Sbjct:   259 LEDGRRFLTQAVASNADVVHTYRDLLSQHPAAVKQSNKLQTKRMSNSLFVLYFGLNHHHD 318

Query:  1029 HLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGCSTFYALIPVPN 1088
              LAHHT+ F   Y++ I+ IF  +   ++ S+YLH+P VTD SLAP GC ++Y L PVP+
Sbjct:   319 QLAHHTVCFGPRYRELIDEIFNHDGLAEDFSLYLHAPCVTDSSLAPEGCGSYYVLAPVPH 378

Query:  1089 LXXXXXXXXXXXXKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDVLGSYLGSAFSF 1148
             L            KL++ +F YLEQ+ +P LR +L+T R+FTP DF+D L +Y GSAFS 
Sbjct:   379 LGTANLDWTVEGPKLRDRIFAYLEQHYMPGLRSQLVTHRMFTPFDFRDQLNAYHGSAFSV 438

Query:  1149 APLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSSAIKLFD 1201
              P+LTQSAWFRPHNRDK +TNLY VGAGTHPGA    +  GS   ++ + L D
Sbjct:   439 EPVLTQSAWFRPHNRDKTITNLYLVGAGTHPGAGIPGV-IGSAKATAGLMLED 490


GO:0016120 "carotene biosynthetic process" evidence=IDA
GO:0016627 "oxidoreductase activity, acting on the CH-CH group of donors" evidence=IDA
GO:0071949 "FAD binding" evidence=IDA
UNIPROTKB|P17054 crtI "Phytoene desaturase (neurosporene-forming)" [Rhodobacter capsulatus SB 1003 (taxid:272942)] Back     alignment and assigned GO terms
UNIPROTKB|P54979 carA2 "zeta-carotene-forming phytoene desaturase" [Myxococcus xanthus (taxid:34)] Back     alignment and assigned GO terms
UNIPROTKB|Q02861 carC "All-trans-zeta-carotene desaturase" [Myxococcus xanthus (taxid:34)] Back     alignment and assigned GO terms
UNIPROTKB|Q67GI0 carB "Phytoene dehydrogenase" [Blakeslea trispora (taxid:4850)] Back     alignment and assigned GO terms
UNIPROTKB|Q8X0Z0 carB "Phytoene dehydrogenase" [Fusarium fujikuroi (taxid:5127)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ED64 Q6ED64 "Phytoene synthase 1" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
TAIR|locus:2167225 PSY "PHYTOENE SYNTHASE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P37295 al-2 "Bifunctional lycopene cyclase/phytoene synthase" [Neurospora crassa OR74A (taxid:367110)] Back     alignment and assigned GO terms
UNIPROTKB|Q67GH9 carRA "Bifunctional lycopene cyclase/phytoene synthase" [Blakeslea trispora (taxid:4850)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P21685CRTI_PANAN1, ., 1, 4, ., 9, 9, ., -0.54750.33820.9817yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.5.1.320.737
3rd Layer2.5.10.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1428
TIGR02734502 TIGR02734, crtI_fam, phytoene desaturase 0.0
TIGR01789370 TIGR01789, lycopene_cycl, lycopene cyclase 2e-91
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 3e-90
pfam05834374 pfam05834, Lycopene_cycl, Lycopene cyclase protein 2e-78
TIGR01789370 TIGR01789, lycopene_cycl, lycopene cyclase 2e-76
cd00683265 cd00683, Trans_IPPS_HH, Trans-Isoprenyl Diphosphat 3e-61
TIGR01790388 TIGR01790, carotene-cycl, lycopene cyclase family 2e-60
pfam00494262 pfam00494, SQS_PSY, Squalene/phytoene synthase 7e-55
pfam05834374 pfam05834, Lycopene_cycl, Lycopene cyclase protein 1e-50
TIGR01790388 TIGR01790, carotene-cycl, lycopene cyclase family 1e-40
TIGR03465266 TIGR03465, HpnD, squalene synthase HpnD 2e-33
COG1562288 COG1562, ERG9, Phytoene/squalene synthetase [Lipid 6e-32
pfam01593444 pfam01593, Amino_oxidase, Flavin containing amine 3e-25
PLN02632334 PLN02632, PLN02632, phytoene synthase 2e-22
TIGR02730493 TIGR02730, carot_isom, carotene isomerase 3e-22
cd00867236 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate S 5e-22
cd00385243 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynth 1e-18
TIGR03464266 TIGR03464, HpnC, squalene synthase HpnC 2e-18
pfam05834374 pfam05834, Lycopene_cycl, Lycopene cyclase protein 5e-15
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 5e-11
TIGR01790388 TIGR01790, carotene-cycl, lycopene cyclase family 1e-09
TIGR02734502 TIGR02734, crtI_fam, phytoene desaturase 6e-07
PRK11883451 PRK11883, PRK11883, protoporphyrinogen oxidase; Re 1e-05
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 1e-05
PLN02697529 PLN02697, PLN02697, lycopene epsilon cyclase 3e-05
PLN02697529 PLN02697, PLN02697, lycopene epsilon cyclase 3e-05
TIGR02733492 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD 4e-05
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 7e-05
PLN02268435 PLN02268, PLN02268, probable polyamine oxidase 7e-05
TIGR00562462 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase 7e-05
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 2e-04
PLN02529738 PLN02529, PLN02529, lysine-specific histone demeth 3e-04
PLN02576496 PLN02576, PLN02576, protoporphyrinogen oxidase 4e-04
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 6e-04
PLN02463447 PLN02463, PLN02463, lycopene beta cyclase 6e-04
PLN02463447 PLN02463, PLN02463, lycopene beta cyclase 6e-04
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General 0.001
TIGR01559337 TIGR01559, squal_synth, farnesyl-diphosphate farne 0.001
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 0.003
>gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase Back     alignment and domain information
 Score =  622 bits (1606), Expect = 0.0
 Identities = 235/468 (50%), Positives = 321/468 (68%), Gaps = 4/468 (0%)

Query: 718  GAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLF 777
            GAG GG+ALAIRL  AGI   ++EQRDKPGGRA V + DGF FD GPTVIT P +++ LF
Sbjct: 5    GAGFGGLALAIRLAAAGIPVTVVEQRDKPGGRAGVLEDDGFRFDTGPTVITMPEALEELF 64

Query: 778  DLSKNRMENYVNLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNY 837
             L+   + +YV L+P+ PFYRL W     L+ +++ ++LE QIA+FN  D+ GYR FL+Y
Sbjct: 65   ALAGRDLADYVELVPLDPFYRLCWEDGSQLDVDNDQEELEAQIARFNPGDVAGYRRFLDY 124

Query: 838  SKKVFKEGYLSFASKSFLTINDML-FILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFN 896
            +++V++EGY       FL+  D+L   LP+L+ + AW+S+YS V++F  ++ L+QAFSF+
Sbjct: 125  AERVYREGYRKLGYVPFLSPRDLLRADLPQLLALLAWRSLYSKVARFFSDERLRQAFSFH 184

Query: 897  SLFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVIS 956
            +LF+GGNPF T SIY LI ALE EWG+WFP+GG GAL+ A+ KL ++LGG L LN++VI 
Sbjct: 185  ALFLGGNPFRTPSIYALISALEREWGVWFPRGGTGALVAAMAKLAEDLGGELRLNAEVIR 244

Query: 957  IYVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSNSL 1016
            I     +   VHL +G+  DAD +VSNAD+ +TYR LL  +   +     L +K+ S SL
Sbjct: 245  IETEGGRATAVHLADGERLDADAVVSNADLHHTYRRLLPNHPRRRYPAARLSRKRPSPSL 304

Query: 1017 FVIYFGLS---EQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLA 1073
            FV+YFGL      +  LAHHT+ F   YK+  + IF K    ++ S+YLH P+VTD SLA
Sbjct: 305  FVLYFGLLGVDGHWPQLAHHTLCFGPRYKELFDEIFRKGRLAEDPSLYLHRPTVTDPSLA 364

Query: 1074 PTGCSTFYALIPVPNLSNSSINWSEESIKLKNIVFMYLEQYCIPNLRKKLITQRIFTPND 1133
            P GC   Y L PVP+L  + ++WS E  + ++ +  YLE+  IP LR +++ +R FTP D
Sbjct: 365  PPGCENLYVLAPVPHLGTADVDWSVEGPRYRDRILAYLEERAIPGLRDRIVVERTFTPAD 424

Query: 1134 FKDVLGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGA 1181
            F+D   ++LGSAFS    LTQSAWFRPHNRD+ + NLY VGAGTHPGA
Sbjct: 425  FRDRYNAWLGSAFSLEHTLTQSAWFRPHNRDRKIDNLYLVGAGTHPGA 472


Phytoene is converted to lycopene by desaturation at four (two symmetrical pairs of) sites. This is achieved by two enzymes (crtP and crtQ) in cyanobacteria (Gloeobacter being an exception) and plants, but by a single enzyme in most other bacteria and in fungi. This single enzyme is called the bacterial-type phytoene desaturase, or CrtI. Most members of this family, part of the larger Pfam family pfam01593, which also contains amino oxidases, are CrtI itself; it is likely that all members act on either phytoene or on related compounds such as dehydrosqualene, for carotenoid biosynthesis [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]. Length = 502

>gnl|CDD|130849 TIGR01789, lycopene_cycl, lycopene cyclase Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|218770 pfam05834, Lycopene_cycl, Lycopene cyclase protein Back     alignment and domain information
>gnl|CDD|130849 TIGR01789, lycopene_cycl, lycopene cyclase Back     alignment and domain information
>gnl|CDD|173831 cd00683, Trans_IPPS_HH, Trans-Isoprenyl Diphosphate Synthases, head-to-head Back     alignment and domain information
>gnl|CDD|130850 TIGR01790, carotene-cycl, lycopene cyclase family protein Back     alignment and domain information
>gnl|CDD|215948 pfam00494, SQS_PSY, Squalene/phytoene synthase Back     alignment and domain information
>gnl|CDD|218770 pfam05834, Lycopene_cycl, Lycopene cyclase protein Back     alignment and domain information
>gnl|CDD|130850 TIGR01790, carotene-cycl, lycopene cyclase family protein Back     alignment and domain information
>gnl|CDD|163278 TIGR03465, HpnD, squalene synthase HpnD Back     alignment and domain information
>gnl|CDD|224478 COG1562, ERG9, Phytoene/squalene synthetase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase Back     alignment and domain information
>gnl|CDD|215339 PLN02632, PLN02632, phytoene synthase Back     alignment and domain information
>gnl|CDD|131777 TIGR02730, carot_isom, carotene isomerase Back     alignment and domain information
>gnl|CDD|173836 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>gnl|CDD|173830 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>gnl|CDD|188327 TIGR03464, HpnC, squalene synthase HpnC Back     alignment and domain information
>gnl|CDD|218770 pfam05834, Lycopene_cycl, Lycopene cyclase protein Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|130850 TIGR01790, carotene-cycl, lycopene cyclase family protein Back     alignment and domain information
>gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase Back     alignment and domain information
>gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|215375 PLN02697, PLN02697, lycopene epsilon cyclase Back     alignment and domain information
>gnl|CDD|215375 PLN02697, PLN02697, lycopene epsilon cyclase Back     alignment and domain information
>gnl|CDD|233987 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase Back     alignment and domain information
>gnl|CDD|213540 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 Back     alignment and domain information
>gnl|CDD|215314 PLN02576, PLN02576, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|178082 PLN02463, PLN02463, lycopene beta cyclase Back     alignment and domain information
>gnl|CDD|178082 PLN02463, PLN02463, lycopene beta cyclase Back     alignment and domain information
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|188157 TIGR01559, squal_synth, farnesyl-diphosphate farnesyltransferase Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1428
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 100.0
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 100.0
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 100.0
TIGR02730493 carot_isom carotene isomerase. Members of this fam 100.0
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 100.0
COG1233487 Phytoene dehydrogenase and related proteins [Secon 100.0
TIGR03464266 HpnC squalene synthase HpnC. This family of genes 100.0
cd00683265 Trans_IPPS_HH Trans-Isoprenyl Diphosphate Synthase 100.0
PLN02632334 phytoene synthase 100.0
TIGR03465266 HpnD squalene synthase HpnD. The genes of this fam 100.0
PLN02697529 lycopene epsilon cyclase 100.0
PLN02463447 lycopene beta cyclase 100.0
COG1562288 ERG9 Phytoene/squalene synthetase [Lipid metabolis 100.0
PF00494267 SQS_PSY: Squalene/phytoene synthase; InterPro: IPR 100.0
TIGR01559336 squal_synth farnesyl-diphosphate farnesyltransfera 100.0
KOG4254|consensus561 100.0
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 100.0
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 100.0
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 100.0
PLN02697529 lycopene epsilon cyclase 99.97
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.97
PRK07233434 hypothetical protein; Provisional 99.97
PLN02612567 phytoene desaturase 99.97
PLN02463447 lycopene beta cyclase 99.97
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 99.96
PLN02487569 zeta-carotene desaturase 99.96
PRK11883451 protoporphyrinogen oxidase; Reviewed 99.96
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.96
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 99.96
PRK12416463 protoporphyrinogen oxidase; Provisional 99.96
PLN02576496 protoporphyrinogen oxidase 99.96
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.95
PRK07208479 hypothetical protein; Provisional 99.95
PLN02268435 probable polyamine oxidase 99.95
PLN02568539 polyamine oxidase 99.94
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.94
PLN02529738 lysine-specific histone demethylase 1 99.93
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.93
PLN02676487 polyamine oxidase 99.93
KOG0685|consensus498 99.93
PLN02328808 lysine-specific histone demethylase 1 homolog 99.93
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.93
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.92
KOG4411|consensus292 99.92
PRK08013400 oxidoreductase; Provisional 99.92
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.92
PLN03000881 amine oxidase 99.92
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 99.92
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 99.91
KOG0029|consensus501 99.91
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.91
COG1231450 Monoamine oxidase [Amino acid transport and metabo 99.91
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.91
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.9
PLN02976 1713 amine oxidase 99.9
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.9
PRK06996398 hypothetical protein; Provisional 99.9
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.89
PRK06185407 hypothetical protein; Provisional 99.89
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.89
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.86
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.86
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.86
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.86
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.86
PRK09126392 hypothetical protein; Provisional 99.86
KOG1276|consensus491 99.84
KOG3855|consensus481 99.84
KOG1459|consensus 413 99.84
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.83
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.82
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 99.82
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 99.82
PRK07045388 putative monooxygenase; Reviewed 99.81
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.81
PRK08244493 hypothetical protein; Provisional 99.81
PRK10015429 oxidoreductase; Provisional 99.81
PRK07588391 hypothetical protein; Provisional 99.8
PRK06834488 hypothetical protein; Provisional 99.8
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.8
PRK11445351 putative oxidoreductase; Provisional 99.78
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 99.77
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.77
PLN02985514 squalene monooxygenase 99.77
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 99.77
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 99.77
PRK07190487 hypothetical protein; Provisional 99.77
PTZ00367567 squalene epoxidase; Provisional 99.77
PRK06475400 salicylate hydroxylase; Provisional 99.76
COG3349485 Uncharacterized conserved protein [Function unknow 99.76
PRK06753373 hypothetical protein; Provisional 99.76
PRK05868372 hypothetical protein; Validated 99.75
PRK10157428 putative oxidoreductase FixC; Provisional 99.75
PRK06184502 hypothetical protein; Provisional 99.75
PRK07538413 hypothetical protein; Provisional 99.72
PRK08294634 phenol 2-monooxygenase; Provisional 99.71
COG2907447 Predicted NAD/FAD-binding protein [General functio 99.7
PRK08132547 FAD-dependent oxidoreductase; Provisional 99.7
cd00867236 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases. 99.7
PRK08163396 salicylate hydroxylase; Provisional 99.69
PRK06126545 hypothetical protein; Provisional 99.67
PRK06847375 hypothetical protein; Provisional 99.66
PRK13977576 myosin-cross-reactive antigen; Provisional 99.65
PRK07236386 hypothetical protein; Provisional 99.64
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 99.55
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 99.55
cd00385243 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzym 99.53
KOG2614|consensus420 99.48
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 99.45
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 99.37
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.36
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 99.34
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 99.3
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 99.3
COG2081408 Predicted flavoproteins [General function predicti 99.29
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.26
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.21
PRK11445351 putative oxidoreductase; Provisional 99.19
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.13
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.12
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.12
COG0579429 Predicted dehydrogenase [General function predicti 99.08
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.05
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.05
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.03
KOG1459|consensus413 99.02
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.01
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.98
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 98.97
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.97
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.97
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.97
PRK06847375 hypothetical protein; Provisional 98.97
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.96
PRK07190487 hypothetical protein; Provisional 98.96
PRK07045388 putative monooxygenase; Reviewed 98.95
KOG1298|consensus509 98.94
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.92
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.92
PRK11728393 hydroxyglutarate oxidase; Provisional 98.91
KOG2820|consensus399 98.91
PRK06184502 hypothetical protein; Provisional 98.89
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.89
PRK06185407 hypothetical protein; Provisional 98.88
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.88
PRK09126392 hypothetical protein; Provisional 98.88
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.88
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.87
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.87
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.86
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.86
PRK05868372 hypothetical protein; Validated 98.83
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.82
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.82
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.8
PRK08244493 hypothetical protein; Provisional 98.78
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.76
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 98.76
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.76
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.75
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.72
PRK08274466 tricarballylate dehydrogenase; Validated 98.71
PRK05257494 malate:quinone oxidoreductase; Validated 98.7
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.68
PLN02661357 Putative thiazole synthesis 98.68
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.67
PRK10157428 putative oxidoreductase FixC; Provisional 98.67
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.67
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.65
KOG1439|consensus440 98.64
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.64
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.62
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.62
PRK08294634 phenol 2-monooxygenase; Provisional 98.62
PRK07236386 hypothetical protein; Provisional 98.61
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.6
PRK10015429 oxidoreductase; Provisional 98.59
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.58
PRK08013400 oxidoreductase; Provisional 98.58
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.57
PRK12842574 putative succinate dehydrogenase; Reviewed 98.55
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.54
PRK07538413 hypothetical protein; Provisional 98.54
PRK07121492 hypothetical protein; Validated 98.53
KOG2844|consensus 856 98.53
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.53
PLN02464627 glycerol-3-phosphate dehydrogenase 98.52
PF08491276 SE: Squalene epoxidase; InterPro: IPR013698 This d 98.52
PRK08163396 salicylate hydroxylase; Provisional 98.51
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.49
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.49
PRK06834488 hypothetical protein; Provisional 98.48
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.47
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.47
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.46
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.45
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.45
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.44
PRK06753373 hypothetical protein; Provisional 98.44
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.43
PRK07588391 hypothetical protein; Provisional 98.42
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.42
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 98.41
PTZ00367567 squalene epoxidase; Provisional 98.41
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.4
PRK06175433 L-aspartate oxidase; Provisional 98.4
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 98.39
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.38
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 98.36
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.36
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.35
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.35
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.35
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.35
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 98.35
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.34
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 98.33
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 98.33
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 98.33
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.33
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.32
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 98.32
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 98.31
PRK08275554 putative oxidoreductase; Provisional 98.3
PRK08401466 L-aspartate oxidase; Provisional 98.3
PRK06475400 salicylate hydroxylase; Provisional 98.3
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.29
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.29
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.29
KOG2853|consensus509 98.29
PRK07804541 L-aspartate oxidase; Provisional 98.28
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.28
PRK06126545 hypothetical protein; Provisional 98.28
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.27
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 98.27
PRK07395553 L-aspartate oxidase; Provisional 98.27
PLN02985514 squalene monooxygenase 98.26
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.25
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.25
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.25
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.25
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.23
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 98.23
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.23
PRK12839572 hypothetical protein; Provisional 98.22
PRK06116450 glutathione reductase; Validated 98.22
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 98.21
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.2
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.19
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 98.18
PRK08626657 fumarate reductase flavoprotein subunit; Provision 98.18
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.16
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.16
PTZ003061167 NADH-dependent fumarate reductase; Provisional 98.15
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.14
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.14
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 98.14
PRK09897534 hypothetical protein; Provisional 98.12
PRK08071510 L-aspartate oxidase; Provisional 98.11
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.11
PRK07512513 L-aspartate oxidase; Provisional 98.11
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.08
PRK06996398 hypothetical protein; Provisional 98.05
PLN02815594 L-aspartate oxidase 98.01
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.0
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.99
PLN02507499 glutathione reductase 97.98
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 97.98
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.96
KOG1298|consensus509 97.96
COG3573552 Predicted oxidoreductase [General function predict 97.95
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.94
PRK10262321 thioredoxin reductase; Provisional 97.91
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.91
KOG2404|consensus477 97.9
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 97.9
PRK09077536 L-aspartate oxidase; Provisional 97.9
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 97.9
COG2081408 Predicted flavoproteins [General function predicti 97.89
KOG2415|consensus621 97.86
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.83
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.81
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.81
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 97.76
KOG2852|consensus380 97.75
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 97.71
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.69
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.67
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.66
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.66
KOG2415|consensus621 97.66
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.65
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 97.63
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.63
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.6
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.59
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.58
PRK12779944 putative bifunctional glutamate synthase subunit b 97.57
KOG1399|consensus448 97.55
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 97.55
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 97.54
PRK06370463 mercuric reductase; Validated 97.51
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.5
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.49
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 97.48
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.47
PRK12831464 putative oxidoreductase; Provisional 97.45
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.43
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.43
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.42
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.41
PRK098531019 putative selenate reductase subunit YgfK; Provisio 97.41
PRK11259376 solA N-methyltryptophan oxidase; Provisional 97.4
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 97.4
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.4
COG2303542 BetA Choline dehydrogenase and related flavoprotei 97.4
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.39
PLN02852491 ferredoxin-NADP+ reductase 97.38
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.37
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.36
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.35
PRK13512438 coenzyme A disulfide reductase; Provisional 97.35
KOG2665|consensus453 97.34
COG4716587 Myosin-crossreactive antigen [Function unknown] 97.33
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.3
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.3
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.29
PRK14694468 putative mercuric reductase; Provisional 97.29
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.28
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.28
KOG2614|consensus420 97.26
TIGR02053463 MerA mercuric reductase. This model represents the 97.26
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.25
PRK13748561 putative mercuric reductase; Provisional 97.25
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.24
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.24
PTZ00058561 glutathione reductase; Provisional 97.24
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 97.23
PRK14727479 putative mercuric reductase; Provisional 97.23
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.22
PTZ00188506 adrenodoxin reductase; Provisional 97.21
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 97.2
PTZ00052499 thioredoxin reductase; Provisional 97.16
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.14
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.13
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.11
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.11
PRK065671028 putative bifunctional glutamate synthase subunit b 97.09
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.08
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.07
KOG0399|consensus2142 97.07
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.06
PRK12814652 putative NADPH-dependent glutamate synthase small 97.05
PLN02785587 Protein HOTHEAD 97.04
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.04
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.02
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.01
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.01
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.99
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 96.98
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.96
PLN02464627 glycerol-3-phosphate dehydrogenase 96.95
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 96.95
PLN02546558 glutathione reductase 96.95
PLN02661357 Putative thiazole synthesis 96.87
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 96.81
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 96.8
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 96.79
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.79
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 96.77
PTZ00153659 lipoamide dehydrogenase; Provisional 96.76
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.75
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.75
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 96.68
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 96.64
KOG4405|consensus547 96.63
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.62
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 96.61
KOG0042|consensus680 96.6
KOG2960|consensus328 96.6
KOG1335|consensus506 96.59
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 96.58
TIGR00275400 flavoprotein, HI0933 family. The model when search 96.54
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 96.54
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 96.54
PRK11728393 hydroxyglutarate oxidase; Provisional 96.54
KOG2960|consensus328 96.53
PRK07845466 flavoprotein disulfide reductase; Reviewed 96.51
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.51
PRK11883451 protoporphyrinogen oxidase; Reviewed 96.49
PTZ00383497 malate:quinone oxidoreductase; Provisional 96.48
KOG1238|consensus623 96.47
PRK02106560 choline dehydrogenase; Validated 96.47
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 96.46
KOG0029|consensus501 96.44
COG3573552 Predicted oxidoreductase [General function predict 96.38
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 96.38
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 96.37
PRK13984604 putative oxidoreductase; Provisional 96.36
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.35
PRK05257494 malate:quinone oxidoreductase; Validated 96.35
PLN02576496 protoporphyrinogen oxidase 96.34
PRK07208479 hypothetical protein; Provisional 96.34
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 96.33
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 96.31
PRK02106560 choline dehydrogenase; Validated 96.3
PRK06116450 glutathione reductase; Validated 96.3
PRK13339497 malate:quinone oxidoreductase; Reviewed 96.29
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 96.26
COG2303542 BetA Choline dehydrogenase and related flavoprotei 96.24
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 96.2
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 96.2
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 96.16
PRK07233434 hypothetical protein; Provisional 96.14
PRK12416463 protoporphyrinogen oxidase; Provisional 96.11
PLN02172461 flavin-containing monooxygenase FMO GS-OX 96.11
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 96.07
COG0579429 Predicted dehydrogenase [General function predicti 96.05
PRK07845466 flavoprotein disulfide reductase; Reviewed 96.03
COG1233487 Phytoene dehydrogenase and related proteins [Secon 96.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 95.99
KOG1238|consensus623 95.99
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 95.97
PLN02268435 probable polyamine oxidase 95.97
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 95.97
PRK06370463 mercuric reductase; Validated 95.96
PRK05976472 dihydrolipoamide dehydrogenase; Validated 95.93
PRK08274466 tricarballylate dehydrogenase; Validated 95.9
PRK08275554 putative oxidoreductase; Provisional 95.89
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 95.89
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 95.89
KOG1800|consensus468 95.84
PRK09077536 L-aspartate oxidase; Provisional 95.82
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 95.79
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 95.76
PRK07846451 mycothione reductase; Reviewed 95.76
PRK12839572 hypothetical protein; Provisional 95.74
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 95.73
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 95.73
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 95.72
KOG2820|consensus399 95.71
PTZ00052499 thioredoxin reductase; Provisional 95.68
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 95.63
PRK09231582 fumarate reductase flavoprotein subunit; Validated 95.61
PRK06292460 dihydrolipoamide dehydrogenase; Validated 95.6
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 95.6
PLN02568539 polyamine oxidase 95.59
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 95.58
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 95.58
PRK06327475 dihydrolipoamide dehydrogenase; Validated 95.58
TIGR02730493 carot_isom carotene isomerase. Members of this fam 95.57
KOG1276|consensus491 95.56
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 95.56
PLN02507499 glutathione reductase 95.54
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 95.52
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 95.5
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 95.5
PRK14694468 putative mercuric reductase; Provisional 95.48
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 95.39
PRK07846451 mycothione reductase; Reviewed 95.37
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 95.36
PRK06481506 fumarate reductase flavoprotein subunit; Validated 95.36
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 95.36
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 95.35
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 95.35
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 95.34
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 95.33
PRK13748561 putative mercuric reductase; Provisional 95.33
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 95.27
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 95.27
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 95.24
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 95.23
PRK07121492 hypothetical protein; Validated 95.21
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 95.19
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 95.18
PLN02785587 Protein HOTHEAD 95.16
PRK06175433 L-aspartate oxidase; Provisional 95.15
PRK09897534 hypothetical protein; Provisional 95.14
PRK14727479 putative mercuric reductase; Provisional 95.14
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 95.13
TIGR02053463 MerA mercuric reductase. This model represents the 95.13
PTZ00058561 glutathione reductase; Provisional 95.06
COG1231450 Monoamine oxidase [Amino acid transport and metabo 95.04
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 95.03
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 94.95
PRK12842574 putative succinate dehydrogenase; Reviewed 94.93
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 94.92
PLN02676487 polyamine oxidase 94.89
PRK13977576 myosin-cross-reactive antigen; Provisional 94.87
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 94.74
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 94.71
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 94.67
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 94.66
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.65
PRK10262321 thioredoxin reductase; Provisional 94.63
PRK07804541 L-aspartate oxidase; Provisional 94.57
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 94.56
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 94.52
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 94.52
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
Probab=100.00  E-value=1.5e-56  Score=534.07  Aligned_cols=309  Identities=23%  Similarity=0.366  Sum_probs=266.0

Q ss_pred             cEEEECccHHHHHHHHHHhccCCCCeEEEEccCCCC---CCceeEEeccccCccccccccccccCccCccEEEcCCCccc
Q psy10545         10 DFILIGAGLWNSIIAWYLKQYNPKLNVLLLELSSSV---KNHIWSFHQTVLSSSQYMLIKPLITYSWPSYQVKFPKFNRK   86 (1428)
Q Consensus        10 d~~i~G~G~ag~~~a~~~~~~~~~~~v~~~~~~~~~---~~~tw~~w~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~   86 (1428)
                      ||||||||||||++|++|.+..++++|+|||++++.   +++|||||.+++     ..+++++.++|+++.|++++.++.
T Consensus         1 DviIvGaGpAGlslA~~l~~~~~g~~Vllid~~~~~~~~~~~tW~~~~~~~-----~~~~~~v~~~w~~~~v~~~~~~~~   75 (374)
T PF05834_consen    1 DVIIVGAGPAGLSLARRLADARPGLSVLLIDPKPKPPWPNDRTWCFWEKDL-----GPLDSLVSHRWSGWRVYFPDGSRI   75 (374)
T ss_pred             CEEEECCcHHHHHHHHHHHhcCCCCEEEEEcCCccccccCCcccccccccc-----cchHHHHheecCceEEEeCCCceE
Confidence            899999999999999999776788999999998765   689999999854     337899999999999999987765


Q ss_pred             c-CccccceehhHHHHHHHHHc----------------------------C-----------------------------
Q psy10545         87 I-FSGYYSICSKHLNSYLIRAL----------------------------G-----------------------------  108 (1428)
Q Consensus        87 ~-~~~Y~~~~~~~~~~~~~~~~----------------------------~-----------------------------  108 (1428)
                      + .|+|++|++.+|+++|.+..                            |                             
T Consensus        76 ~~~~~Y~~i~~~~f~~~l~~~~~~~~~~~~~~~V~~i~~~~~~~~v~~~~g~~i~a~~VvDa~g~~~~~~~~~~~Q~f~G  155 (374)
T PF05834_consen   76 LIDYPYCMIDRADFYEFLLERAAAGGVIRLNARVTSIEETGDGVLVVLADGRTIRARVVVDARGPSSPKARPLGLQHFYG  155 (374)
T ss_pred             EcccceEEEEHHHHHHHHHHHhhhCCeEEEccEEEEEEecCceEEEEECCCCEEEeeEEEECCCcccccccccccceeEE
Confidence            4 67999999999999998720                            0                             


Q ss_pred             CEEEEecC-CCCCceEeeecccCCCCCCceEEEEccCCCCcEEEEEeeecCCCCCCHHHHHHHHHHHHHHcCCcceeEEE
Q psy10545        109 QQWNLSSP-HGLDIPIIMDATVNQKNDEYHFIYTLPLTPNSLMIEDTRYTKKPFLKIDMLKKSIKDYAIKNRWKLKNIER  187 (1428)
Q Consensus       109 ~~~~~~~~-~g~~~~~~MD~r~~~~~~~~~F~Y~lP~~~~~~liE~T~~~~~~~~~~~~~~~~l~~~l~~~g~~~~~i~~  187 (1428)
                      .+++++.| |+.++++|||||++|..++++|+|+||+|++++|||+|+|++++.++.+.|+++|++||+++|++.++|++
T Consensus       156 ~~v~~~~~~f~~~~~~lMD~r~~~~~~~~~F~Y~lP~~~~~alvE~T~fs~~~~~~~~~~~~~l~~~l~~~g~~~~~i~~  235 (374)
T PF05834_consen  156 WEVETDEPVFDPDTATLMDFRVPQSADGPSFLYVLPFSEDRALVEETSFSPRPALPEEELKARLRRYLERLGIDDYEILE  235 (374)
T ss_pred             EEEeccCCCCCCCceEEEEecccCCCCCceEEEEEEcCCCeEEEEEEEEcCCCCCCHHHHHHHHHHHHHHcCCCceeEEE
Confidence            01111112 23478999999999843799999999999999999999999999779999999999999999999999999


Q ss_pred             EEEEeecCCCCcchhhcccCceecccccccccCCCCCcHHHHHHHHHHHHHHhhh-cCCCChhHHHHHHHHhHHHHHhHH
Q psy10545        188 EEIGSIPIALKNEKIIKFKKTICVGLRANLLHATTGYSLPIAIQLAENIAKYSIT-TNQINSTVLFKLVKKFIINHQKKQ  266 (1428)
Q Consensus       188 ~E~g~iPm~~~~~~~~~~~~~~~~G~~~g~~~pstGYs~~~~~~~a~~~a~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~  266 (1428)
                      +|.|+|||+...+++...+++++||++||++||||||||.++|++|++||+++++ +.+...     ..+.|.+..|+++
T Consensus       236 ~E~G~IPm~~~~~~~~~~~~v~~iG~agG~v~PsTGYs~~~~~~~a~~ia~~l~~~~~~~~~-----~~~~~~~~~~~~~  310 (374)
T PF05834_consen  236 EERGVIPMTTGGFPPRFGQRVIRIGTAGGMVKPSTGYSFARIQRQADAIADALAKGGAPLRA-----WSPLWPRERWRDR  310 (374)
T ss_pred             eecceeecccCCCccccCCCeeeEEccccCCCCcccHHHHHHHHHHHHHHHHHhhccccccc-----cccccHHHHHHHH
Confidence            9999999976544434467899999999999999999999999999999999985 332221     1135667788899


Q ss_pred             HHHHHHHHHhhcccCc-chHHHHHHHhcCChhhHhhhccCCCChHHHHHHHhcCCchHHHHHH
Q psy10545        267 RFFCMLNRLFFLSNSR-CHLDIMQYFYTLPDKIIRNFYANKLSFFDKIRIFSGAGIGGIALAI  328 (1428)
Q Consensus       267 ~~~~~~~~~~l~~~~~-~~~~~f~~f~~~~~~~~~~Fl~~~~~~~~~~~ii~g~~~~~~~~a~  328 (1428)
                      .|+|.+++.+|...++ ..+.||+.||++|+++|+|||++++++.|..+||.++|+++|..|+
T Consensus       311 ~flr~l~~~~l~~~~~~~~~~f~~~f~~l~~~~~~~FL~~~~~~~~~~~i~~~~p~~p~~~a~  373 (374)
T PF05834_consen  311 RFLRVLGLEVLLRLPPDGRRIFFRMFFRLPPDRIARFLSERSSLADDLRIMLALPKRPFLRAL  373 (374)
T ss_pred             HHHHHhcchhhcccChhHHHHHHHHHhCCCHHHHHhHhcCCCCHHHHHHHHHhCCCcChhhcc
Confidence            9999999888888877 9999999999999999999999999999999999999999999875



Carotenoids with cyclic end groups are essential components of the photosynthetic membranes in all plants, algae, and cyanobacteria. These lipid-soluble compounds protect against photo-oxidation, harvest light for photosynthesis, and dissipate excess light energy absorbed by the antenna pigments. The cyclisation of lycopene (psi, psi-carotene) is a key branch point in the pathway of carotenoid biosynthesis. Two types of cyclic end groups are found in higher plant carotenoids: the beta and epsilon rings. Carotenoids with two beta rings are ubiquitous, and those with one beta and one epsilon ring are common; however, carotenoids with two epsilon rings are rare [].; GO: 0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 0016117 carotenoid biosynthetic process

>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03464 HpnC squalene synthase HpnC Back     alignment and domain information
>cd00683 Trans_IPPS_HH Trans-Isoprenyl Diphosphate Synthases, head-to-head Back     alignment and domain information
>PLN02632 phytoene synthase Back     alignment and domain information
>TIGR03465 HpnD squalene synthase HpnD Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>COG1562 ERG9 Phytoene/squalene synthetase [Lipid metabolism] Back     alignment and domain information
>PF00494 SQS_PSY: Squalene/phytoene synthase; InterPro: IPR002060 Squalene synthase 2 Back     alignment and domain information
>TIGR01559 squal_synth farnesyl-diphosphate farnesyltransferase Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>KOG4411|consensus Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>KOG1459|consensus Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>cd00867 Trans_IPPS Trans-Isoprenyl Diphosphate Synthases Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>cd00385 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, Class 1 Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1459|consensus Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>KOG1439|consensus Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>KOG4405|consensus Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1428
4dgk_A501 Crystal Structure Of Phytoene Desaturase Crti From 1e-150
3vjd_A293 Crystal Structure Of The Y248a Mutant Of C(30) Caro 1e-11
2zco_A293 Crystal Structure Of The C(30) Carotenoid Dehydrosq 2e-11
4e9u_A287 Crystal Structure Of Dehydrosqualene Synthase (Crtm 2e-11
4f6v_A292 Crystal Structure Of Dehydrosqualene Synthase (Crtm 2e-11
3ae0_A293 Crystal Structure Of The C(30) Carotenoid Dehydrosq 2e-11
3adz_A293 Crystal Structure Of The C(30) Carotenoid Dehydrosq 1e-10
4hd1_A294 Crystal Structure Of Squalene Synthase Hpnc From Al 7e-08
1ezf_A340 Crystal Structure Of Human Squalene Synthase Length 2e-04
3lee_A340 Crystal Structure Of The Human Squalene Synthase Co 2e-04
3vj8_A343 Crystal Structure Of The Human Squalene Synthase Le 3e-04
>pdb|4DGK|A Chain A, Crystal Structure Of Phytoene Desaturase Crti From Pantoea Ananatis Length = 501 Back     alignment and structure

Iteration: 1

Score = 531 bits (1368), Expect = e-150, Method: Compositional matrix adjust. Identities = 246/473 (52%), Positives = 330/473 (69%), Gaps = 1/473 (0%) Query: 729 RLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLFDLSKNRMENYV 788 RLQ AGI ++LEQRDKPGGRAYVY+ GF FDAGPTVITDP++I+ LF L+ +++ YV Sbjct: 19 RLQAAGIPVLLLEQRDKPGGRAYVYEDQGFTFDAGPTVITDPSAIEELFALAGKQLKEYV 78 Query: 789 NLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNYSKKVFKEGYLS 848 LLP+ PFYRL W K NY+++ LE QI +FN D++GYR FL+YS+ VFKEGYL Sbjct: 79 ELLPVTPFYRLCWESGKVFNYDNDQTRLEAQIQQFNPRDVEGYRQFLDYSRAVFKEGYLK 138 Query: 849 FASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQAFSFNSLFIGGNPFSTS 908 + FL+ DML P+L K++AW+SVYS V+ +I++++L+QAFSF+SL +GGNPF+TS Sbjct: 139 LGTVPFLSFRDMLRAAPQLAKLQAWRSVYSKVASYIEDEHLRQAFSFHSLLVGGNPFATS 198 Query: 909 SIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQVISIYXXXXXXXXXX 968 SIYTLIHALE EWG+WFP+GG GAL++ +IKLFQ+LGG ++LN++V + Sbjct: 199 SIYTLIHALEREWGVWFPRGGTGALVQGMIKLFQDLGGEVVLNARVSHMETTGNKIEAVH 258 Query: 969 XXXGQIFDADIIVSNADIINTYRNLLGQYAFGXXXXXXXXXXXMSNSLFVIYFGLSEQYT 1028 G+ F + SNAD+++TYR+LL Q+ MSNSLFV+YFGL+ + Sbjct: 259 LEDGRRFLTQAVASNADVVHTYRDLLSQHPAAVKQSNKLQTKRMSNSLFVLYFGLNHHHD 318 Query: 1029 HLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGCSTFYALIPVPN 1088 LAHHT+ F Y++ I+ IF + ++ S+YLH+P VTD SLAP GC ++Y L PVP+ Sbjct: 319 QLAHHTVCFGPRYRELIDEIFNHDGLAEDFSLYLHAPCVTDSSLAPEGCGSYYVLAPVPH 378 Query: 1089 LXXXXXXXXXXXXKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDFKDVLGSYLGSAFSF 1148 L KL++ +F YLEQ+ +P LR +L+T R+FTP DF+D L +Y GSAFS Sbjct: 379 LGTANLDWTVEGPKLRDRIFAYLEQHYMPGLRSQLVTHRMFTPFDFRDQLNAYHGSAFSV 438 Query: 1149 APLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGSKSFSSAIKLFD 1201 P+LTQSAWFRPHNRDK +TNLY VGAGTHPGA + GS ++ + L D Sbjct: 439 EPVLTQSAWFRPHNRDKTITNLYLVGAGTHPGAGIPGV-IGSAKATAGLMLED 490
>pdb|3VJD|A Chain A, Crystal Structure Of The Y248a Mutant Of C(30) Carotenoid Dehydrosqualene Synthase From Staphylococcus Aureus Length = 293 Back     alignment and structure
>pdb|2ZCO|A Chain A, Crystal Structure Of The C(30) Carotenoid Dehydrosqualene Synthase From Staphylococcus Aureus Length = 293 Back     alignment and structure
>pdb|4E9U|A Chain A, Crystal Structure Of Dehydrosqualene Synthase (Crtm) From S. Aureus Complexed With A Thiocyanate Inhibitor Length = 287 Back     alignment and structure
>pdb|4F6V|A Chain A, Crystal Structure Of Dehydrosqualene Synthase (Crtm) From S. Aureus Complexed With Bph-1034, Mg2+ And Fmp. Length = 292 Back     alignment and structure
>pdb|3AE0|A Chain A, Crystal Structure Of The C(30) Carotenoid Dehydrosqualene Synthase From Staphylococcus Aureus Complexed With Geranylgeranyl Thiopyrophosphate Length = 293 Back     alignment and structure
>pdb|3ADZ|A Chain A, Crystal Structure Of The C(30) Carotenoid Dehydrosqualene Synthase From Staphylococcus Aureus Complexed With Intermediate Pspp Length = 293 Back     alignment and structure
>pdb|4HD1|A Chain A, Crystal Structure Of Squalene Synthase Hpnc From Alicyclobacillus Acidocaldarius Length = 294 Back     alignment and structure
>pdb|1EZF|A Chain A, Crystal Structure Of Human Squalene Synthase Length = 340 Back     alignment and structure
>pdb|3LEE|A Chain A, Crystal Structure Of The Human Squalene Synthase Complexed With Bph- 652 Length = 340 Back     alignment and structure
>pdb|3VJ8|A Chain A, Crystal Structure Of The Human Squalene Synthase Length = 343 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1428
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 1e-107
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 3e-05
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 1e-82
3acx_A293 Dehydrosqualene synthase; CRTM, carotenoid biosynt 4e-64
3vj8_A343 Squalene synthase; farnesyl-diphosphate farnesyltr 3e-43
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 1e-17
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 8e-17
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 5e-16
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 2e-15
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 3e-15
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 1e-14
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 1e-14
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 3e-14
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 4e-14
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 1e-13
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 2e-13
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 2e-11
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 2e-11
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 2e-10
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 4e-10
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 5e-10
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 2e-09
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 2e-09
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 2e-08
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 6e-08
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 2e-07
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 4e-07
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 2e-05
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 6e-05
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 1e-04
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 2e-04
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 7e-04
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 2e-04
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 4e-04
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 4e-04
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 6e-04
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 6e-04
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 7e-04
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 9e-04
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
 Score =  344 bits (885), Expect = e-107
 Identities = 79/467 (16%), Positives = 153/467 (32%), Gaps = 71/467 (15%)

Query: 718  GAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLF 777
            GAG+GG+  A RL  AG    + E+    GGR       GF   +G   +  PN      
Sbjct: 7    GAGLGGLLSAARLSKAGHEVEVFERLPITGGRFTNLSYKGFQLSSGAFHML-PNGPGGPL 65

Query: 778  DLSKNRMENYVNLLPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNY 837
                  +E  VN++  +                     +   + K N + +KG++   + 
Sbjct: 66   ACFLKEVEASVNIVRSEM------------------TTVRVPLKKGNPDYVKGFK---DI 104

Query: 838  SKKVFKEGYLSFASKSFLTINDMLFILPKLIKIKAWKSVYSIVSQFIKNDYLKQ---AFS 894
            S   F    LS+  +  +     L I+       +  S+ + +   + +++L +   +F 
Sbjct: 105  SFNDFPS-LLSYKDRMKI----ALLIVSTRKNRPSGSSLQAWIKSQVSDEWLIKFADSFC 159

Query: 895  FNSLFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLILNSQV 954
              +L +  +      ++ +I  +    G   P+GG   +I AL  +    GG +    +V
Sbjct: 160  GWALSLKSDEVPVEEVFEIIENMYRFGGTGIPEGGCKGIIDALETVISANGGKIHTGQEV 219

Query: 955  ISIYVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSN 1014
              I + N K   + + + +I DAD+++SN     T        +         +   +  
Sbjct: 220  SKILIENGKAAGI-IADDRIHDADLVISNLGHAATAVLCSEALSKEADAAYFKMVGTLQP 278

Query: 1015 SLFVIYFGLSEQYTHLAHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAP 1074
            S  +    L+     + H  +      ++                  ++  +  D  LAP
Sbjct: 279  SAGI-KICLAADEPLVGHTGVLLTPYTRR---------------INGVNEVTQADPELAP 322

Query: 1075 TGCSTFYALIPVPNLSNSSINWSEESIKLKNIVFMYLEQYCIPNLRKKLITQRIFTPNDF 1134
             G         V   +  ++    E           L++   P  R       +     +
Sbjct: 323  PGKHLTMCHQYVAPENVKNLESEIEMGLED------LKEI-FPGKR-----YEVLLIQSY 370

Query: 1135 KDVLGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGA 1181
             D             P+   ++   P N     + LY VG G     
Sbjct: 371  HD-----------EWPVNRAASGTDPGNETP-FSGLYVVGDGAKGKG 405


>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>3acx_A Dehydrosqualene synthase; CRTM, carotenoid biosynthesis, staphyloxanthin biosynthesis, transferase, head-TO-head condensation, inhibitor; HET: 673; 1.31A {Staphylococcus aureus} PDB: 2zcp_A* 2zcq_A* 2zcr_A* 2zcs_A* 2zy1_A* 3acw_A* 2zco_A* 3acy_A* 3npr_A* 3nri_A* 3tfn_A* 3tfp_A* 3tfv_A* 3adz_A* 3lgz_B* 3vjd_A* 3vje_A* 3ae0_A* 4ea2_A* 4e9u_A* ... Length = 293 Back     alignment and structure
>3vj8_A Squalene synthase; farnesyl-diphosphate farnesyltransferase, head-TO-head synth cholesterol biosynthesis, oxidoreductase, transferase; 1.52A {Homo sapiens} PDB: 3vj9_A 3vja_A 3vjb_A 3vjc_A* 3asx_A* 3lee_A* 3q2z_A* 3q30_A* 1ezf_A* Length = 343 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Length = 453 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1428
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 100.0
4hd1_A294 Squalene synthase HPNC; MCSG, structural genomics, 100.0
3acx_A293 Dehydrosqualene synthase; CRTM, carotenoid biosynt 100.0
3vj8_A343 Squalene synthase; farnesyl-diphosphate farnesyltr 100.0
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 100.0
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 100.0
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.96
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.96
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.96
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 99.95
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.95
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.95
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.95
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 99.94
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.94
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 99.94
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.93
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 99.92
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.92
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.92
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.9
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 99.9
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.89
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.89
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.87
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 99.87
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 99.87
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.86
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 99.86
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.85
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.85
1vg0_A650 RAB proteins geranylgeranyltransferase component A 99.82
3atr_A453 Conserved archaeal protein; saturating double bond 99.82
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 99.82
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.82
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.81
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.81
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.8
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 99.77
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 99.77
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.76
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.76
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 99.75
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.75
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.73
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 99.71
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.71
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.7
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.7
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 99.69
4hb9_A412 Similarities with probable monooxygenase; flavin, 99.69
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.68
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 99.68
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 99.66
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 99.66
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.65
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 99.64
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.63
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 99.62
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.59
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.58
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.58
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.58
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.54
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.49
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 99.46
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.28
3atr_A453 Conserved archaeal protein; saturating double bond 99.12
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.11
3dme_A369 Conserved exported protein; structural genomics, P 99.07
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.05
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.99
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.98
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.95
2bry_A497 NEDD9 interacting protein with calponin homology a 98.95
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.92
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.92
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.92
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.91
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.88
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.85
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.84
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.83
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.83
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.82
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.79
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.79
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.78
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.77
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.76
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.76
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.75
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.72
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.71
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.7
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.69
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.67
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.67
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.66
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.64
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.62
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.6
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.59
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.58
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.57
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.56
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.56
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.56
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.51
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.5
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.49
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.49
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.48
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.48
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.48
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 98.48
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.47
2cul_A232 Glucose-inhibited division protein A-related PROT 98.47
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.46
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.45
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.44
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.44
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.42
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.42
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.42
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.41
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 98.41
4dna_A463 Probable glutathione reductase; structural genomic 98.39
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.38
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.38
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.37
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.37
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 98.36
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.35
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.34
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.33
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.33
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.31
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.3
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.3
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.29
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.26
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.26
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.23
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.23
2bry_A497 NEDD9 interacting protein with calponin homology a 98.22
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 98.21
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.21
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.21
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.21
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.2
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.2
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.19
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.19
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.18
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.17
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.17
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.16
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.15
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.14
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.14
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.14
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.14
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.13
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.13
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.12
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.11
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.11
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.11
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.1
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.09
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.09
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.08
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.06
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.04
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.03
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.03
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.02
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.98
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.98
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.98
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 97.96
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.96
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.96
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.92
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 97.9
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.87
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 97.87
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.86
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.85
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.81
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.8
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.78
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.75
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.73
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.73
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.7
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.69
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 97.69
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 97.64
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.64
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.62
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.6
3dme_A369 Conserved exported protein; structural genomics, P 97.58
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.58
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 97.56
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.55
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.54
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.51
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.5
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 97.49
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.48
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.45
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.44
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.43
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.42
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.41
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.41
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.4
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.39
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.38
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.38
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.36
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.36
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.34
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.31
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.3
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.3
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.29
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.29
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.28
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.28
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.28
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.27
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.27
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.24
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.22
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.21
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.21
2cul_A232 Glucose-inhibited division protein A-related PROT 97.21
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.2
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.19
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.19
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.17
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 97.17
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.17
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.17
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.16
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.16
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.15
2gqf_A401 Hypothetical protein HI0933; structural genomics, 97.15
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.13
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.12
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.11
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.1
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.09
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.07
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.06
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.02
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.02
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.01
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.01
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.01
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.97
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.97
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.95
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 96.93
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 96.89
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 96.89
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 96.88
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.86
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 96.85
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.85
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 96.85
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.81
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.81
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 96.8
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.79
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 96.76
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.76
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 96.75
4fk1_A304 Putative thioredoxin reductase; structural genomic 96.74
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 96.7
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 96.68
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 96.67
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 96.66
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 96.66
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 96.66
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 96.65
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 96.59
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 96.59
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 96.58
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.55
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 96.54
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.53
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 96.52
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.5
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.5
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 96.48
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 96.48
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 96.48
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 96.48
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 96.47
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 96.46
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 96.46
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 96.46
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 96.42
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 96.41
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 96.39
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.39
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 96.39
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 96.38
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 96.37
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 96.37
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 96.36
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 96.34
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 96.32
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.3
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 96.27
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 96.27
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.26
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 96.25
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 96.25
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 96.23
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 96.22
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 96.21
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 96.21
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 96.2
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 96.18
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 96.17
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 96.17
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 96.17
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 96.16
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 96.12
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 96.06
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 96.05
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 96.0
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 95.98
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 95.98
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 95.96
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 95.96
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 95.95
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 95.94
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 95.91
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 95.86
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 95.82
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 95.82
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.81
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 95.79
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 95.77
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 95.73
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 95.72
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 95.69
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 95.67
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 95.67
1vg0_A650 RAB proteins geranylgeranyltransferase component A 95.63
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 95.59
1ojt_A482 Surface protein; redox-active center, glycolysis, 95.59
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 95.55
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 95.53
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 95.52
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 95.52
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 95.51
4dna_A463 Probable glutathione reductase; structural genomic 95.51
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 95.51
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 95.49
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 95.49
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 95.48
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 95.47
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 95.46
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 95.44
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 95.44
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 95.43
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 95.42
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 95.32
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 95.32
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 95.29
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 95.27
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 95.23
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 95.23
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 95.23
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 95.19
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 95.12
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 95.06
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 95.03
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 95.02
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 95.02
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 95.0
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 94.98
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 94.97
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 94.93
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 94.91
3r9u_A315 Thioredoxin reductase; structural genomics, center 94.88
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 94.84
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 94.82
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 94.82
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 94.81
4gut_A776 Lysine-specific histone demethylase 1B; histone de 94.77
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 94.77
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 94.76
1pj5_A830 N,N-dimethylglycine oxidase; channelling, FAD bind 94.74
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 94.71
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 94.67
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 94.65
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 94.64
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 94.61
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 94.58
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 94.56
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 94.49
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 94.43
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 94.41
1fec_A490 Trypanothione reductase; redox-active center, oxid 94.4
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 94.3
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 94.2
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 94.11
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 94.02
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 93.98
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 93.94
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 93.88
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 93.84
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 93.84
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 93.63
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 93.52
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 93.51
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 92.96
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; 92.9
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 92.77
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 92.52
3aqb_B325 Component B of hexaprenyl diphosphate synthase; pr 92.4
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 92.02
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 91.99
4f62_A317 Geranyltranstransferase; enzyme function initiativ 91.37
3mzv_A341 Decaprenyl diphosphate synthase; transferase, stru 91.3
3ts7_A324 Geranyltranstransferase; isoprenoid synthesis, far 91.13
3rmg_A334 Octaprenyl-diphosphate synthase; structural genomi 91.06
1uby_A367 FPS, farnesyl diphosphate synthase; transferase, i 90.94
2her_A368 Fragment, farnesyl pyrophosphate synthase; farnesy 90.85
2ihi_A395 Pyrophosphate synthase; PV092040, structural genom 90.73
1wmw_A330 Geranylgeranyl diphosphate synthetase; GGPP, preny 90.72
3p8r_A302 Geranyltranstransferase; isoprenyl synthase, struc 90.56
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 90.51
3oyr_A345 Trans-isoprenyl diphosphate synthase; isoprenyl sy 90.51
2qis_A374 Farnesyl pyrophosphate synthetase; trans-prenyltra 90.4
1lss_A140 TRK system potassium uptake protein TRKA homolog; 90.35
3lsn_A304 Geranyltranstransferase; structural genomics, prot 90.28
2q80_A301 Geranylgeranyl pyrophosphate synthetase; isoprenoi 90.24
1yhl_A362 Farnesyl pyrophosphate synthase; farnesyl diphosph 90.15
3uca_A324 Geranyltranstransferase; isoprenoid synthesis, iso 90.07
3tc1_A315 Octaprenyl pyrophosphate synthase; all alpha-helic 90.0
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 89.93
3m0g_A297 Farnesyl diphosphate synthase; structural genomics 89.91
3lom_A313 Geranyltranstransferase; geranyltransferase, struc 89.82
3kb9_A382 EPI-isozizaene synthase; terpenoid cyclase, alpha- 89.61
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 89.52
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 89.44
3lmd_A360 Geranylgeranyl pyrophosphate synthase; isoprenyl d 89.39
3lk5_A380 Geranylgeranyl pyrophosphate synthase; structural 89.36
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 89.31
1id1_A153 Putative potassium channel protein; RCK domain, E. 89.27
4dhd_A358 Polyprenyl synthetase; isoprenoid synthesis, isopr 89.14
3nf2_A352 Putative polyprenyl synthetase; isoprenyl diphosph 89.06
3pko_A334 Geranylgeranyl pyrophosphate synthase; isoprenyl d 88.61
1rtr_A301 Geranyltranstransferase; 2.50A {Staphylococcus aur 88.53
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 88.41
1v4e_A299 Octoprenyl-diphosphate synthase; trans-type prenyl 87.5
2e8v_A340 Geranylgeranyl pyrophosphate synthetase; prenyltra 87.17
3apz_A348 Geranyl diphosphate synthase; prenyltransferase, a 87.07
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 86.17
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 86.11
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 86.06
3p8l_A302 Geranyltranstransferase; isoprenyl synthase, struc 85.32
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 85.27
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 85.23
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 84.9
3ipi_A295 Geranyltranstransferase; isoprene biosynthesis, he 84.64
3c85_A183 Putative glutathione-regulated potassium-efflux S 84.43
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 84.4
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 83.9
2h8o_A335 Geranyltranstransferase; geranyltransferase,agroba 83.89
1wy0_A342 Geranylgeranyl pyrophosphate synthetase; pyrococcu 83.68
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 83.03
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 82.86
1ps1_A337 Pentalenene synthase; antibiotic biosynthesis, ses 82.6
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 82.54
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 82.52
2ftz_A284 Geranyltranstransferase; TM0161, structural GE joi 82.44
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 82.33
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 82.27
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 81.92
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 81.71
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 81.65
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 81.26
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 80.95
3tl2_A315 Malate dehydrogenase; center for structural genomi 80.8
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 80.75
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 80.63
3pde_A309 Farnesyl-diphosphate synthase; isoprenyl diphospha 80.61
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 80.5
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 80.5
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 80.47
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
Probab=100.00  E-value=1.3e-58  Score=580.22  Aligned_cols=488  Identities=54%  Similarity=0.981  Sum_probs=364.7

Q ss_pred             cceeeecCCCcchHHHHHHHHhCCCeEEEEccCCCCCCcceEEEeCCeEEcccccccCCchHHHHHHHHhcccccccceE
Q psy10545        711 DKIRIFSGAGIGGIALAIRLQTAGISTIILEQRDKPGGRAYVYKQDGFIFDAGPTVITDPNSIKLLFDLSKNRMENYVNL  790 (1428)
Q Consensus       711 ~~dViIIGaGiaGLsAA~~La~~G~~V~VlEa~~~~GGr~~s~~~~G~~~d~G~~~i~~~~~~~~l~~~lG~~l~~~l~~  790 (1428)
                      |++|||||||++||+||++|+++|++|+||||++++||+++|++.+||.+|.|++++.++..+.++++.+|.++.+.+++
T Consensus         1 Mk~VvVIGaG~~GL~aA~~La~~G~~V~VlEa~~~~GG~~~t~~~~G~~~D~G~~~~~~~~~~~~l~~~~g~~~~~~~~~   80 (501)
T 4dgk_A            1 MKPTTVIGAGFGGLALAIRLQAAGIPVLLLEQRDKPGGRAYVYEDQGFTFDAGPTVITDPSAIEELFALAGKQLKEYVEL   80 (501)
T ss_dssp             CCCEEEECCHHHHHHHHHHHHHTTCCEEEECCC-------CEEEETTEEEECSCCCBSCTHHHHHHHHTTTCCGGGTCCE
T ss_pred             CCCEEEECCcHHHHHHHHHHHHCCCcEEEEccCCCCCCcEEEEEeCCEEEecCceeecCchhHHHHHHHhcchhhhceee
Confidence            57899999999999999999999999999999999999999999999999999999998888899999999888888899


Q ss_pred             EecCCceEEEeCCCcEEEecCCHHHHHHHHHhhCcccHHHHHHHHHHHHHHHHHhhhhhcccCcccHHHHHHhhHHHHhh
Q psy10545        791 LPIKPFYRLYWGKEKFLNYEDNIKDLEKQIAKFNLNDIKGYRLFLNYSKKVFKEGYLSFASKSFLTINDMLFILPKLIKI  870 (1428)
Q Consensus       791 ~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  870 (1428)
                      .+.++.+.+.+.+|+.+.++.+...+.+.+.+++|.+.+.+.+|++.++.++......+...++.++.+++...+.+..+
T Consensus        81 ~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  160 (501)
T 4dgk_A           81 LPVTPFYRLCWESGKVFNYDNDQTRLEAQIQQFNPRDVEGYRQFLDYSRAVFKEGYLKLGTVPFLSFRDMLRAAPQLAKL  160 (501)
T ss_dssp             EEESSSEEEEETTSCEEEECSCHHHHHHHHHHHCTHHHHHHHHHHHHHHHHTSSSCC--CCCCCCCHHHHHHSGGGTTTS
T ss_pred             EecCcceEEEcCCCCEEEeeccHHHHHHHHhhcCccccchhhhHHHHHHHhhhhhhhhccccccchhhhhhhhhhhhhhh
Confidence            99999999999999999999999999999999999999999999999888877666666666777777776655544444


Q ss_pred             cccCCHHHHHHhhcCCHHHHHHHHhhcccccCCCCchhHHHHHHHHhccccceeeecCchHHHHHHHHHHHHHcCcEEEe
Q psy10545        871 KAWKSVYSIVSQFIKNDYLKQAFSFNSLFIGGNPFSTSSIYTLIHALEYEWGIWFPKGGVGALIKALIKLFQNLGGNLIL  950 (1428)
Q Consensus       871 ~~~~s~~~~l~~~~~~~~l~~~l~~~~~~~g~~p~~~s~~~~~~~~~~~~~g~~~~~gG~~~l~~~L~~~l~~~G~~V~~  950 (1428)
                      ....++.+++.+++.++.++.++.....+.+..|...++.+.++.+.....|.++|+||++.|+++|++.++++|++|++
T Consensus       161 ~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~g~~p~~~~~~~~~~~~~~~~~G~~~p~GG~~~l~~aL~~~~~~~Gg~I~~  240 (501)
T 4dgk_A          161 QAWRSVYSKVASYIEDEHLRQAFSFHSLLVGGNPFATSSIYTLIHALEREWGVWFPRGGTGALVQGMIKLFQDLGGEVVL  240 (501)
T ss_dssp             HHHHHHHHHHHTTCCCHHHHHHHHHHHHHHHSCC--CCCTHHHHHHHHSCCCEEEETTHHHHHHHHHHHHHHHTTCEEEC
T ss_pred             hhcccHHHHHHHHhccHHHHhhhhhhhcccCCCcchhhhhhhhhhhhhccCCeEEeCCCCcchHHHHHHHHHHhCCceee
Confidence            44567889999999999999999877777788888777777777777777899999999999999999999999999999


Q ss_pred             CceeeEEEEeCCeEEEEEecCCcEEEcCEEEEcCCHHHHHHHhcCCCCCChhHHHHHhhcCCCCceEEEEEeecCCcCCC
Q psy10545        951 NSQVISIYVNNNKVNKVHLKNGQIFDADIIVSNADIINTYRNLLGQYAFGKKKYMNLIKKKMSNSLFVIYFGLSEQYTHL 1030 (1428)
Q Consensus       951 ~~~V~~I~~~~~~v~~V~~~~G~~i~ad~VV~A~~~~~~~~~Ll~~~~~p~~~~~~l~~~~~~~s~~~v~l~~~~~~~~~ 1030 (1428)
                      |++|++|..+++++++|+++||+++.||.||++++++.+...|+++.+.+....+.+++.+++.+.++++++++.+.+.+
T Consensus       241 ~~~V~~I~~~~~~~~gV~~~~g~~~~ad~VV~~a~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~s~~~~~~~l~~~~~~l  320 (501)
T 4dgk_A          241 NARVSHMETTGNKIEAVHLEDGRRFLTQAVASNADVVHTYRDLLSQHPAAVKQSNKLQTKRMSNSLFVLYFGLNHHHDQL  320 (501)
T ss_dssp             SCCEEEEEEETTEEEEEEETTSCEEECSCEEECCC---------------------------CCEEEEEEEEESSCCTTS
T ss_pred             ecceeEEEeeCCeEEEEEecCCcEEEcCEEEECCCHHHHHHHhccccccchhhhhhhhccccCCceeEEEecccCCcccc
Confidence            99999999999999999999999999999999999999999899887777777788889999999999999999998889


Q ss_pred             cceEEEcCCChHHHHHHHhcCCCCCCCceEEEEeCCCCCCCCCCCCccEEEEEEecCCCCCCCCCcHHHHHHHHHHHHHH
Q psy10545       1031 AHHTIFFPSNYKKSIENIFGKNFSRDNLSIYLHSPSVTDLSLAPTGCSTFYALIPVPNLSNSSINWSEESIKLKNIVFMY 1110 (1428)
Q Consensus      1031 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~s~~d~s~ap~G~~~l~v~~~~p~~~~~~~~~~~~~ee~~~~vl~~ 1110 (1428)
                      .++++++.+++...++.++..+.+++++.++++.+|..||+++|+|++++++++++|.......+|+..++++.+++++.
T Consensus       321 ~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~s~~dp~~ap~G~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~vl~~  400 (501)
T 4dgk_A          321 AHHTVCFGPRYRELIDEIFNHDGLAEDFSLYLHAPCVTDSSLAPEGCGSYYVLAPVPHLGTANLDWTVEGPKLRDRIFAY  400 (501)
T ss_dssp             CSEEEEEECC-------------CCCEEEEEEECGGGTCGGGSSTTCEEEEEEEEECCTTTSCCCHHHHHHHHHHHHHHH
T ss_pred             ccceeccccchhhhccccccccccccCCceecccCCCCCCCcCCCCCceEEEEEecCccccccccHHHHHHHHHHHHHHH
Confidence            99999999998888888888888999999999999999999999999999999988776543567999999999999999


Q ss_pred             HHhccCCCccCceEEEEecCcccHHHHhCCCCCcccccccccccccccCCCCCCCCCCceEEecCCccCCCCcccccccc
Q psy10545       1111 LEQYCIPNLRKKLITQRIFTPNDFKDVLGSYLGSAFSFAPLLTQSAWFRPHNRDKNLTNLYFVGAGTHPGAANKIIKAGS 1190 (1428)
Q Consensus      1111 L~~~~~P~l~~~i~~~~~~tp~~~~~~~~~~~G~~~g~~~~~~q~~~~rp~~~t~~i~~Ly~aGd~t~pg~gv~GA~~sg 1190 (1428)
                      |++.++|+++++++..++.||.+|+++++.+.|++||..+...|...+||..++++++|||+||++|+||+||+||+.||
T Consensus       401 l~~~~~P~~~~~i~~~~~~tP~~~~~~~~~~~G~~~g~~~~~~q~~~~RP~~~~t~i~gLyl~G~~t~pG~Gv~ga~~SG  480 (501)
T 4dgk_A          401 LEQHYMPGLRSQLVTHRMFTPFDFRDQLNAYHGSAFSVEPVLTQSAWFRPHNRDKTITNLYLVGAGTHPGAGIPGVIGSA  480 (501)
T ss_dssp             HHHHTCTTHHHHEEEEEEECTTTTC------------------------------CCTTEEECCCH------HHHHHHHH
T ss_pred             HHHhhCCChHHceEEEEECCHHHHHHHcCCCCccccChhcchhhccccCCCCCCCCCCCEEEECCCCCCcccHHHHHHHH
Confidence            99757799999999999999999999999999999999999999888999876545999999999999999999999999


Q ss_pred             cccccccc
Q psy10545       1191 KSFSSAIK 1198 (1428)
Q Consensus      1191 ~~~a~~i~ 1198 (1428)
                      +.+|+.|.
T Consensus       481 ~~aA~~il  488 (501)
T 4dgk_A          481 KATAGLML  488 (501)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
Confidence            99999885



>4hd1_A Squalene synthase HPNC; MCSG, structural genomics, PSI-biology, midwest center for S genomics, transferase; 2.40A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3acx_A Dehydrosqualene synthase; CRTM, carotenoid biosynthesis, staphyloxanthin biosynthesis, transferase, head-TO-head condensation, inhibitor; HET: 673; 1.31A {Staphylococcus aureus} PDB: 2zcp_A* 2zcq_A* 2zcr_A* 2zcs_A* 2zy1_A* 3acw_A* 2zco_A* 3acy_A* 3npr_A* 3nri_A* 3tfn_A* 3tfp_A* 3tfv_A* 3adz_A* 3lgz_B* 3vjd_A* 3vje_A* 3ae0_A* 4ea2_A* 4e9u_A* ... Back     alignment and structure
>3vj8_A Squalene synthase; farnesyl-diphosphate farnesyltransferase, head-TO-head synth cholesterol biosynthesis, oxidoreductase, transferase; 1.52A {Homo sapiens} PDB: 3vj9_A 3vja_A 3vjb_A 3vjc_A* 3v66_A* 3lee_A* 3q2z_A* 3q30_A* 3asx_A* 1ezf_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3aqb_B Component B of hexaprenyl diphosphate synthase; prenyltransferase, transferase; 2.40A {Micrococcus luteus} PDB: 3aqc_B* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>4f62_A Geranyltranstransferase; enzyme function initiative, structural genomics; 2.10A {Marinomonas SP} Back     alignment and structure
>3mzv_A Decaprenyl diphosphate synthase; transferase, structural genomics, PSI-2, protein structure initiative; 1.90A {Rhodobacter capsulatus} Back     alignment and structure
>3ts7_A Geranyltranstransferase; isoprenoid synthesis, farnesyl diphosphate synthase; 1.94A {Methylococcus capsulatus} Back     alignment and structure
>3rmg_A Octaprenyl-diphosphate synthase; structural genomics, protein structure initiative, isoprene biosynthesis, transferase; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1uby_A FPS, farnesyl diphosphate synthase; transferase, isoprene biosynthesis, cholesterol biosynthesis; HET: DMA; 2.40A {Gallus gallus} SCOP: a.128.1.1 PDB: 1ubw_A* 1ubv_A* 1ubx_A* 1fps_A Back     alignment and structure
>1wmw_A Geranylgeranyl diphosphate synthetase; GGPP, prenyl diphosphate synthase, structural genom riken structural genomics/proteomics initiative; 1.55A {Thermus thermophilus} Back     alignment and structure
>3p8r_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.50A {Vibrio cholerae} SCOP: a.128.1.1 Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3oyr_A Trans-isoprenyl diphosphate synthase; isoprenyl synthase, PSI, protein structure initiative; HET: IPE; 2.00A {Caulobacter crescentus} Back     alignment and structure
>2qis_A Farnesyl pyrophosphate synthetase; trans-prenyltransferase, structural genomics, structural GEN consortium, SGC, transferase; HET: RIS; 1.80A {Homo sapiens} PDB: 4dem_F* 1yv5_A* 1yq7_A* 2opm_A* 2opn_A* 3cp6_A* 2rah_A* 2vf6_A* 1zw5_A* 3b7l_A* 3s4j_A* 3rye_A* 3n45_F* 2f89_F* 2f7m_F* 2f8z_F* 2f8c_F* 2f92_F* 2f9k_F* 3n1v_F* ... Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3lsn_A Geranyltranstransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; HET: MSE; 1.35A {Pseudomonas fluorescens} PDB: 3lji_A* 3p41_A* Back     alignment and structure
>2q80_A Geranylgeranyl pyrophosphate synthetase; isoprenoid pathway, isopentenyl transferase, structural GENO structural genomics consortium, SGC; HET: GRG; 2.70A {Homo sapiens} SCOP: a.128.1.1 Back     alignment and structure
>1yhl_A Farnesyl pyrophosphate synthase; farnesyl diphosphate synthase, bisphosphonate, dimethyl ALLY pyrophosphate sulfate, FPPS, transferase; HET: DMA RIS; 1.95A {Trypanosoma cruzi} PDB: 1yhk_A* 1yhm_A* 3iba_A* 3ick_A* 3icm_A* 3icn_A* 3icz_A* 3id0_A* Back     alignment and structure
>3uca_A Geranyltranstransferase; isoprenoid synthesis, isoprenoid diphosphate synthase; 2.00A {Clostridium perfringens} Back     alignment and structure
>3tc1_A Octaprenyl pyrophosphate synthase; all alpha-helices fold, transferase; 2.00A {Helicobacter pylori} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3m0g_A Farnesyl diphosphate synthase; structural genomics, protein structure initiative, NYSGXRC, biosynthesis, transferase, PSI-2; 1.90A {Rhodobacter capsulatus} PDB: 3lvs_A Back     alignment and structure
>3lom_A Geranyltranstransferase; geranyltransferase, structural genomics, PSI, protein structure initiative, nysgrc; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3kb9_A EPI-isozizaene synthase; terpenoid cyclase, alpha-helical fold, farnesyl diphosphate, metal-binding, lyase, magnesium; HET: BTM; 1.60A {Streptomyces coelicolor} PDB: 3kbk_A 3lgk_A 3lg5_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3lmd_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, protein structure initiative, nysgrc; 1.90A {Corynebacterium glutamicum} PDB: 3q2q_A* Back     alignment and structure
>3lk5_A Geranylgeranyl pyrophosphate synthase; structural genomics, protein structure initiative, geranylge pyrophosphate synthase; 1.90A {Corynebacterium glutamicum} PDB: 3qqv_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4dhd_A Polyprenyl synthetase; isoprenoid synthesis, isoprenoid diphosphate synthase, trans; 1.65A {Pyrobaculum calidifontis} PDB: 4gp1_A* 4gp2_A* Back     alignment and structure
>3nf2_A Putative polyprenyl synthetase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; 2.20A {Streptomyces coelicolor} Back     alignment and structure
>3pko_A Geranylgeranyl pyrophosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative, nysgrc; HET: CIT; 1.98A {Lactobacillus brevis} PDB: 3n3d_A Back     alignment and structure
>1rtr_A Geranyltranstransferase; 2.50A {Staphylococcus aureus} SCOP: a.128.1.1 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1v4e_A Octoprenyl-diphosphate synthase; trans-type prenyltransferase, thermophilic; 2.28A {Thermotoga maritima} SCOP: a.128.1.1 PDB: 1v4j_A 1wkz_A 1vg2_A 1wl3_A 1wl0_A 1wl2_A 1v4h_A 1v4i_A 1v4k_A 2azl_A 1wl1_A 1vg4_A 1vg3_A 1vg6_A 1vg7_A Back     alignment and structure
>2e8v_A Geranylgeranyl pyrophosphate synthetase; prenyltransferase, farnesyl pyrophosphate, bisphosphonate; HET: GRG; 1.80A {Saccharomyces cerevisiae} PDB: 2e8t_A* 2e8u_A* 2dh4_A* 2e8w_A* 2e8x_A* 2e90_A* 2e91_A* 2e92_A* 2e93_A* 2e94_A* 2e95_A* 2z4v_A* 2z4w_A* 2z4x_A* 2z4y_A* 2z4z_A* 2z50_A* 2z52_A* 2z78_A* 2z7h_A* ... Back     alignment and structure
>3apz_A Geranyl diphosphate synthase; prenyltransferase, all alpha-helices fold, chroloplast, TRAN isoprenoid biosynthetic process; 2.60A {Arabidopsis thaliana} PDB: 3aq0_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3p8l_A Geranyltranstransferase; isoprenyl synthase, structural genomics, PSI, protein struct initiative, nysgrc; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ipi_A Geranyltranstransferase; isoprene biosynthesis, helical bundle, protein structure initiative II (PSI II), structural genomics, nysgxrc; 1.90A {Methanosarcina mazei} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2h8o_A Geranyltranstransferase; geranyltransferase,agrobacterium tumefaciens, structural GEN PSI-2, protein structure initiative; 1.60A {Agrobacterium tumefaciens} Back     alignment and structure
>1wy0_A Geranylgeranyl pyrophosphate synthetase; pyrococcus horikosh structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1ps1_A Pentalenene synthase; antibiotic biosynthesis, sesquiterpene cyclase, lyase; 2.60A {Streptomyces SP} SCOP: a.128.1.4 PDB: 1hm7_A 1hm4_A Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2ftz_A Geranyltranstransferase; TM0161, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3pde_A Farnesyl-diphosphate synthase; isoprenyl diphosphate synthase, structural genomics, PSI, PR structure initiative; HET: IPE; 1.75A {Lactobacillus brevis} PDB: 3m9u_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1428
d1ezfa_333 a.128.1.2 (A:) Squalene synthase {Human (Homo sapi 2e-42
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 2e-30
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 2e-04
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 8e-27
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 0.002
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 2e-26
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 6e-05
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 4e-23
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 8e-04
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 4e-21
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 3e-04
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 7e-21
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 0.003
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 4e-18
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 0.001
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 9e-18
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 6e-04
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 1e-07
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 1e-06
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 2e-05
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 0.002
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 2e-05
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 1e-04
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 8e-05
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 0.003
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 1e-04
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 3e-04
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 0.001
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 7e-04
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 8e-04
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 8e-04
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 0.001
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 0.001
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 0.001
d1aoga2117 c.3.1.5 (A:170-286) Trypanothione reductase {Trypa 0.002
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 0.002
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 0.003
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 0.003
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 0.003
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 0.003
>d1ezfa_ a.128.1.2 (A:) Squalene synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 333 Back     information, alignment and structure

class: All alpha proteins
fold: Terpenoid synthases
superfamily: Terpenoid synthases
family: Squalene synthase
domain: Squalene synthase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  156 bits (395), Expect = 2e-42
 Identities = 45/257 (17%), Positives = 93/257 (36%), Gaps = 15/257 (5%)

Query: 1184 KIIKAGSKSFSSAIKLFDPVIRYKVLMLYAWCRYCDDVIDNQICGNRSK------FLKKN 1237
            K +   S+SF++ I+  D  +R  V + Y   R  D + D+       K      F    
Sbjct: 8    KYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFL 67

Query: 1238 VSMKHKLKILRIKTKRACIGFKMKEPAFLALQKIISIHSFPVHLLFEHLDGFEMDVMERT 1297
                 +    + K ++    F       L  + +   +   +  +   +     + +++ 
Sbjct: 68   YQPDWRFMESKEKDRQVLEDF---PTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKH 124

Query: 1298 YITLDETLGYCYHVAGTIGLIIAHLIGVKE------KDTLNCARNLGIAFQLTNISRDVI 1351
              +  E   YC++VAG +G+ ++ L    E       +    A ++G+  Q TNI RD +
Sbjct: 125  VTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYL 184

Query: 1352 DDFYVGRCYLPLDWLRNEGLNKSNFVLAENRKKLFKVVTRILDVAEFYYSSSLVKLNTLP 1411
            +D   GR + P +          +F   EN     + +  ++  A  +    +  L+ L 
Sbjct: 185  EDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLR 244

Query: 1412 LRSTLAIVTSWSIYREI 1428
             +S         +    
Sbjct: 245  NQSVFNFCAIPQVMAIA 261


>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1428
d1ezfa_333 Squalene synthase {Human (Homo sapiens) [TaxId: 96 100.0
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.82
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.79
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.75
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.72
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.71
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 99.66
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.57
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.51
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 99.43
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.34
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 99.32
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 99.29
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.27
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.22
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 99.21
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 99.2
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.15
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.12
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.09
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.06
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.94
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.87
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.84
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.78
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.69
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.62
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.59
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.55
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.53
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.47
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.41
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.41
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.39
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.36
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.31
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.28
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.27
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.27
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.25
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.24
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.23
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.22
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.22
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.19
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.19
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.18
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.18
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.16
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.14
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.14
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.1
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.06
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.05
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.05
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.05
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.04
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.02
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.02
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.01
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.99
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.97
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.97
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.95
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.91
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.9
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.82
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.82
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.81
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.78
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.77
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.75
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.75
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.74
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.74
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.72
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.72
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.71
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.7
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.67
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.66
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.51
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.47
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.47
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 97.45
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.44
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.43
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.43
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.42
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.4
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.38
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 97.37
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.36
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 97.32
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.3
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 97.29
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.23
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.23
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.21
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.14
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.1
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.08
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.08
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 97.06
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.06
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.05
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.03
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 97.01
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.0
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 96.99
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 96.95
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 96.95
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 96.94
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.94
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.9
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.89
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.86
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 96.86
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 96.84
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.83
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.81
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.76
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.76
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 96.74
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.72
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 96.7
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 96.68
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.67
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 96.64
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.6
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 96.6
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 96.6
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 96.58
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 96.55
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 96.49
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.49
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.48
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.42
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.41
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 96.4
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.38
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 96.3
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 96.27
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 96.23
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.1
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.05
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.04
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.0
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.99
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 95.78
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 95.73
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.7
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 95.66
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.56
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.47
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.4
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 95.38
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.29
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.29
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 95.23
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.23
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 95.15
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 95.06
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.91
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.85
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 94.81
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.77
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.65
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.36
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.99
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.87
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.82
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.73
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.41
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.74
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 92.71
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 92.59
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 92.57
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 92.36
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 92.08
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 91.85
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 91.75
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.62
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 91.62
d2ivda2108 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 91.1
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 90.98
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 90.92
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 90.8
d1fpsa_348 Farnesyl diphosphate synthase (geranyltranstransfe 90.04
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 89.9
d2q80a1291 Geranylgeranyl pyrophosphate synthetase {Human (Ho 89.73
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 89.68
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 89.28
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 89.15
d1seza2112 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 88.78
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 88.29
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 87.27
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 87.25
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 86.16
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 86.12
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 86.08
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 85.93
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 85.4
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 85.32
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 84.95
d1ps1a_311 Pentalenene synthase {Streptomyces sp., UC5319 [Ta 84.8
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 84.24
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 83.71
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 83.57
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 83.27
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 82.94
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 82.61
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 82.38
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 82.07
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 81.32
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 80.45
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 80.13
>d1ezfa_ a.128.1.2 (A:) Squalene synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Terpenoid synthases
superfamily: Terpenoid synthases
family: Squalene synthase
domain: Squalene synthase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.6e-39  Score=370.88  Aligned_cols=232  Identities=18%  Similarity=0.181  Sum_probs=195.3

Q ss_pred             ccccccccccccchhhHHHHHHHHhhhhccccccccCccCcchhhhhhhhhHHHHHHHHHHHHHHHhcC----CCCCcHH
Q psy10545       1189 GSKSFSSAIKLFDPVIRYKVLMLYAWCRYCDDVIDNQICGNRSKFLKKNVSMKHKLKILRIKTKRACIG----FKMKEPA 1264 (1428)
Q Consensus      1189 sg~~~a~~i~~l~~~~r~~~~~lYaf~r~~Ddi~D~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~----~~~~~p~ 1264 (1428)
                      .+++++..+++||+++|.++++||+|||.+|||+|++..+..        .....|.+|++.+.....+    .+..+|+
T Consensus        13 ~SrSF~~a~~~Lp~~~R~~v~~lYafcR~~DdI~D~~~~~~~--------~k~~~L~~~~~~l~~~~~~~~~~~~~~~~l   84 (333)
T d1ezfa_          13 TSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVE--------KKVPLLHNFHSFLYQPDWRFMESKEKDRQV   84 (333)
T ss_dssp             HCSSHHHHHHTSCTHHHHHHHHHHHHHHHHHHHHHCTTSCHH--------HHHHHHHHHHHHTTCTTCCCCCCCSTTHHH
T ss_pred             hCccHHHHHHHCCHHHHHHHHHHHHHHHHhhhhHhCCCCCHH--------HHHHHHHHHHHHHHHhhhcccccCcchHHH
Confidence            578899999999999999999999999999999998643221        2245688888877654332    2345667


Q ss_pred             HHHHHHHHHHc-------CCCHHHHHHHHHHHHhhccCCCCCCHHHHHHHHHHHhHHHHHHHHHhhCCCcc------chH
Q psy10545       1265 FLALQKIISIH-------SFPVHLLFEHLDGFEMDVMERTYITLDETLGYCYHVAGTIGLIIAHLIGVKEK------DTL 1331 (1428)
Q Consensus      1265 ~~~l~~~~~~~-------~l~~~~~~~li~~~~~dl~~~~~~t~~~l~~Y~~~vag~vg~~~~~~~~~~~~------~~~ 1331 (1428)
                      +.++..++..+       ..+...+.+++.++.+|....+|+|++||+.|||+|||+||+|+++++|..+.      +..
T Consensus        85 l~~~~~v~~~~~~l~~~~~~~i~~~~~~m~~gm~d~~~~~~~t~~dL~~Ycy~VAG~VG~~l~~l~~~~~~~~~~~~~~~  164 (333)
T d1ezfa_          85 LEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDT  164 (333)
T ss_dssp             HHTHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHHTSCCCSHHHHHHHHHHHTHHHHHHHHHHHHHHTSSCHHHHHCH
T ss_pred             HhhccHHHHHHHHHHHHhccchHHHHHHHhccHHHHccCcCCCHHHHHHHHHHHHHHHHHHHHHHhCcCCCccccHHHHH
Confidence            77666666654       23333344444555555566789999999999999999999999999987542      356


Q ss_pred             HHHHHHHHHHHHHHHHhcchhhhcCCceeecHHHHHhcCCCccccccccchHHHHHHHHHHHHHHHHHHHHHHHhhcCCC
Q psy10545       1332 NCARNLGIAFQLTNISRDVIDDFYVGRCYLPLDWLRNEGLNKSNFVLAENRKKLFKVVTRILDVAEFYYSSSLVKLNTLP 1411 (1428)
Q Consensus      1332 ~~a~~~g~a~q~~nilrd~~~d~~~gR~ylP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~a~~~~~~lp 1411 (1428)
                      +.|++||+|||+||||||++||+++||||||+|+|.+||++++|+..+++.+++..++.+|+++|+.||++|++|+..||
T Consensus       165 ~~A~~lG~AlQltNIlRDi~eD~~~gR~YlP~e~l~~~g~~~~dl~~~~~~~~~~~~~~~l~~~A~~~~~~a~~y~~~lp  244 (333)
T d1ezfa_         165 ERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLR  244 (333)
T ss_dssp             HHHHHHHHHHHHHHHHHTHHHHHHHTCCCSCHHHHTTTCSSGGGGGSGGGHHHHHHHHHHHHHHHHTTHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHHHHHHhhHHHHhCCcEECCHHHHHHcCCCHHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccchHHHHHHHHHhhhC
Q psy10545       1412 LRSTLAIVTSWSIYREI 1428 (1428)
Q Consensus      1412 ~~~~~a~~~a~~~y~~i 1428 (1428)
                      .++++++.++..+|+.|
T Consensus       245 ~~~~~~~~~~~~~~a~~  261 (333)
T d1ezfa_         245 NQSVFNFCAIPQVMAIA  261 (333)
T ss_dssp             CHHHHHHHHHHHHHHHH
T ss_pred             chhHHHHHHHHHHHHHH
Confidence            99999999999999864



>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2q80a1 a.128.1.1 (A:6-296) Geranylgeranyl pyrophosphate synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps1a_ a.128.1.4 (A:) Pentalenene synthase {Streptomyces sp., UC5319 [TaxId: 1931]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure