Psyllid ID: psy1056

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590

IIHHNCTPEYQANEVLKVKKYKHGFIRDPVCIAPSTTLGKVLQMKKQHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKDLSSPLTKKITLAAPLVSSPMDTVTESDMAIAMALCGGIGAAIGTREADKYRLKLLSQAGVDVVILDSSQGNSIYQIEMIKYIKKEYPDMQVIGGNVVTTDQAKNLIDAGVDGLRVGSHGCHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKVMTNVNEIISAQAGISLEEANVILEKSKKGKLPILNDKGELIALIARTDLKKSRDYPDSSKDENNQLIVGAAIGTREADKNRLKLLSQAGVDVVILDSSQGNSIYQIEMIKFIKKEYPDMQVIGGNVLFGYQPRATLLNFIYQIEMIKFIKKEYPDMQVIGRNGTAVYRVAEYASRRGVPVIADGGVQSVGHVMKALALGASTAMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMSRKDGGAAAMDRYFHNEMDKLKVAQGVSGAIVDKGSVLRFLPYLQCGLKHGCQDIGAKSLSNLRAMMYSGELKFEKRTLCAQNEGSVHGLYSYEKRLF

cccccccHHHHHHHHHHHHcccccEEcccEEEcccccHHHHHHHHHHcccccEEEccccccccEEEEEEEEcccEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHcccccccEEccccccHHHHHHHHHHcccccccccccccccEEEEEEcccccccEEEEEEEcccccccccccccccccccccccccccEEEcccccHHHHHHHHHHcccccccEEcccccEEEEEEEHHcccccccccccccccccEEEEEEEcccccHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHccccEEEEccHHcHHHHHHHHHHcccccccccccccccccEEEEcccHHHHHHHHHHHHHccccEEEccccccccHHHHHHHcccccHHccccccccccccccEEEEccEEEccccccccHHHHcccccccccccccccccccccccccccEEEcccccccccHHHHHHHHHHHcccccccccHHHHHHcccccccEEEEEEccccccccccccEEEEEEcc

cccccccHHHHHHHHHHHHcccccEEEccEEEccccHHHHHHHHHHHcccccEEEEcccccccEEEEEEEcccEEEEccccccccccccccHHHHHHccEcccccccccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEEHHHHccEcEEEEEEccccccEEEEEEEcccccEccccccccccHHHHcccccccEEccccccHHHHHHHHHHHccccccEEcccccEEEEEEHHHHHHHHccccccccccccEEEEEEEcccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccEEEEccHHcHHHHHHHHHHHcccEEEEccccccEEEEHHHHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHcccEEEHHHHHccccccccEEEEEcccEEEEEcccccHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccEEEEEccHcccccccccccHHHHccc

iihhnctpeyqanEVLKVKKykhgfirdpvciapsttlgKVLQMKkqhgfcgfpvtengklgEKLLGIVtsrdvdflensanmdlkiekdlsspltkkitlaaplvsspmdtvtESDMAIAMALCGGIGAAIGTREADKYRLKLLSQAGVDVVILdssqgnsiYQIEMIKYIKKeypdmqviggnvvttdqAKNLIDagvdglrvgshgchgfcgfpvtengklgEKLLGIVtsrdvdflensanmDLKIEKVMTNVNEIISAQAGISLEEANVILEkskkgklpilndKGELIALIARTdlkksrdypdsskdennqLIVGAAIGTREADKNRLKLLSQAGVDVVIldssqgnsiYQIEMIKFIKKeypdmqviggnvlfgyqpraTLLNFIYQIEMIKFIKKeypdmqvigrngTAVYRVAEYasrrgvpviadggvqSVGHVMKALALGASTAMMGSllagtseapgeyffsdgvrlkkyrgmgsleamsrkdggaaamDRYFHNEMDKLKVAqgvsgaivdkgsvlrFLPYLqcglkhgcqdigAKSLSNLRAMMYSGelkfekrtlcaqnegsvhgLYSYEKRLF

iihhnctpeyqanEVLKVKKYKHGFIRDPVCIAPSTTLGKVLQMKKQHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDlkiekdlsspltkkitlaaplvsspmDTVTESDMAIAMALCGGIGAAIGTREADKYRLKLLSQAGVDvvildssqgnsiYQIEMIKYIKKEYPDMQVIGGNVVTTDQAKNLIDAGVDGLRVGSHGCHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKVMTNVNEIISAQAGISLEEANVILEkskkgklpilndkGELIALIArtdlkksrdypdsskdennqLIVGAAIGTREADKNRLKLLSQAGVDvvildssqgnsiYQIEMIKFIKKEYPDMQVIGGNVLFGYQPRATLLNFIYQIEMIKFIKKEYPDMQVIGRNGTAVYRVAEYASRRGVPVIADGGVQSVGHVMKALALGASTAMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMSRKDGGAAAMDRYFHNEMDKLKVAQGVSGAIVDKGSVLRFLPYLQCGLKHGCQDIGAKSLSNLRAMMYSGELKFEKrtlcaqnegsvhglysyekrlf

******TPEYQANEVLKVKKYKHGFIRDPVCIAPSTTLGKVLQMKKQHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKI*********KKITLAAPLVS***DTVTESDMAIAMALCGGIGAAIGTREADKYRLKLLSQAGVDVVILDSSQGNSIYQIEMIKYIKKEYPDMQVIGGNVVTTDQAKNLIDAGVDGLRVGSHGCHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKVMTNVNEIISAQAGISLEEANVILEKSKKGKLPILNDKGELIALIART******************LIVGAAIGTREADKNRLKLLSQAGVDVVILDSSQGNSIYQIEMIKFIKKEYPDMQVIGGNVLFGYQPRATLLNFIYQIEMIKFIKKEYPDMQVIGRNGTAVYRVAEYASRRGVPVIADGGVQSVGHVMKALALGASTAMMGSLLAGTSEAPGEYFFSDGVRLKKYRG***************AMDRYFHNEMDKLKVAQGVSGAIVDKGSVLRFLPYLQCGLKHGCQDIGAKSLSNLRAMMYSGELKFEKRTLCAQNEGSVHGLYS******

IIHHNCTPEYQANEVLKVKKYKHGFIRDPVCIAPSTTLGKVLQMKKQHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKDLSSPLTKKITLAAPLVSSPMDTVTESDMAIAMALCGGIGAAIGTREADKYRLKLLSQAGVDVVILDSSQGNSIYQIEMIKYIKKEYPDMQVIGGNVVTTDQAKNLIDAGVDGLRVGSHGCHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKVMTNVNEIISAQAGISLEEANVILEKSKKGKLPILNDKGELIALIARTDLKKSRDYPDSSKDENNQLIVGAAIGTREADKNRLKLLSQAGVDVVILDSSQGNSIYQIEMIKFIKKEYPDMQVIGGNVLFGYQPRATLLNFIYQIEMIKFIKKEYPDMQVIGRNGTAVYRVAEYASRRGVPVIADGGVQSVGHVMKALALGASTAMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLE*****************NEMDKLKVAQGVSGAIVDKGSVLRFLPYLQCGLKHGCQDIGAKSLSNLRAMMYSGELKFEKRTLCAQNEGSVHGLYSYEKRLF

IIHHNCTPEYQANEVLKVKKYKHGFIRDPVCIAPSTTLGKVLQMKKQHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKDLSSPLTKKITLAAPLVSSPMDTVTESDMAIAMALCGGIGAAIGTREADKYRLKLLSQAGVDVVILDSSQGNSIYQIEMIKYIKKEYPDMQVIGGNVVTTDQAKNLIDAGVDGLRVGSHGCHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKVMTNVNEIISAQAGISLEEANVILEKSKKGKLPILNDKGELIALIARTDLK**********DENNQLIVGAAIGTREADKNRLKLLSQAGVDVVILDSSQGNSIYQIEMIKFIKKEYPDMQVIGGNVLFGYQPRATLLNFIYQIEMIKFIKKEYPDMQVIGRNGTAVYRVAEYASRRGVPVIADGGVQSVGHVMKALALGASTAMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMSRKDGGAAAMDRYFHNEMDKLKVAQGVSGAIVDKGSVLRFLPYLQCGLKHGCQDIGAKSLSNLRAMMYSGELKFEKRTLCAQNEGSVHGLYSYEKRLF

***HNCTPEYQANEVLKVKKYKHGFIRDPVCIAPSTTLGKVLQMKKQHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKDLSSPLTKKITLAAPLVSSPMDTVTESDMAIAMALCGGIGAAIGTREADKYRLKLLSQAGVDVVILDSSQGNSIYQIEMIKYIKKEYPDMQVIGGNVVTTDQAKNLIDAGVDGLRVGSHGCHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKVMTNVNEIISAQAGISLEEANVILEKSKKGKLPILNDKGELIALIARTDLKKSRDYPDSSKDENNQLIVGAAIGTREADKNRLKLLSQAGVDVVILDSSQGNSIYQIEMIKFIKKEYPDMQVIGGNVLFGYQPRATLLNFIYQIEMIKFIKKEYPDMQVIGRNGTAVYRVAEYASRRGVPVIADGGVQSVGHVMKALALGASTAMMGSLLAGTSEAPGEYFFSDGVRLKKYRGM*******************F*NEMDKLKVAQGVSGAIVDKGSVLRFLPYLQCGLKHGCQDIGAKSLSNLRAMMYSGELKFEKRTLCAQNEGSVHGLYSYEKRLF

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		590	2.2.26 [Sep-21-2011]
F6S675		512	Inosine-5'-monophosphate	yes	N/A	0.786	0.906	0.559	1e-147
Q07152		537	Inosine-5'-monophosphate	yes	N/A	0.747	0.821	0.522	1e-146
A0JNA3		514	Inosine-5'-monophosphate	yes	N/A	0.796	0.914	0.546	1e-146
Q5RGV1		514	Inosine-5'-monophosphate	yes	N/A	0.796	0.914	0.546	1e-145
B0UXP9		514	Inosine-5'-monophosphate	no	N/A	0.801	0.920	0.538	1e-145
P50096		514	Inosine-5'-monophosphate	yes	N/A	0.796	0.914	0.542	1e-144
D3ZLZ7		514	Inosine-5'-monophosphate	yes	N/A	0.796	0.914	0.542	1e-144
P12268		514	Inosine-5'-monophosphate	no	N/A	0.796	0.914	0.540	1e-144
E9PU28		514	Inosine-5'-monophosphate	yes	N/A	0.796	0.914	0.538	1e-144
F7CYY5		515	Inosine-5'-monophosphate	no	N/A	0.798	0.914	0.542	1e-144

>sp\|F6S675\|IMDH1_XENTR Inosine-5'-monophosphate dehydrogenase 1 OS=Xenopus tropicalis GN=impdh1 PE=3 SV=1	Back alignment and function desciption

 Score =  521 bits (1343), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 297/531 (55%), Positives = 369/531 (69%), Gaps = 67/531 (12%)

Query: 75  DFLENSANMDLKI-EKDLSSPLTKKITLAAPLVSSPMDTVTESDMAIAMALCGGIGA--- 130
           DFL     +D    E DL+S LT+KITL  PL+SSPMDTVTESDMAIAMAL GGIG    
Sbjct: 34  DFLILPGFIDFTADEVDLTSALTRKITLKTPLISSPMDTVTESDMAIAMALMGGIGIIHH 93

Query: 131 -AIGTREADKYRLKLLSQAGVDVVILDSSQGNSIYQIEMIKYIKKEYPDMQVIGGNVVTT 189
                 +A++ R K       D V++  S  +++                    G+V   
Sbjct: 94  NCTPEFQANEVRKKFEQGFITDPVVM--SLNHTV--------------------GDVF-- 129

Query: 190 DQAKNLIDAGVDGLRVGSHGCHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLK 249
            +AKN                HGF G PVTE GK+G KL+GIVTSRD+DFL    +    
Sbjct: 130 -EAKNR---------------HGFSGIPVTETGKMGSKLVGIVTSRDIDFL-TEKDYSTY 172

Query: 250 IEKVMTNVNEIISAQAGISLEEANVILEKSKKGKLPILNDKGELIALIARTDLKKSRDYP 309
           + +VMT  +E++ A AG++L+EAN IL++SKKGKLPI+ND  EL+A+IARTDLKK+RDYP
Sbjct: 173 LSEVMTKRDELVVAPAGVTLKEANEILQRSKKGKLPIVNDSDELVAIIARTDLKKNRDYP 232

Query: 310 DSSKDENNQLIVGAAIGTREADKNRLKLLSQAGVDVVILDSSQGNSIYQIEMIKFIKKEY 369
            +SKD   QL+ GAAIGTRE DK RL LL+QAGVDVV+LDSSQGNS+YQI MI +IK++Y
Sbjct: 233 LASKDCRKQLLCGAAIGTREDDKYRLDLLTQAGVDVVVLDSSQGNSVYQINMIHYIKQKY 292

Query: 370 PDMQVIGGNVLFGYQPRATLLNFI-YQIEMIKF--------IKKEYPDMQVIGR-NGTAV 419
           P++QV+GGNV+   Q +    N I   ++ ++         I +E   +   GR  GTAV
Sbjct: 293 PELQVVGGNVVTAAQAK----NLIDAGVDALRVGMGCGSICITQE---VMACGRPQGTAV 345

Query: 420 YRVAEYASRRGVPVIADGGVQSVGHVMKALALGASTAMMGSLLAGTSEAPGEYFFSDGVR 479
           Y+VAEYA R GVPVIADGG+Q+VGHV+KALALGAST MMGSLLA T+EAPGEYFFSDGVR
Sbjct: 346 YKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVR 405

Query: 480 LKKYRGMGSLEAMSRKDGGAAAMDRYFHNEMDKLKVAQGVSGAIVDKGSVLRFLPYLQCG 539
           LKKYRGMGSL+AM +     ++  RYF +E DK+KVAQGVSG+I DKGS+ +F+PYL  G
Sbjct: 406 LKKYRGMGSLDAMEKN---TSSQKRYF-SEGDKVKVAQGVSGSIQDKGSIHKFVPYLIAG 461

Query: 540 LKHGCQDIGAKSLSNLRAMMYSGELKFEKRTLCAQNEGSVHGLYSYEKRLF 590
           ++HGCQDIGAKSLS LR+MMYSGELK EKRT+ AQ EG VHGL+SYEKRL+
Sbjct: 462 IQHGCQDIGAKSLSILRSMMYSGELKLEKRTMSAQVEGGVHGLHSYEKRLY 512

Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth.
Xenopus tropicalis (taxid: 8364)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 0EC: 5

>sp\|Q07152\|IMDH_DROME Inosine-5'-monophosphate dehydrogenase OS=Drosophila melanogaster GN=ras PE=1 SV=1	Back alignment and function description

>sp\|A0JNA3\|IMDH1_BOVIN Inosine-5'-monophosphate dehydrogenase 1 OS=Bos taurus GN=IMPDH1 PE=2 SV=2	Back alignment and function description

>sp\|Q5RGV1\|IMDH3_DANRE Inosine-5'-monophosphate dehydrogenase 1b OS=Danio rerio GN=impdh1b PE=2 SV=1	Back alignment and function description

>sp\|B0UXP9\|IMDH2_DANRE Inosine-5'-monophosphate dehydrogenase 2 OS=Danio rerio GN=impdh2 PE=2 SV=1	Back alignment and function description

>sp\|P50096\|IMDH1_MOUSE Inosine-5'-monophosphate dehydrogenase 1 OS=Mus musculus GN=Impdh1 PE=2 SV=2	Back alignment and function description

>sp\|D3ZLZ7\|IMDH1_RAT Inosine-5'-monophosphate dehydrogenase 1 OS=Rattus norvegicus GN=Impdh1 PE=3 SV=1	Back alignment and function description

>sp\|P12268\|IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens GN=IMPDH2 PE=1 SV=2	Back alignment and function description

>sp\|E9PU28\|IMDH2_RAT Inosine-5'-monophosphate dehydrogenase 2 OS=Rattus norvegicus GN=Impdh2 PE=3 SV=1	Back alignment and function description

>sp\|F7CYY5\|IMDH2_XENTR Inosine-5'-monophosphate dehydrogenase 2 OS=Xenopus tropicalis GN=impdh2 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		590
383863705		523	PREDICTED: inosine-5'-monophosphate dehy	0.788	0.889	0.616	1e-168
66508366		523	PREDICTED: inosine-5'-monophosphate dehy	0.788	0.889	0.612	1e-167
350417357		523	PREDICTED: inosine-5'-monophosphate dehy	0.788	0.889	0.604	1e-166
332027369		521	Inosine-5'-monophosphate dehydrogenase [	0.788	0.892	0.606	1e-166
340714347		525	PREDICTED: inosine-5'-monophosphate dehy	0.788	0.885	0.604	1e-166
193716221		511	PREDICTED: inosine-5'-monophosphate dehy	0.791	0.913	0.609	1e-165
307207027		523	Inosine-5'-monophosphate dehydrogenase [	0.840	0.948	0.581	1e-164
307184254		523	Inosine-5'-monophosphate dehydrogenase [	0.847	0.956	0.576	1e-163
350419125		572	PREDICTED: inosine-5'-monophosphate dehy	0.798	0.823	0.584	1e-162
91093403		513	PREDICTED: similar to inosine-5-monophos	0.784	0.902	0.572	1e-155

>gi\|383863705\|ref\|XP_003707320.1\| PREDICTED: inosine-5'-monophosphate dehydrogenase-like isoform 1 [Megachile rotundata]	Back alignment and taxonomy information

 Score =  597 bits (1538), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 315/511 (61%), Positives = 381/511 (74%), Gaps = 46/511 (9%)

Query: 88  EKDLSSPLTKKITLAAPLVSSPMDTVTESDMAIAMALCGGIGAAIGTREADKYRLKLLSQ 147
           E DL SPLTKKI L APLVSSPMDTVTESDMAIAMALCGGIG  I      +Y       
Sbjct: 51  EVDLLSPLTKKIMLKAPLVSSPMDTVTESDMAIAMALCGGIG-IIHHNCTPEY------- 102

Query: 148 AGVDVVILDSSQGNSIYQIEMIKYIKKEYPDMQVIGGNVVTTDQAKNLIDAGVDGLRVGS 207
                      Q N +++++  KY      D  V+  N   +D    +++   +      
Sbjct: 103 -----------QANEVHKVK--KYKHGFIRDPVVLSPNHTVSD----VMNVKAE------ 139

Query: 208 HGCHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDL-KIEKVMTNVNEIISAQAG 266
              HGF G P+T+ GK+G KLLGIVTSRD+DFLE+S N    K+E +MT +  +I+A AG
Sbjct: 140 ---HGFSGVPITDTGKVGGKLLGIVTSRDIDFLESSPNQQYTKLETIMTKLENLITATAG 196

Query: 267 ISLEEANVILEKSKKGKLPILNDKGELIALIARTDLKKSRDYPDSSKDENNQLIVGAAIG 326
           ++L+EANVILEKSKKGKLPI+N+KGEL++L+ARTDLKK+R YP++SKDEN QL+VGAAIG
Sbjct: 197 VTLQEANVILEKSKKGKLPIVNEKGELVSLMARTDLKKNRSYPNASKDENKQLLVGAAIG 256

Query: 327 TREADKNRLKLLSQAGVDVVILDSSQGNSIYQIEMIKFIKKEYPDMQVIGGNVLFGYQPR 386
           TR  DK+RL+LL  +GVDV++LDSSQGNS YQIEMIK+IK EYP++QVI GNV+   Q +
Sbjct: 257 TRHTDKHRLQLLGASGVDVIVLDSSQGNSKYQIEMIKYIKSEYPELQVIAGNVVTTMQAK 316

Query: 387 ------ATLLNFIYQIEMIKFIKKEYPDMQVIGR-NGTAVYRVAEYASRRGVPVIADGGV 439
                 A  L        I   +    ++  +GR   TAVY+VAEYA R GVPVIADGG+
Sbjct: 317 NLIEAGADALRVGMGCGSICITQ----EVMAVGRPQATAVYKVAEYARRFGVPVIADGGI 372

Query: 440 QSVGHVMKALALGASTAMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMSRKDGGA 499
           QS+GH++K L+LGAST MMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAM+RKD   
Sbjct: 373 QSIGHIIKGLSLGASTVMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMNRKDAQG 432

Query: 500 AAMDRYFHNEMDKLKVAQGVSGAIVDKGSVLRFLPYLQCGLKHGCQDIGAKSLSNLRAMM 559
           +AMDRYFHNEMDKLKVAQGVSG+IVDKG+VL+FLPYLQCG+KHGCQDIGAKS+S L++MM
Sbjct: 433 SAMDRYFHNEMDKLKVAQGVSGSIVDKGTVLKFLPYLQCGIKHGCQDIGAKSISALKSMM 492

Query: 560 YSGELKFEKRTLCAQNEGSVHGLYSYEKRLF 590
           YSGELKFE+RT  AQ EG+VH L+SYEKRLF
Sbjct: 493 YSGELKFERRTHSAQQEGNVHSLFSYEKRLF 523

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|66508366\|ref\|XP_623071.1\| PREDICTED: inosine-5'-monophosphate dehydrogenase isoform 1 [Apis mellifera] gi\|380025093\|ref\|XP_003696314.1\| PREDICTED: inosine-5'-monophosphate dehydrogenase-like isoform 1 [Apis florea]	Back alignment and taxonomy information

>gi\|350417357\|ref\|XP_003491383.1\| PREDICTED: inosine-5'-monophosphate dehydrogenase-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|332027369\|gb\|EGI67452.1\| Inosine-5'-monophosphate dehydrogenase [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|340714347\|ref\|XP_003395691.1\| PREDICTED: inosine-5'-monophosphate dehydrogenase-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|193716221\|ref\|XP_001951660.1\| PREDICTED: inosine-5'-monophosphate dehydrogenase-like isoform 1 [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|307207027\|gb\|EFN84850.1\| Inosine-5'-monophosphate dehydrogenase [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|307184254\|gb\|EFN70727.1\| Inosine-5'-monophosphate dehydrogenase [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|350419125\|ref\|XP_003492078.1\| PREDICTED: inosine-5'-monophosphate dehydrogenase-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|91093403\|ref\|XP_966518.1\| PREDICTED: similar to inosine-5-monophosphate dehydrogenase isoform 1 [Tribolium castaneum] gi\|270015409\|gb\|EFA11857.1\| hypothetical protein TcasGA2_TC005099 [Tribolium castaneum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		590
FB\|FBgn0003204		537	ras "raspberry" [Drosophila me	0.637	0.700	0.647	7.9e-157
UNIPROTKB\|P12268		514	IMPDH2 "Inosine-5'-monophospha	0.635	0.729	0.618	2.5e-147
UNIPROTKB\|Q3SWY3		514	IMPDH2 "Inosine-5'-monophospha	0.635	0.729	0.618	3.7e-146
UNIPROTKB\|A0JNA3		514	IMPDH1 "Inosine-5'-monophospha	0.635	0.729	0.629	1.1e-137
UNIPROTKB\|F1SML7		572	IMPDH1 "Inosine-5'-monophospha	0.635	0.655	0.629	2.8e-137
UNIPROTKB\|I3LRI0		528	IMPDH1 "Inosine-5'-monophospha	0.635	0.710	0.629	2.8e-137
UNIPROTKB\|E2RID1		530	IMPDH1 "Inosine-5'-monophospha	0.635	0.707	0.629	2.8e-137
ZFIN\|ZDB-GENE-030219-206		539	impdh1b "inosine 5'-phosphate	0.635	0.695	0.626	5.8e-137
UNIPROTKB\|A4D0Z6		599	IMPDH1 "Inosine-5'-monophospha	0.635	0.626	0.626	1.5e-136
UNIPROTKB\|J3KNX8		589	IMPDH1 "Inosine-5'-monophospha	0.635	0.636	0.626	1.5e-136

FB\|FBgn0003204 ras "raspberry" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1238 (440.9 bits), Expect = 7.9e-157, Sum P(2) = 7.9e-157
 Identities = 248/383 (64%), Positives = 304/383 (79%)

Query:   211 HGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKVMTNVNEIISAQAGISLE 270
             +GF G+PVTENGKLG KLLG+VTSRD+DF EN    ++ +  +MT   E+++A  GI+L 
Sbjct:   159 NGFTGYPVTENGKLGGKLLGMVTSRDIDFRENQP--EVLLADIMTT--ELVTAPNGINLP 214

Query:   271 EANVILEKSKKGKLPILNDKGELIALIARTDLKKSRDYPDSSKDENNQLIVGAAIGTREA 330
              AN ILEKSKKGKLPI+N  GEL+A+IARTDLKK+R YP++SKD N QL+VGAAIGTR  
Sbjct:   215 TANAILEKSKKGKLPIVNQAGELVAMIARTDLKKARSYPNASKDSNKQLLVGAAIGTRSE 274

Query:   331 DKNRLKLLSQAGVDVVILDSSQGNSIYQIEMIKFIKKEYPDMQVIGGNVLFGYQPRATLL 390
             DK RL LL   GVDV+ILDSSQGNS+YQ+EMIK+IK+ YP++QVIGGNV+   Q +  + 
Sbjct:   275 DKARLALLVANGVDVIILDSSQGNSVYQVEMIKYIKETYPELQVIGGNVVTRAQAKNLID 334

Query:   391 NFI--YQIEMIKFIKKEYPDMQVIG-RNGTAVYRVAEYASRRGVPVIADGGVQSVGHVMK 447
               +   ++ M         ++   G    TAVY+V+ YA + GVPVIADGG+QS+GH++K
Sbjct:   335 AGVDGLRVGMGSGSICITQEVMACGCPQATAVYQVSTYARQFGVPVIADGGIQSIGHIVK 394

Query:   448 ALALGASTAMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMSRKDGGAAAMDRYFH 507
             A+ALGAS  MMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAM R D   AAM RY+H
Sbjct:   395 AIALGASAVMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMERGDAKGAAMSRYYH 454

Query:   508 NEMDKLKVAQGVSGAIVDKGSVLRFLPYLQCGLKHGCQDIGAKSLSNLRAMMYSGELKFE 567
             NEMDK+KVAQGVSG+IVDKGSVLR+LPYL+CGL+H CQDIGA S++ LR M+Y+G+L+F 
Sbjct:   455 NEMDKMKVAQGVSGSIVDKGSVLRYLPYLECGLQHSCQDIGANSINKLRDMIYNGQLRFM 514

Query:   568 KRTLCAQNEGSVHGLYSYEKRLF 590
             KRT  AQ EG+VHGL+SYEKRLF
Sbjct:   515 KRTHSAQLEGNVHGLFSYEKRLF 537

GO:0048477 "oogenesis" evidence=TAS

GO:0003938 "IMP dehydrogenase activity" evidence=ISS;NAS

GO:0006177 "GMP biosynthetic process" evidence=NAS

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0006164 "purine nucleotide biosynthetic process" evidence=IEA

GO:0007411 "axon guidance" evidence=IMP

GO:0006911 "phagocytosis, engulfment" evidence=IMP

UNIPROTKB\|P12268 IMPDH2 "Inosine-5'-monophosphate dehydrogenase 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3SWY3 IMPDH2 "Inosine-5'-monophosphate dehydrogenase 2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|A0JNA3 IMPDH1 "Inosine-5'-monophosphate dehydrogenase 1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SML7 IMPDH1 "Inosine-5'-monophosphate dehydrogenase" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LRI0 IMPDH1 "Inosine-5'-monophosphate dehydrogenase" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RID1 IMPDH1 "Inosine-5'-monophosphate dehydrogenase" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030219-206 impdh1b "inosine 5'-phosphate dehydrogenase 1b" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|A4D0Z6 IMPDH1 "Inosine-5'-monophosphate dehydrogenase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|J3KNX8 IMPDH1 "Inosine-5'-monophosphate dehydrogenase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P12269	IMDH2_CRIGR	1, ., 1, ., 1, ., 2, 0, 5	0.5384	0.8084	0.9280	no	N/A
Q8F4Q4	IMDH_LEPIN	1, ., 1, ., 1, ., 2, 0, 5	0.4285	0.8084	0.9389	yes	N/A
Q8CMQ7	IMDH_STAES	1, ., 1, ., 1, ., 2, 0, 5	0.3466	0.7067	0.8545	yes	N/A
Q07152	IMDH_DROME	1, ., 1, ., 1, ., 2, 0, 5	0.5224	0.7474	0.8212	yes	N/A
B0UXP9	IMDH2_DANRE	1, ., 1, ., 1, ., 2, 0, 5	0.5381	0.8016	0.9202	no	N/A
E9PU28	IMDH2_RAT	1, ., 1, ., 1, ., 2, 0, 5	0.5388	0.7966	0.9143	yes	N/A
P47996	IMDH1_ARATH	1, ., 1, ., 1, ., 2, 0, 5	0.3447	0.7627	0.8946	yes	N/A
P99106	IMDH_STAAN	1, ., 1, ., 1, ., 2, 0, 5	0.3424	0.7067	0.8545	yes	N/A
Q5KP44	IMDH_CRYNJ	1, ., 1, ., 1, ., 2, 0, 5	0.4719	0.7762	0.8419	yes	N/A
Q4WHZ9	IMDH_ASPFU	1, ., 1, ., 1, ., 2, 0, 5	0.4555	0.7728	0.8351	yes	N/A
F6S675	IMDH1_XENTR	1, ., 1, ., 1, ., 2, 0, 5	0.5593	0.7864	0.9062	yes	N/A
Q2G0Y7	IMDH_STAA8	1, ., 1, ., 1, ., 2, 0, 5	0.3424	0.7067	0.8545	yes	N/A
P65167	IMDH_MYCTU	1, ., 1, ., 1, ., 2, 0, 5	0.3478	0.7915	0.8827	yes	N/A
Q9GZH3	IMDH_CAEEL	1, ., 1, ., 1, ., 2, 0, 5	0.4120	0.8118	0.8970	yes	N/A
Q9KGN8	IMDH_BACHD	1, ., 1, ., 1, ., 2, 0, 5	0.3382	0.7152	0.8701	yes	N/A
Q6GJQ7	IMDH_STAAR	1, ., 1, ., 1, ., 2, 0, 5	0.3424	0.7067	0.8545	yes	N/A
Q6GC82	IMDH_STAAS	1, ., 1, ., 1, ., 2, 0, 5	0.3424	0.7067	0.8545	yes	N/A
Q5HRX2	IMDH_STAEQ	1, ., 1, ., 1, ., 2, 0, 5	0.3466	0.7067	0.8545	yes	N/A
P65169	IMDH_STAAM	1, ., 1, ., 1, ., 2, 0, 5	0.3424	0.7067	0.8545	yes	N/A
A0JNA3	IMDH1_BOVIN	1, ., 1, ., 1, ., 2, 0, 5	0.5464	0.7966	0.9143	yes	N/A
Q6GMG5	IMDH1_DANRE	1, ., 1, ., 1, ., 2, 0, 5	0.5339	0.8186	0.8878	no	N/A
Q54QQ0	IMDH_DICDI	1, ., 1, ., 1, ., 2, 0, 5	0.4900	0.7711	0.8834	yes	N/A
P21879	IMDH_BACSU	1, ., 1, ., 1, ., 2, 0, 5	0.3474	0.7457	0.9016	yes	N/A
P65168	IMDH_MYCBO	1, ., 1, ., 1, ., 2, 0, 5	0.3478	0.7915	0.8827	yes	N/A
D3ZLZ7	IMDH1_RAT	1, ., 1, ., 1, ., 2, 0, 5	0.5426	0.7966	0.9143	yes	N/A
Q2YVL6	IMDH_STAAB	1, ., 1, ., 1, ., 2, 0, 5	0.3424	0.7067	0.8545	yes	N/A
P50094	IMDH4_YEAST	1, ., 1, ., 1, ., 2, 0, 5	0.4656	0.7728	0.8702	yes	N/A
P50096	IMDH1_MOUSE	1, ., 1, ., 1, ., 2, 0, 5	0.5426	0.7966	0.9143	yes	N/A
O67820	IMDH_AQUAE	1, ., 1, ., 1, ., 2, 0, 5	0.3380	0.7508	0.9040	yes	N/A
Q5HIQ7	IMDH_STAAC	1, ., 1, ., 1, ., 2, 0, 5	0.3424	0.7067	0.8545	yes	N/A
Q5RGV1	IMDH3_DANRE	1, ., 1, ., 1, ., 2, 0, 5	0.5464	0.7966	0.9143	yes	N/A
O14344	IMDH_SCHPO	1, ., 1, ., 1, ., 2, 0, 5	0.3989	0.7355	0.8282	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.1	0.963
4th Layer	1.1.1.205	0.946

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		590
PLN02274		505	PLN02274, PLN02274, inosine-5'-monophosphate dehyd	1e-180
PTZ00314		495	PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd	1e-178
pfam00478		467	pfam00478, IMPDH, IMP dehydrogenase / GMP reductas	1e-150
TIGR01302		450	TIGR01302, IMP_dehydrog, inosine-5'-monophosphate	1e-144
PRK05567		486	PRK05567, PRK05567, inosine 5'-monophosphate dehyd	2e-94
cd00381		325	cd00381, IMPDH, IMPDH: The catalytic domain of the	2e-86
PLN02274		505	PLN02274, PLN02274, inosine-5'-monophosphate dehyd	2e-67
PTZ00314		495	PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd	4e-66
pfam00478		467	pfam00478, IMPDH, IMP dehydrogenase / GMP reductas	1e-62
TIGR01302		450	TIGR01302, IMP_dehydrog, inosine-5'-monophosphate	8e-60
cd00381		325	cd00381, IMPDH, IMPDH: The catalytic domain of the	3e-54
PRK07107		502	PRK07107, PRK07107, inosine 5-monophosphate dehydr	1e-48
PRK05567		486	PRK05567, PRK05567, inosine 5'-monophosphate dehyd	3e-43
cd04602		114	cd04602, CBS_pair_IMPDH_2, This cd contains two ta	3e-37
PRK06843		404	PRK06843, PRK06843, inosine 5-monophosphate dehydr	3e-33
PRK07107		502	PRK07107, PRK07107, inosine 5-monophosphate dehydr	2e-25
TIGR01303		475	TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family	2e-24
cd04602		114	cd04602, CBS_pair_IMPDH_2, This cd contains two ta	4e-20
PRK07807		479	PRK07807, PRK07807, inosine 5-monophosphate dehydr	2e-19
cd04601		110	cd04601, CBS_pair_IMPDH, This cd contains two tand	2e-17
TIGR01306		321	TIGR01306, GMP_reduct_2, guanosine monophosphate r	4e-15
PRK05458		326	PRK05458, PRK05458, guanosine 5'-monophosphate oxi	1e-14
TIGR01305		343	TIGR01305, GMP_reduct_1, guanosine monophosphate r	1e-14
cd04601		110	cd04601, CBS_pair_IMPDH, This cd contains two tand	8e-14
COG0516		170	COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nu	5e-13
PRK06843		404	PRK06843, PRK06843, inosine 5-monophosphate dehydr	5e-12
PRK05096		346	PRK05096, PRK05096, guanosine 5'-monophosphate oxi	5e-12
PRK08649		368	PRK08649, PRK08649, inosine 5-monophosphate dehydr	2e-09
TIGR01303		475	TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family	3e-09
cd02205		113	cd02205, CBS_pair, The CBS domain, named after hum	1e-08
COG0516		170	COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nu	2e-08
cd04635		122	cd04635, CBS_pair_22, The CBS domain, named after	3e-08
TIGR01304		369	TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family	4e-08
cd04585		122	cd04585, CBS_pair_ACT_assoc2, This cd contains two	7e-08
COG0517		117	COG0517, COG0517, FOG: CBS domain [General functio	8e-08
PRK05458		326	PRK05458, PRK05458, guanosine 5'-monophosphate oxi	1e-07
cd04722		200	cd04722, TIM_phosphate_binding, TIM barrel protein	1e-07
cd04612		111	cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont	1e-07
cd04803		122	cd04803, CBS_pair_15, The CBS domain, named after	3e-07
cd04599		105	cd04599, CBS_pair_GGDEF_assoc2, This cd contains t	4e-07
cd04599		105	cd04599, CBS_pair_GGDEF_assoc2, This cd contains t	4e-07
cd04610		107	cd04610, CBS_pair_ParBc_assoc, This cd contains tw	5e-07
PRK06843		404	PRK06843, PRK06843, inosine 5-monophosphate dehydr	7e-07
PRK05096		346	PRK05096, PRK05096, guanosine 5'-monophosphate oxi	9e-07
TIGR01306		321	TIGR01306, GMP_reduct_2, guanosine monophosphate r	1e-06
cd04615		113	cd04615, CBS_pair_2, The CBS domain, named after h	1e-06
smart00116		49	smart00116, CBS, Domain in cystathionine beta-synt	1e-06
cd04588		110	cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c	2e-06
cd04631		125	cd04631, CBS_pair_18, The CBS domain, named after	4e-06
cd04607		113	cd04607, CBS_pair_NTP_transferase_assoc, This cd c	4e-06
cd04802		112	cd04802, CBS_pair_3, The CBS domain, named after h	4e-06
COG2524		294	COG2524, COG2524, Predicted transcriptional regula	1e-05
TIGR01305		343	TIGR01305, GMP_reduct_1, guanosine monophosphate r	2e-05
COG0517		117	COG0517, COG0517, FOG: CBS domain [General functio	2e-05
cd04612		111	cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont	2e-05
cd04801		114	cd04801, CBS_pair_M50_like, This cd contains two t	2e-05
cd04622		113	cd04622, CBS_pair_9, The CBS domain, named after h	2e-05
cd02205		113	cd02205, CBS_pair, The CBS domain, named after hum	3e-05
cd04730		236	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD	3e-05
cd04584		121	cd04584, CBS_pair_ACT_assoc, This cd contains two	4e-05
cd04585		122	cd04585, CBS_pair_ACT_assoc2, This cd contains two	5e-05
cd02809		299	cd02809, alpha_hydroxyacid_oxid_FMN, Family of hom	5e-05
pfam00571		57	pfam00571, CBS, CBS domain	6e-05
cd04633		121	cd04633, CBS_pair_20, The CBS domain, named after	6e-05
PRK14869		546	PRK14869, PRK14869, putative manganese-dependent i	9e-05
pfam01070		302	pfam01070, FMN_dh, FMN-dependent dehydrogenase	9e-05
cd04600		124	cd04600, CBS_pair_HPP_assoc, This cd contains two	9e-05
cd04584		121	cd04584, CBS_pair_ACT_assoc, This cd contains two	1e-04
COG1304		360	COG1304, idi, Isopentenyl diphosphate isomerase (B	1e-04
COG2070		336	COG2070, COG2070, Dioxygenases related to 2-nitrop	2e-04
smart00116		49	smart00116, CBS, Domain in cystathionine beta-synt	3e-04
COG3448		382	COG3448, COG3448, CBS-domain-containing membrane p	3e-04
cd04623		113	cd04623, CBS_pair_10, The CBS domain, named after	5e-04
cd04637		122	cd04637, CBS_pair_24, The CBS domain, named after	5e-04
TIGR01137		454	TIGR01137, cysta_beta, cystathionine beta-synthase	5e-04
cd04638		106	cd04638, CBS_pair_25, The CBS domain, named after	6e-04
pfam00571		57	pfam00571, CBS, CBS domain	7e-04
cd04633		121	cd04633, CBS_pair_20, The CBS domain, named after	8e-04
cd04587		113	cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd	9e-04
COG0516		170	COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nu	0.001
cd02205		113	cd02205, CBS_pair, The CBS domain, named after hum	0.001
cd04631		125	cd04631, CBS_pair_18, The CBS domain, named after	0.001
cd04584		121	cd04584, CBS_pair_ACT_assoc, This cd contains two	0.001
cd04637		122	cd04637, CBS_pair_24, The CBS domain, named after	0.001
cd04622		113	cd04622, CBS_pair_9, The CBS domain, named after h	0.002
cd04730		236	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD	0.002
cd04595		110	cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con	0.002
cd04620		115	cd04620, CBS_pair_7, The CBS domain, named after h	0.002
cd04596		108	cd04596, CBS_pair_DRTGG_assoc, This cd contains tw	0.002
pfam03060		329	pfam03060, NMO, Nitronate monooxygenase	0.003
cd04800		111	cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c	0.003
cd04800		111	cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c	0.003
cd04636		132	cd04636, CBS_pair_23, The CBS domain, named after	0.003
cd04722		200	cd04722, TIM_phosphate_binding, TIM barrel protein	0.004
cd04637		122	cd04637, CBS_pair_24, The CBS domain, named after	0.004

>gnl\|CDD\|215154 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

 Score =  518 bits (1336), Expect = e-180
 Identities = 240/520 (46%), Positives = 319/520 (61%), Gaps = 75/520 (14%)

Query: 90  DLSSPLTKKITLAAPLVSSPMDTVTESDMAIAMALCGGIGAAIGTREADKYRLKLLSQAG 149
           DLS+ L++ I L+ P VSSPMDTVTESDMAIAMA  GGIG                    
Sbjct: 42  DLSTRLSRNIPLSIPCVSSPMDTVTESDMAIAMAALGGIG-------------------- 81

Query: 150 VDVVILDSSQGNSIYQIEMIKYIKKEYPDMQVIGGNVVTTDQAKNLIDAGVDGLRVGSHG 209
               I+  +      Q  +++  K       V    V +     + +D            
Sbjct: 82  ----IVHYNNTAE-EQAAIVRKAKSRRVGF-VSDPVVKSPSSTISSLDE--------LKA 127

Query: 210 CHGFCGFPVTENGKLGEKLLGIVTSRDVDFLENSANMDLKIEKVMTNVNEIISAQAGISL 269
             GF    VTE G +G KLLG VT RD DF+ +    + K+ +VMT+ +++++A AGI L
Sbjct: 128 SRGFSSVCVTETGTMGSKLLGYVTKRDWDFVNDR---ETKLSEVMTSDDDLVTAPAGIDL 184

Query: 270 EEANVILEKSKKGKLPILNDKGELIALIARTDLKKSRDYPDSSK---DENNQLIVGAAIG 326
           EEA  +L+ SKKGKLP++N+ GEL+ L+ RTD+K+ + YP   K    ++ +L+VGAAIG
Sbjct: 185 EEAEAVLKDSKKGKLPLVNEDGELVDLVTRTDVKRVKGYPKLGKPSVGKDGKLLVGAAIG 244

Query: 327 TREADKNRLKLLSQAGVDVVILDSSQGNSIYQIEMIKFIKKEYPDMQVIGGNVLFGYQPR 386
           TRE+DK RL+ L +AGVDVV+LDSSQG+SIYQ+EMIK+IKK YP++ VIGGNV+  YQ +
Sbjct: 245 TRESDKERLEHLVKAGVDVVVLDSSQGDSIYQLEMIKYIKKTYPELDVIGGNVVTMYQAQ 304

Query: 387 ATLLNFIYQIEMIKFIKKEYPDMQV---------------IGR-NGTAVYRVAEYASRRG 430
                          I+     ++V               +GR   TAVY+VA  A++ G
Sbjct: 305 -------------NLIQAGVDGLRVGMGSGSICTTQEVCAVGRGQATAVYKVASIAAQHG 351

Query: 431 VPVIADGGVQSVGHVMKALALGASTAMMGSLLAGTSEAPGEYFFSDGVRLKKYRGMGSLE 490
           VPVIADGG+ + GH++KAL LGAST MMGS LAGT+EAPGEYF+ DGVR+KKYRGMGSLE
Sbjct: 352 VPVIADGGISNSGHIVKALTLGASTVMMGSFLAGTTEAPGEYFYQDGVRVKKYRGMGSLE 411

Query: 491 AMSRKDGGAAAMDRYFHNEMDKLKVAQGVSGAIVDKGSVLRFLPYLQCGLKHGCQDIGAK 550
           AM++        D+ +  +  KLK+AQGVSGA+ DKGSVL+F+PY    +K G QD+GA 
Sbjct: 412 AMTK------GSDQRYLGDTAKLKIAQGVSGAVADKGSVLKFVPYTMQAVKQGFQDLGAS 465

Query: 551 SLSNLRAMMYSGELKFEKRTLCAQNEGSVHGLYSYEKRLF 590
           SL +   ++ SG L+ E RT  AQ EG VHGL SYEK+ F
Sbjct: 466 SLQSAHELLRSGTLRLEVRTGAAQVEGGVHGLVSYEKKAF 505

Length = 505

>gnl\|CDD\|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain	Back alignment and domain information

>gnl\|CDD\|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|238223 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|215154 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain	Back alignment and domain information

>gnl\|CDD\|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|238223 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|239975 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>gnl\|CDD\|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|130370 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family protein	Back alignment and domain information

>gnl\|CDD\|239975 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>gnl\|CDD\|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>gnl\|CDD\|130373 TIGR01306, GMP_reduct_2, guanosine monophosphate reductase, bacterial	Back alignment and domain information

>gnl\|CDD\|235479 PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>gnl\|CDD\|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>gnl\|CDD\|223590 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|235343 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|236322 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|130370 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family protein	Back alignment and domain information

>gnl\|CDD\|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|223590 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|240006 cd04635, CBS_pair_22, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|233351 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein	Back alignment and domain information

>gnl\|CDD\|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|235479 PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>gnl\|CDD\|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>gnl\|CDD\|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239972 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>gnl\|CDD\|239972 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>gnl\|CDD\|239983 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>gnl\|CDD\|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|235343 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|130373 TIGR01306, GMP_reduct_2, guanosine monophosphate reductase, bacterial	Back alignment and domain information

>gnl\|CDD\|239988 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>gnl\|CDD\|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>gnl\|CDD\|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>gnl\|CDD\|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>gnl\|CDD\|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>gnl\|CDD\|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>gnl\|CDD\|240114 cd04801, CBS_pair_M50_like, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>gnl\|CDD\|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|240081 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>gnl\|CDD\|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|239203 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>gnl\|CDD\|201313 pfam00571, CBS, CBS domain	Back alignment and domain information

>gnl\|CDD\|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>gnl\|CDD\|216281 pfam01070, FMN_dh, FMN-dependent dehydrogenase	Back alignment and domain information

>gnl\|CDD\|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>gnl\|CDD\|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|224223 COG1304, idi, Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|224981 COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>gnl\|CDD\|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|233287 TIGR01137, cysta_beta, cystathionine beta-synthase	Back alignment and domain information

>gnl\|CDD\|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|201313 pfam00571, CBS, CBS domain	Back alignment and domain information

>gnl\|CDD\|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>gnl\|CDD\|223590 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|240081 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>gnl\|CDD\|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>gnl\|CDD\|239992 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|239969 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>gnl\|CDD\|217344 pfam03060, NMO, Nitronate monooxygenase	Back alignment and domain information

>gnl\|CDD\|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>gnl\|CDD\|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>gnl\|CDD\|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>gnl\|CDD\|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		590
KOG2550\|consensus		503		100.0
PLN02274		505	inosine-5'-monophosphate dehydrogenase	100.0
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	100.0
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	100.0
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	100.0
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	100.0
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	100.0
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	100.0
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	100.0
PF00478		352	IMPDH: IMP dehydrogenase / GMP reductase domain; I	100.0
PRK05096		346	guanosine 5'-monophosphate oxidoreductase; Provisi	100.0
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase, eu	100.0
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine m	100.0
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase, ba	100.0
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisi	100.0
PRK08649		368	inosine 5-monophosphate dehydrogenase; Validated	100.0
TIGR01304		369	IMP_DH_rel_2 IMP dehydrogenase family protein. Thi	99.92
KOG2550\|consensus		503		99.86
PF01070		356	FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR	99.84
PRK11197		381	lldD L-lactate dehydrogenase; Provisional	99.83
KOG0538\|consensus		363		99.82
PLN02493		367	probable peroxisomal (S)-2-hydroxy-acid oxidase	99.82
PLN02979		366	glycolate oxidase	99.82
cd04736		361	MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin	99.82
cd03332		383	LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin	99.81
TIGR02708		367	L_lactate_ox L-lactate oxidase. Members of this pr	99.81
PLN02535		364	glycolate oxidase	99.8
cd02922		344	FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom	99.8
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	99.79
cd02811		326	IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di	99.79
COG1304		360	idi Isopentenyl diphosphate isomerase (BS_ypgA, MT	99.77
PRK05437		352	isopentenyl pyrophosphate isomerase; Provisional	99.76
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	99.76
cd04737		351	LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d	99.76
cd02809		299	alpha_hydroxyacid_oxid_FMN Family of homologous FM	99.76
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	99.75
TIGR02151		333	IPP_isom_2 isopentenyl-diphosphate delta-isomerase	99.74
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	99.71
PLN02274		505	inosine-5'-monophosphate dehydrogenase	99.71
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	99.68
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	99.67
COG2524		294	Predicted transcriptional regulator, contains C-te	99.59
cd02808		392	GltS_FMN Glutamate synthase (GltS) FMN-binding dom	99.55
PRK14869		546	putative manganese-dependent inorganic pyrophospha	99.52
COG3448		382	CBS-domain-containing membrane protein [Signal tra	99.46
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem re	99.43
PF03060		330	NMO: Nitronate monooxygenase; InterPro: IPR004136	99.42
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein)	99.4
cd04619		114	CBS_pair_6 The CBS domain, named after human CBS,	99.38
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	99.34
PF04131		192	NanE: Putative N-acetylmannosamine-6-phosphate epi	99.34
COG2524		294	Predicted transcriptional regulator, contains C-te	99.33
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS,	99.31
cd04801		114	CBS_pair_M50_like This cd contains two tandem repe	99.31
cd04618		98	CBS_pair_5 The CBS domain, named after human CBS,	99.29
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS,	99.29
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem rep	99.29
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains tw	99.28
cd04630		114	CBS_pair_17 The CBS domain, named after human CBS,	99.27
COG4109		432	Predicted transcriptional regulator containing CBS	99.26
COG3620		187	Predicted transcriptional regulator with C-termina	99.26
PRK10892		326	D-arabinose 5-phosphate isomerase; Provisional	99.26
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two	99.25
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS,	99.25
PRK11543		321	gutQ D-arabinose 5-phosphate isomerase; Provisiona	99.24
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS,	99.24
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem r	99.24
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan	99.24
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem re	99.23
cd04626		111	CBS_pair_13 The CBS domain, named after human CBS,	99.22
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repea	99.21
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two	99.21
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS,	99.21
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS,	99.2
cd04627		123	CBS_pair_14 The CBS domain, named after human CBS,	99.2
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS,	99.2
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tand	99.2
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	99.2
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tand	99.2
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS,	99.2
cd04587		113	CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains	99.19
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains	99.19
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two	99.19
COG3448		382	CBS-domain-containing membrane protein [Signal tra	99.19
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats	99.19
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS,	99.18
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem re	99.18
cd04606		109	CBS_pair_Mg_transporter This cd contains two tande	99.18
cd04611		111	CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two	99.18
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS,	99.18
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS,	99.17
cd04604		114	CBS_pair_KpsF_GutQ_assoc This cd contains two tand	99.17
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS,	99.17
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS,	99.17
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS,	99.16
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS,	99.16
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem rep	99.16
COG3010		229	NanE Putative N-acetylmannosamine-6-phosphate epim	99.15
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem r	99.15
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains	99.14
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS,	99.14
COG0516		170	GuaB IMP dehydrogenase/GMP reductase [Nucleotide t	99.13
COG0517		117	FOG: CBS domain [General function prediction only]	99.13
cd04599		105	CBS_pair_GGDEF_assoc2 This cd contains two tandem	99.12
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS,	99.12
COG2905		610	Predicted signal-transduction protein containing c	99.12
cd04625		112	CBS_pair_12 The CBS domain, named after human CBS,	99.12
PRK15094		292	magnesium/cobalt efflux protein CorC; Provisional	99.11
cd04622		113	CBS_pair_9 The CBS domain, named after human CBS,	99.11
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem re	99.11
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS,	99.11
cd04589		111	CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains	99.1
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two t	99.1
PRK01862		574	putative voltage-gated ClC-type chloride channel C	99.1
COG2070		336	Dioxygenases related to 2-nitropropane dioxygenase	99.09
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	99.08
TIGR00400		449	mgtE Mg2+ transporter (mgtE). This family of proka	99.08
cd04594		104	CBS_pair_EriC_assoc_archaea This cd contains two t	99.08
cd04637		122	CBS_pair_24 The CBS domain, named after human CBS,	99.07
cd04802		112	CBS_pair_3 The CBS domain, named after human CBS,	99.07
PF01645		368	Glu_synthase: Conserved region in glutamate syntha	99.07
TIGR00393		268	kpsF KpsF/GutQ family protein. This model describe	99.06
cd04742		418	NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom	99.05
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem r	99.05
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS,	99.04
TIGR02814		444	pfaD_fam PfaD family protein. The protein PfaD is	99.04
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	99.02
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem rep	99.01
KOG1764\|consensus		381		99.01
TIGR01037		300	pyrD_sub1_fam dihydroorotate dehydrogenase (subfam	99.01
PLN02826		409	dihydroorotate dehydrogenase	99.01
COG3620		187	Predicted transcriptional regulator with C-termina	99.01
TIGR03520		408	GldE gliding motility-associated protein GldE. Mem	99.0
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	98.97
cd02205		113	CBS_pair The CBS domain, named after human CBS, is	98.96
cd04591		105	CBS_pair_EriC_assoc_euk_bac This cd contains two t	98.96
cd04618		98	CBS_pair_5 The CBS domain, named after human CBS,	98.95
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS,	98.95
PRK06015		201	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	98.94
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS,	98.94
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	98.93
cd04743		320	NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma	98.93
TIGR00400		449	mgtE Mg2+ transporter (mgtE). This family of proka	98.92
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem re	98.92
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem r	98.91
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS,	98.89
PLN02495		385	oxidoreductase, acting on the CH-CH group of donor	98.87
PF01081		196	Aldolase: KDPG and KHG aldolase; InterPro: IPR0008	98.87
TIGR01137		454	cysta_beta cystathionine beta-synthase. Members of	98.87
cd04727		283	pdxS PdxS is a subunit of the pyridoxal 5'-phospha	98.85
PF00571		57	CBS: CBS domain CBS domain web page. Mutations in	98.82
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	98.82
PRK07114		222	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	98.8
COG0800		211	Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca	98.8
PRK10892		326	D-arabinose 5-phosphate isomerase; Provisional	98.79
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	98.78
COG0167		310	PyrD Dihydroorotate dehydrogenase [Nucleotide tran	98.77
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	98.77
COG2905		610	Predicted signal-transduction protein containing c	98.76
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS,	98.76
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domai	98.75
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	98.75
COG0069		485	GltB Glutamate synthase domain 2 [Amino acid trans	98.75
TIGR00343		287	pyridoxal 5'-phosphate synthase, synthase subunit	98.74
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS,	98.74
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	98.73
PRK11543		321	gutQ D-arabinose 5-phosphate isomerase; Provisiona	98.72
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem rep	98.72
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem re	98.71
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS,	98.7
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tande	98.7
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	98.7
cd04619		114	CBS_pair_6 The CBS domain, named after human CBS,	98.7
cd04730		236	NPD_like 2-Nitropropane dioxygenase (NPD), one of	98.68
PRK04180		293	pyridoxal biosynthesis lyase PdxS; Provisional	98.68
PRK11750		1485	gltB glutamate synthase subunit alpha; Provisional	98.67
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains tw	98.67
PRK11573		413	hypothetical protein; Provisional	98.66
COG0517		117	FOG: CBS domain [General function prediction only]	98.65
PRK02506		310	dihydroorotate dehydrogenase 1A; Reviewed	98.65
cd04627		123	CBS_pair_14 The CBS domain, named after human CBS,	98.64
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	98.64
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem re	98.63
PF00478		352	IMPDH: IMP dehydrogenase / GMP reductase domain; I	98.62
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan	98.62
PF00571		57	CBS: CBS domain CBS domain web page. Mutations in	98.62
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS,	98.6
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS,	98.6
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tand	98.59
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	98.58
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem r	98.58
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	98.56
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two	98.55
TIGR00737		319	nifR3_yhdG putative TIM-barrel protein, nifR3 fami	98.54
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS,	98.53
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS,	98.53
PRK01862		574	putative voltage-gated ClC-type chloride channel C	98.53
cd04801		114	CBS_pair_M50_like This cd contains two tandem repe	98.53
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS,	98.52
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS,	98.52
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS,	98.51
TIGR00736		231	nifR3_rel_arch TIM-barrel protein, putative. Membe	98.51
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repea	98.51
cd04630		114	CBS_pair_17 The CBS domain, named after human CBS,	98.51
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS,	98.5
cd04599		105	CBS_pair_GGDEF_assoc2 This cd contains two tandem	98.48
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS,	98.48
TIGR03520		408	GldE gliding motility-associated protein GldE. Mem	98.48
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	98.47
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats	98.47
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS,	98.46
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem rep	98.46
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS,	98.46
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	98.46
cd04626		111	CBS_pair_13 The CBS domain, named after human CBS,	98.45
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a	98.44
cd04606		109	CBS_pair_Mg_transporter This cd contains two tande	98.44
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two	98.43
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tand	98.43
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains	98.42
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS,	98.41
TIGR00393		268	kpsF KpsF/GutQ family protein. This model describe	98.41
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	98.41
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS,	98.41
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	98.41
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two	98.4
COG1253		429	TlyC Hemolysins and related proteins containing CB	98.4
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem re	98.39
PRK15094		292	magnesium/cobalt efflux protein CorC; Provisional	98.38
PRK00208		250	thiG thiazole synthase; Reviewed	98.38
cd04587		113	CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains	98.38
cd04728		248	ThiG Thiazole synthase (ThiG) is the tetrameric en	98.37
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem r	98.37
cd04625		112	CBS_pair_12 The CBS domain, named after human CBS,	98.37
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two t	98.37
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	98.36
PRK05286		344	dihydroorotate dehydrogenase 2; Reviewed	98.35
cd04738		327	DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl	98.35
cd04604		114	CBS_pair_KpsF_GutQ_assoc This cd contains two tand	98.35
cd04741		294	DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c	98.35
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R	98.34
cd04622		113	CBS_pair_9 The CBS domain, named after human CBS,	98.34
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS,	98.33
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase, eu	98.33
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains	98.32
cd04591		105	CBS_pair_EriC_assoc_euk_bac This cd contains two t	98.32
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS,	98.32
cd04611		111	CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two	98.31
cd04637		122	CBS_pair_24 The CBS domain, named after human CBS,	98.3
COG4109		432	Predicted transcriptional regulator containing CBS	98.3
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	98.3
TIGR01036		335	pyrD_sub2 dihydroorotate dehydrogenase, subfamily	98.29
cd04589		111	CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains	98.29
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem rep	98.29
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	98.29
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	98.28
cd04594		104	CBS_pair_EriC_assoc_archaea This cd contains two t	98.28
cd04802		112	CBS_pair_3 The CBS domain, named after human CBS,	98.28
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	98.28
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem r	98.26
PF01180		295	DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP	98.26
PRK10550		312	tRNA-dihydrouridine synthase C; Provisional	98.25
PRK10415		321	tRNA-dihydrouridine synthase B; Provisional	98.24
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS,	98.24
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS,	98.24
COG0107		256	HisF Imidazoleglycerol-phosphate synthase [Amino a	98.23
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	98.23
PRK14024		241	phosphoribosyl isomerase A; Provisional	98.22
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	98.22
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	98.22
COG0516		170	GuaB IMP dehydrogenase/GMP reductase [Nucleotide t	98.2
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	98.19
cd02205		113	CBS_pair The CBS domain, named after human CBS, is	98.19
PF00218		254	IGPS: Indole-3-glycerol phosphate synthase; InterP	98.18
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	98.18
PF05690		247	ThiG: Thiazole biosynthesis protein ThiG; InterPro	98.17
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	98.17
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	98.17
cd04726		202	KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl	98.17
cd02911		233	arch_FMN Archeal FMN-binding domain. This family o	98.16
PRK14869		546	putative manganese-dependent inorganic pyrophospha	98.16
TIGR00742		318	yjbN tRNA dihydrouridine synthase A. Members of th	98.13
TIGR01137		454	cysta_beta cystathionine beta-synthase. Members of	98.12
PRK11815		333	tRNA-dihydrouridine synthase A; Provisional	98.07
KOG1764\|consensus		381		98.07
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem r	98.05
PRK07695		201	transcriptional regulator TenI; Provisional	98.05
CHL00162		267	thiG thiamin biosynthesis protein G; Validated	98.04
cd02931		382	ER_like_FMN Enoate reductase (ER)-like FMN-binding	98.03
cd02932		336	OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN	98.01
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	98.01
COG0106		241	HisA Phosphoribosylformimino-5-aminoimidazole carb	98.0
PRK05096		346	guanosine 5'-monophosphate oxidoreductase; Provisi	98.0
cd04597		113	CBS_pair_DRTGG_assoc2 This cd contains two tandem	98.0
PLN02591		250	tryptophan synthase	97.99
PRK13957		247	indole-3-glycerol-phosphate synthase; Provisional	97.98
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.98
CHL00200		263	trpA tryptophan synthase alpha subunit; Provisiona	97.96
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tande	97.92
cd04733		338	OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN	97.91
cd04735		353	OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN	97.89
PRK13523		337	NADPH dehydrogenase NamA; Provisional	97.89
cd04734		343	OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN	97.89
cd00564		196	TMP_TenI Thiamine monophosphate synthase (TMP synt	97.88
PRK04128		228	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.87
TIGR00734		221	hisAF_rel hisA/hisF family protein. This alignment	97.86
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	97.86
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domai	97.85
TIGR01919		243	hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy	97.83
PRK13111		258	trpA tryptophan synthase subunit alpha; Provisiona	97.82
cd02933		338	OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind	97.82
PRK07455		187	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	97.81
COG0134		254	TrpC Indole-3-glycerol phosphate synthase [Amino a	97.8
COG0159		265	TrpA Tryptophan synthase alpha chain [Amino acid t	97.8
COG2022		262	ThiG Uncharacterized enzyme of thiazole biosynthes	97.8
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	97.77
PLN02460		338	indole-3-glycerol-phosphate synthase	97.76
PRK11840		326	bifunctional sulfur carrier protein/thiazole synth	97.75
COG0042		323	tRNA-dihydrouridine synthase [Translation, ribosom	97.74
cd00956		211	Transaldolase_FSA Transaldolase-like fructose-6-ph	97.74
PRK04302		223	triosephosphate isomerase; Provisional	97.74
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	97.73
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R	97.73
PRK07455		187	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	97.71
cd04597		113	CBS_pair_DRTGG_assoc2 This cd contains two tandem	97.71
PLN02446		262	(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy	97.71
cd04724		242	Tryptophan_synthase_alpha Ttryptophan synthase (TR	97.7
PRK00043		212	thiE thiamine-phosphate pyrophosphorylase; Reviewe	97.7
PRK13802		695	bifunctional indole-3-glycerol phosphate synthase/	97.7
PF00290		259	Trp_syntA: Tryptophan synthase alpha chain; InterP	97.68
PRK05848		273	nicotinate-nucleotide pyrophosphorylase; Provision	97.66
KOG0474\|consensus		762		97.62
COG4535		293	CorC Putative Mg2+ and Co2+ transporter CorC [Inor	97.62
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.61
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	97.59
PLN02334		229	ribulose-phosphate 3-epimerase	97.57
PRK13125		244	trpA tryptophan synthase subunit alpha; Provisiona	97.55
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	97.54
cd02930		353	DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin	97.52
PRK08883		220	ribulose-phosphate 3-epimerase; Provisional	97.52
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	97.51
PRK07028		430	bifunctional hexulose-6-phosphate synthase/ribonuc	97.51
smart00116		49	CBS Domain in cystathionine beta-synthase and othe	97.51
COG1902		363	NemA NADH:flavin oxidoreductases, Old Yellow Enzym	97.51
COG4536		423	CorB Putative Mg2+ and Co2+ transporter CorB [Inor	97.49
cd04747		361	OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN	97.49
KOG2335\|consensus		358		97.48
cd00958		235	DhnA Class I fructose-1,6-bisphosphate (FBP) aldol	97.47
PRK00507		221	deoxyribose-phosphate aldolase; Provisional	97.44
TIGR00693		196	thiE thiamine-phosphate pyrophosphorylase. This mo	97.44
PRK09427		454	bifunctional indole-3-glycerol phosphate synthase/	97.43
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	97.42
PF01207		309	Dus: Dihydrouridine synthase (Dus); InterPro: IPR0	97.42
TIGR02129		253	hisA_euk phosphoribosylformimino-5-aminoimidazole	97.4
PRK10605		362	N-ethylmaleimide reductase; Provisional	97.39
PF04481		242	DUF561: Protein of unknown function (DUF561); Inte	97.39
PRK04169		232	geranylgeranylglyceryl phosphate synthase-like pro	97.39
COG1253		429	TlyC Hemolysins and related proteins containing CB	97.38
PF01884		230	PcrB: PcrB family; InterPro: IPR008205 This entry	97.38
cd02929		370	TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH)	97.35
PLN02617		538	imidazole glycerol phosphate synthase hisHF	97.34
PF00724		341	Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox	97.34
PRK07226		267	fructose-bisphosphate aldolase; Provisional	97.33
TIGR01768		223	GGGP-family geranylgeranylglyceryl phosphate synth	97.32
PRK02615		347	thiamine-phosphate pyrophosphorylase; Provisional	97.31
TIGR01163		210	rpe ribulose-phosphate 3-epimerase. This family co	97.3
cd00959		203	DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of	97.3
cd01573		272	modD_like ModD; Quinolinate phosphoribosyl transfe	97.28
PRK11573		413	hypothetical protein; Provisional	97.28
TIGR00126		211	deoC deoxyribose-phosphate aldolase. Deoxyribose-p	97.27
TIGR01769		205	GGGP geranylgeranylglyceryl phosphate synthase. Th	97.26
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	97.24
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	97.23
smart00116		49	CBS Domain in cystathionine beta-synthase and othe	97.22
PF02581		180	TMP-TENI: Thiamine monophosphate synthase/TENI; In	97.16
COG1646		240	Predicted phosphate-binding enzymes, TIM-barrel fo	97.15
PF01081		196	Aldolase: KDPG and KHG aldolase; InterPro: IPR0008	97.11
PRK07428		288	nicotinate-nucleotide pyrophosphorylase; Provision	97.08
COG0352		211	ThiE Thiamine monophosphate synthase [Coenzyme met	97.05
PRK07114		222	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	97.04
PRK06512		221	thiamine-phosphate pyrophosphorylase; Provisional	96.98
PRK08385		278	nicotinate-nucleotide pyrophosphorylase; Provision	96.97
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	96.94
cd01572		268	QPRTase Quinolinate phosphoribosyl transferase (QA	96.93
cd00429		211	RPE Ribulose-5-phosphate 3-epimerase (RPE). This e	96.92
PRK05742		277	nicotinate-nucleotide pyrophosphorylase; Provision	96.91
TIGR01949		258	AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep	96.89
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	96.88
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase, ba	96.88
PF01791		236	DeoC: DeoC/LacD family aldolase; InterPro: IPR0029	96.87
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	96.87
cd01568		269	QPRTase_NadC Quinolinate phosphoribosyl transferas	96.87
COG0214		296	SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta	96.86
KOG0475\|consensus		696		96.85
TIGR00078		265	nadC nicotinate-nucleotide pyrophosphorylase. Syno	96.85
PRK06015		201	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	96.82
PRK08091		228	ribulose-phosphate 3-epimerase; Validated	96.78
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	96.75
KOG1436\|consensus		398		96.73
PRK05581		220	ribulose-phosphate 3-epimerase; Validated	96.71
PLN02411		391	12-oxophytodienoate reductase	96.71
COG0274		228	DeoC Deoxyribose-phosphate aldolase [Nucleotide tr	96.7
PTZ00170		228	D-ribulose-5-phosphate 3-epimerase; Provisional	96.67
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	96.65
PRK08745		223	ribulose-phosphate 3-epimerase; Provisional	96.64
TIGR01334		277	modD putative molybdenum utilization protein ModD.	96.64
PRK08072		277	nicotinate-nucleotide pyrophosphorylase; Provision	96.62
cd00405		203	PRAI Phosphoribosylanthranilate isomerase (PRAI) c	96.61
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	96.61
PRK08005		210	epimerase; Validated	96.59
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.57
TIGR00343		287	pyridoxal 5'-phosphate synthase, synthase subunit	96.54
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.53
cd04726		202	KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl	96.5
PRK14024		241	phosphoribosyl isomerase A; Provisional	96.47
PRK03512		211	thiamine-phosphate pyrophosphorylase; Provisional	96.44
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	96.4
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	96.38
PRK13307		391	bifunctional formaldehyde-activating enzyme/3-hexu	96.33
PRK07896		289	nicotinate-nucleotide pyrophosphorylase; Provision	96.32
PRK14057		254	epimerase; Provisional	96.32
PRK04180		293	pyridoxal biosynthesis lyase PdxS; Provisional	96.31
PRK09722		229	allulose-6-phosphate 3-epimerase; Provisional	96.31
PRK06559		290	nicotinate-nucleotide pyrophosphorylase; Provision	96.3
TIGR01304		369	IMP_DH_rel_2 IMP dehydrogenase family protein. Thi	96.25
PRK06096		284	molybdenum transport protein ModD; Provisional	96.24
COG0269		217	SgbH 3-hexulose-6-phosphate synthase and related p	96.21
PRK08649		368	inosine 5-monophosphate dehydrogenase; Validated	96.19
PRK09016		296	quinolinate phosphoribosyltransferase; Validated	96.18
COG2070		336	Dioxygenases related to 2-nitropropane dioxygenase	96.17
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisi	96.12
PF01729		169	QRPTase_C: Quinolinate phosphoribosyl transferase,	96.11
PF04131		192	NanE: Putative N-acetylmannosamine-6-phosphate epi	96.08
PRK04128		228	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.04
PRK08999		312	hypothetical protein; Provisional	96.04
PRK05283		257	deoxyribose-phosphate aldolase; Provisional	96.01
COG0036		220	Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate	96.01
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	96.0
PRK06543		281	nicotinate-nucleotide pyrophosphorylase; Provision	95.97
KOG1606\|consensus		296		95.93
PLN02898		502	HMP-P kinase/thiamin-monophosphate pyrophosphoryla	95.91
PRK06806		281	fructose-bisphosphate aldolase; Provisional	95.88
PRK06106		281	nicotinate-nucleotide pyrophosphorylase; Provision	95.87
cd04727		283	pdxS PdxS is a subunit of the pyridoxal 5'-phospha	95.86
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	95.85
PF00834		201	Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam	95.85
TIGR01859		282	fruc_bis_ald_ fructose-1,6-bisphosphate aldolase,	95.84
cd02812		219	PcrB_like PcrB_like proteins. One member of this f	95.83
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	95.81
PF03437		254	BtpA: BtpA family; InterPro: IPR005137 Photosystem	95.79
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	95.77
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	95.76
TIGR00875		213	fsa_talC_mipB fructose-6-phosphate aldolase, TalC/	95.75
KOG3111\|consensus		224		95.74
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	95.74
PRK12290		437	thiE thiamine-phosphate pyrophosphorylase; Reviewe	95.68
PLN02716		308	nicotinate-nucleotide diphosphorylase (carboxylati	95.67
PRK01362		214	putative translaldolase; Provisional	95.64
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	95.63
PRK06978		294	nicotinate-nucleotide pyrophosphorylase; Provision	95.62
COG4535		293	CorC Putative Mg2+ and Co2+ transporter CorC [Inor	95.58
KOG0474\|consensus		762		95.51
cd04730		236	NPD_like 2-Nitropropane dioxygenase (NPD), one of	95.49
cd04743		320	NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma	95.41
PRK08227		264	autoinducer 2 aldolase; Validated	95.39
TIGR01769		205	GGGP geranylgeranylglyceryl phosphate synthase. Th	95.3
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	95.27
PRK09250		348	fructose-bisphosphate aldolase; Provisional	95.23
PLN02623		581	pyruvate kinase	95.23
TIGR02129		253	hisA_euk phosphoribosylformimino-5-aminoimidazole	95.21
PRK13306		216	ulaD 3-keto-L-gulonate-6-phosphate decarboxylase;	95.2
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	95.17
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	95.03
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	95.01
COG0269		217	SgbH 3-hexulose-6-phosphate synthase and related p	94.98
PRK12653		220	fructose-6-phosphate aldolase; Reviewed	94.98
PRK12656		222	fructose-6-phosphate aldolase; Reviewed	94.82
COG0352		211	ThiE Thiamine monophosphate synthase [Coenzyme met	94.81
PRK06852		304	aldolase; Validated	94.79
TIGR00259		257	thylakoid_BtpA membrane complex biogenesis protein	94.67
PRK07315		293	fructose-bisphosphate aldolase; Provisional	94.61
COG1646		240	Predicted phosphate-binding enzymes, TIM-barrel fo	94.58
PRK00043		212	thiE thiamine-phosphate pyrophosphorylase; Reviewe	94.57
TIGR01768		223	GGGP-family geranylgeranylglyceryl phosphate synth	94.43
TIGR00736		231	nifR3_rel_arch TIM-barrel protein, putative. Membe	94.29
PRK06806		281	fructose-bisphosphate aldolase; Provisional	94.24
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	94.22
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	94.21
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	94.14
TIGR00693		196	thiE thiamine-phosphate pyrophosphorylase. This mo	94.14
PRK13957		247	indole-3-glycerol-phosphate synthase; Provisional	94.04
COG1830		265	FbaB DhnA-type fructose-1,6-bisphosphate aldolase	93.96
PRK06801		286	hypothetical protein; Provisional	93.87
PRK12655		220	fructose-6-phosphate aldolase; Reviewed	93.76
COG3010		229	NanE Putative N-acetylmannosamine-6-phosphate epim	93.65
TIGR01163		210	rpe ribulose-phosphate 3-epimerase. This family co	93.61
PRK04169		232	geranylgeranylglyceryl phosphate synthase-like pro	93.61
PRK12376		236	putative translaldolase; Provisional	93.6
PRK12858		340	tagatose 1,6-diphosphate aldolase; Reviewed	93.6
COG4536		423	CorB Putative Mg2+ and Co2+ transporter CorB [Inor	93.59

>KOG2550\|consensus	Back alignment and domain information

Probab=100.00  E-value=1.6e-88  Score=675.87  Aligned_cols=465  Identities=58%  Similarity=0.900  Sum_probs=447.7

Q ss_pred             EeccccccccCCCCCCC-CccCCcccccccccccCCceeeCCCCCCchHHHHHHHHHcCCeeEecCCCcchHHHHHHHHH
Q psy1056          69 VTSRDVDFLENSANMDL-KIEKDLSSPLTKKITLAAPLVSSPMDTVTESDMAIAMALCGGIGAAIGTREADKYRLKLLSQ  147 (590)
Q Consensus        69 vT~~Did~l~~~~~~~~-~~~~~~~~~l~~~~~~~~piv~~~~~tv~~~~~~~~~~~~G~~gi~~~~~~d~~~~~~~l~~  147 (590)
                      +|+.  ||+.+|.+.++ .+++++++++++.+.++.|++++|||||++..|+++|++.||+|+||.|.+           
T Consensus        30 Ltyn--DfliLPg~idF~s~eVsL~t~ltr~itl~tPlvsSpMDTVtes~MAiaMAl~ggIg~IHhNct-----------   96 (503)
T KOG2550|consen   30 LTYN--DFLILPGFIDFASDEVSLQTKLTRNITLNTPLVSSPMDTVTESEMAIAMALLGGIGFIHHNCT-----------   96 (503)
T ss_pred             cccc--ceeecccccccccccceeehhhhhcccccCceeccCCcccchhHHHHHHHhcCCceeeecCCC-----------
Confidence            8999  99999999999 789999999999999999999999999999999999999999999999998           


Q ss_pred             cCCcEEEEcCCCCchHHHHHHHHHhhhcCCCcccccccccc--hHHHHHHHHHhccccccccccccCceeeEEeeCCCCC
Q psy1056         148 AGVDVVILDSSQGNSIYQIEMIKYIKKEYPDMQVIGGNVVT--TDQAKNLIDAGVDGLRVGSHGCHGFCGFPVTENGKLG  225 (590)
Q Consensus       148 ~~~dvv~~~~~~~~~~~~~~~v~~vk~~~~~~~im~~~~~~--~~~~~~a~~~m~~~~~v~~~~~~~~~~~pVvd~~~~~  225 (590)
                                    .+.|..+++++|. +... ++..|++.  +.++.++++..         ..+++..+||++++.-+
T Consensus        97 --------------pe~QA~~v~~vK~-~~~g-~~~~p~v~sp~~tvg~v~~~k---------~~~gF~g~pvTe~g~~~  151 (503)
T KOG2550|consen   97 --------------PEDQADMVRRVKN-YENG-FINNPIVISPTTTVGEVKEAK---------EKHGFSGIPVTEDGKRG  151 (503)
T ss_pred             --------------HHHHHHHHHHHHH-hhcc-cccCCcccCCcccchhhhhhc---------ccccccccccccCCccc
Confidence                          8899999999998 8776 77777776  89999999999         99999999999987677


Q ss_pred             CeEEEEEecchhhccccccccccchhhccccCCCeeEEcCCCCHHHHHHHHHhcCCCcceEEcCCCceEEEEeecccccc
Q psy1056         226 EKLLGIVTSRDVDFLENSANMDLKIEKVMTNVNEIISAQAGISLEEANVILEKSKKGKLPILNDKGELIALIARTDLKKS  305 (590)
Q Consensus       226 ~~lvGivt~~Dl~~~~~~~~~~~~V~~im~~~~~~~tv~~~~~l~ea~~~m~~~~~~~lpVvd~~g~l~Giit~~dll~~  305 (590)
                      .||+|+||.+|+.|....   ...+.++|++  ++++.+.+.+++++.+++.+++...|||||++|+++.+++++||.+.
T Consensus       152 ~KLvG~vtsrdi~f~~~~---~~~~~~vmt~--~~~~~~~gi~l~~~neiL~~~kkGkl~iv~~~gelva~~~rtDl~k~  226 (503)
T KOG2550|consen  152 SKLVGIITSRDIQFLEDN---SLLVSDVMTK--NPVTGAQGITLKEANEILKKIKKGKLPVVDDKGELVAMLSRTDLMKN  226 (503)
T ss_pred             ceeEEEEehhhhhhhhcc---cchhhhhccc--ccccccccccHHHHHHHHHhhhcCCcceeccCCceeeeeehhhhhhh
Confidence            899999999999988443   5889999999  78999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCcccCCceEEeEeeccchhHHHHHHHHHHcCCcEEEEecCCCchhhHHHHHHHHHHhCCCceEEeccccCcHHH
Q psy1056         306 RDYPDSSKDENNQLIVGAAIGTREADKNRLKLLSQAGVDVVILDSSQGNSIYQIEMIKFIKKEYPDMQVIGGNVLFGYQP  385 (590)
Q Consensus       306 ~~~~~~~~d~~~~l~v~a~i~~~~~~~e~~~~li~~gad~i~V~~~~G~~~~~l~~i~~i~~~~~~vpvi~g~v~s~~~a  385 (590)
                      ..|+.+.++..++++.+++++.+++..++++.+.++|+|++++|++||++.+.+++++++|+.||+.+||.|||.|.+.|
T Consensus       227 ~~yPlask~~~kqll~gAaiGTre~dK~rl~ll~~aGvdvviLDSSqGnS~~qiemik~iK~~yP~l~ViaGNVVT~~qa  306 (503)
T KOG2550|consen  227 RDYPLASKDSTKQLLCGAAIGTRDDDKERLDLLVQAGVDVVILDSSQGNSIYQLEMIKYIKETYPDLQIIAGNVVTKEQA  306 (503)
T ss_pred             cCCCccccCcccceeeeeccccccchhHHHHHhhhcCCcEEEEecCCCcchhHHHHHHHHHhhCCCceeeccceeeHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHCCCCEEEE-----cccccccCCCcccccc-chhHHHHHHHHHhcCCCcEEecCCCCCHHHHHHHHHcCCCEEEEC
Q psy1056         386 RATLLNFIYQIEM-----IKFIKKEYPDMQVIGR-NGTAVYRVAEYASRRGVPVIADGGVQSVGHVMKALALGASTAMMG  459 (590)
Q Consensus       386 ~~l~~~Gvd~i~v-----~~~~~~~~~~~~~~g~-~~~~l~~~~~~~~~~~v~iia~GGi~~~~di~kalalGA~~v~~g  459 (590)
                      +.|+++|||++.|     |+|+|+.   +.++|+ +.++++.+++++.+.++|+||||||++.++++|||+|||++||||
T Consensus       307 ~nLI~aGaDgLrVGMGsGSiCiTqe---vma~GrpQ~TAVy~va~~A~q~gvpviADGGiq~~Ghi~KAl~lGAstVMmG  383 (503)
T KOG2550|consen  307 ANLIAAGADGLRVGMGSGSICITQK---VMACGRPQGTAVYKVAEFANQFGVPCIADGGIQNVGHVVKALGLGASTVMMG  383 (503)
T ss_pred             HHHHHccCceeEeccccCceeeece---eeeccCCcccchhhHHHHHHhcCCceeecCCcCccchhHhhhhcCchhheec
Confidence            9999999999999     9999999   999999 999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCCCceEeecCeeeeeeeccccHHHHhcccCCCcccchhhhccccceeecccceeEEeeCCchhchHHHHHhh
Q psy1056         460 SLLAGTSEAPGEYFFSDGVRLKKYRGMGSLEAMSRKDGGAAAMDRYFHNEMDKLKVAQGVSGAIVDKGSVLRFLPYLQCG  539 (590)
Q Consensus       460 ~~l~~~~es~~~~~~~~g~~~k~~~g~~s~~a~~~~~~~~~~~~~~~~~~~~~~~~~eg~~~~~~~~~~~~~~~~~~~~~  539 (590)
                      .+|++++||||++++.||+++|.||||||+.||.+      ++..|||.+.++.+++||+++.+++||++.++|+++..+
T Consensus       384 ~lLAgtTEapGeyf~~~g~rlKkyrGMGSl~AM~~------~s~~rY~~e~dkvkiAQGVsg~v~dKGsv~kfipyl~~g  457 (503)
T KOG2550|consen  384 GLLAGTTEAPGEYFFRDGVRLKKYRGMGSLDAMES------SSQKRYFSEVDKVKIAQGVSGSVQDKGSVQKFIPYLLAG  457 (503)
T ss_pred             ceeeeeeccCcceeeecCeeehhccCcchHHHHhh------hhhhccccccceEeeccCcEEEeccCcchhhhHHHHHHH
Confidence            99999999999999999999999999999999985      588899999999999999999999999999999999999


Q ss_pred             hhhhCcccCcCcHHHHHHhhccCceEEEEEecCccccCCCCccccc
Q psy1056         540 LKHGCQDIGAKSLSNLRAMMYSGELKFEKRTLCAQNEGSVHGLYSY  585 (590)
Q Consensus       540 l~~~m~~~G~~~i~~l~~~~~~~~~~~~~~~~~~~~e~~~h~~~~~  585 (590)
                      ||++|+++||+++.+||+++++|+++|+.+|.++|.||++|+++||
T Consensus       458 iqh~cqdiGa~sL~~l~~~~~~~~vrfe~rt~~Aq~Eggvh~l~Sy  503 (503)
T KOG2550|consen  458 IQHSCQDIGARSLKELREMMYSGEVRFEKRTMSAQIEGGVHGLHSY  503 (503)
T ss_pred             HhhhhhhhhHHHHHHHHHHhhcceEEEEeccccceeccCccCCCCC
Confidence            9999999999999999999999999999999999999999999998

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase	Back alignment and domain information

>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial	Back alignment and domain information

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>PRK08649 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein	Back alignment and domain information

>KOG2550\|consensus	Back alignment and domain information

>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related	Back alignment and domain information

>PRK11197 lldD L-lactate dehydrogenase; Provisional	Back alignment and domain information

>KOG0538\|consensus	Back alignment and domain information

>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase	Back alignment and domain information

>PLN02979 glycolate oxidase	Back alignment and domain information

>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain	Back alignment and domain information

>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain	Back alignment and domain information

>TIGR02708 L_lactate_ox L-lactate oxidase	Back alignment and domain information

>PLN02535 glycolate oxidase	Back alignment and domain information

>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain	Back alignment and domain information

>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK05437 isopentenyl pyrophosphate isomerase; Provisional	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain	Back alignment and domain information

>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain	Back alignment and domain information

>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism	Back alignment and domain information

>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1	Back alignment and domain information

>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene []	Back alignment and domain information

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]	Back alignment and domain information

>PRK10892 D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea	Back alignment and domain information

>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG0516 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG0517 FOG: CBS domain [General function prediction only]	Back alignment and domain information

>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]	Back alignment and domain information

>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK15094 magnesium/cobalt efflux protein CorC; Provisional	Back alignment and domain information

>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only]	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>TIGR00400 mgtE Mg2+ transporter (mgtE)	Back alignment and domain information

>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea	Back alignment and domain information

>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots []	Back alignment and domain information

>TIGR00393 kpsF KpsF/GutQ family protein	Back alignment and domain information

>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD	Back alignment and domain information

>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR02814 pfaD_fam PfaD family protein	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>KOG1764\|consensus	Back alignment and domain information

>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein	Back alignment and domain information

>PLN02826 dihydroorotate dehydrogenase	Back alignment and domain information

>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]	Back alignment and domain information

>TIGR03520 GldE gliding motility-associated protein GldE	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS)	Back alignment and domain information

>TIGR00400 mgtE Mg2+ transporter (mgtE)	Back alignment and domain information

>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism	Back alignment and domain information

>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PLN02495 oxidoreductase, acting on the CH-CH group of donors	Back alignment and domain information

>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4	Back alignment and domain information

>TIGR01137 cysta_beta cystathionine beta-synthase	Back alignment and domain information

>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa	Back alignment and domain information

>PF00571 CBS: CBS domain CBS domain web page	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK10892 D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]	Back alignment and domain information

>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1	Back alignment and domain information

>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional	Back alignment and domain information

>PRK11750 gltB glutamate synthase subunit alpha; Provisional	Back alignment and domain information

>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>PRK11573 hypothetical protein; Provisional	Back alignment and domain information

>COG0517 FOG: CBS domain [General function prediction only]	Back alignment and domain information

>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed	Back alignment and domain information

>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase	Back alignment and domain information

>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>PF00571 CBS: CBS domain CBS domain web page	Back alignment and domain information

>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea	Back alignment and domain information

>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family	Back alignment and domain information

>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative	Back alignment and domain information

>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR03520 GldE gliding motility-associated protein GldE	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR00393 kpsF KpsF/GutQ family protein	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only]	Back alignment and domain information

>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>PRK15094 magnesium/cobalt efflux protein CorC; Provisional	Back alignment and domain information

>PRK00208 thiG thiazole synthase; Reviewed	Back alignment and domain information

>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism	Back alignment and domain information

>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK05286 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2	Back alignment and domain information

>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain	Back alignment and domain information

>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed	Back alignment and domain information

>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2	Back alignment and domain information

>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea	Back alignment and domain information

>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway	Back alignment and domain information

>PRK10550 tRNA-dihydrouridine synthase C; Provisional	Back alignment and domain information

>PRK10415 tRNA-dihydrouridine synthase B; Provisional	Back alignment and domain information

>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>COG0516 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS)	Back alignment and domain information

>cd02911 arch_FMN Archeal FMN-binding domain	Back alignment and domain information

>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>TIGR00742 yjbN tRNA dihydrouridine synthase A	Back alignment and domain information

>TIGR01137 cysta_beta cystathionine beta-synthase	Back alignment and domain information

>PRK11815 tRNA-dihydrouridine synthase A; Provisional	Back alignment and domain information

>KOG1764\|consensus	Back alignment and domain information

>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>PRK07695 transcriptional regulator TenI; Provisional	Back alignment and domain information

>CHL00162 thiG thiamin biosynthesis protein G; Validated	Back alignment and domain information

>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain	Back alignment and domain information

>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>PRK13957 indole-3-glycerol-phosphate synthase; Provisional	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>CHL00200 trpA tryptophan synthase alpha subunit; Provisional	Back alignment and domain information

>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2	Back alignment and domain information

>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4	Back alignment and domain information

>PRK13523 NADPH dehydrogenase NamA; Provisional	Back alignment and domain information

>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3	Back alignment and domain information

>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI	Back alignment and domain information

>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>TIGR00734 hisAF_rel hisA/hisF family protein	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase	Back alignment and domain information

>PRK13111 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism]	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>PLN02460 indole-3-glycerol-phosphate synthase	Back alignment and domain information

>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional	Back alignment and domain information

>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases	Back alignment and domain information

>PRK04302 triosephosphate isomerase; Provisional	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed	Back alignment and domain information

>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	Back alignment and domain information

>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA)	Back alignment and domain information

>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional	Back alignment and domain information

>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4	Back alignment and domain information

>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>KOG0474\|consensus	Back alignment and domain information

>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PLN02334 ribulose-phosphate 3-epimerase	Back alignment and domain information

>PRK13125 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain	Back alignment and domain information

>PRK08883 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated	Back alignment and domain information

>smart00116 CBS Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]	Back alignment and domain information

>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5	Back alignment and domain information

>KOG2335\|consensus	Back alignment and domain information

>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea	Back alignment and domain information

>PRK00507 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>TIGR00693 thiE thiamine-phosphate pyrophosphorylase	Back alignment and domain information

>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA	Back alignment and domain information

>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type	Back alignment and domain information

>PRK10605 N-ethylmaleimide reductase; Provisional	Back alignment and domain information

>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae	Back alignment and domain information

>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed	Back alignment and domain information

>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only]	Back alignment and domain information

>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P)	Back alignment and domain information

>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside []	Back alignment and domain information

>PRK07226 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein	Back alignment and domain information

>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>TIGR01163 rpe ribulose-phosphate 3-epimerase	Back alignment and domain information

>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family	Back alignment and domain information

>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport	Back alignment and domain information

>PRK11573 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00126 deoC deoxyribose-phosphate aldolase	Back alignment and domain information

>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>smart00116 CBS Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2	Back alignment and domain information

>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only]	Back alignment and domain information

>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4	Back alignment and domain information

>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism]	Back alignment and domain information

>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes	Back alignment and domain information

>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE)	Back alignment and domain information

>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial	Back alignment and domain information

>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes	Back alignment and domain information

>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>KOG0475\|consensus	Back alignment and domain information

>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase	Back alignment and domain information

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK08091 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>KOG1436\|consensus	Back alignment and domain information

>PRK05581 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>PLN02411 12-oxophytodienoate reductase	Back alignment and domain information

>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism]	Back alignment and domain information

>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PRK08745 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>TIGR01334 modD putative molybdenum utilization protein ModD	Back alignment and domain information

>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP)	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>PRK08005 epimerase; Validated	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS)	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional	Back alignment and domain information

>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK14057 epimerase; Provisional	Back alignment and domain information

>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional	Back alignment and domain information

>PRK09722 allulose-6-phosphate 3-epimerase; Provisional	Back alignment and domain information

>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein	Back alignment and domain information

>PRK06096 molybdenum transport protein ModD; Provisional	Back alignment and domain information

>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK08649 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK09016 quinolinate phosphoribosyltransferase; Validated	Back alignment and domain information

>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only]	Back alignment and domain information

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2	Back alignment and domain information

>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene []	Back alignment and domain information

>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK08999 hypothetical protein; Provisional	Back alignment and domain information

>PRK05283 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>KOG1606\|consensus	Back alignment and domain information

>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase	Back alignment and domain information

>PRK06806 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5	Back alignment and domain information

>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist	Back alignment and domain information

>cd02812 PcrB_like PcrB_like proteins	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family	Back alignment and domain information

>KOG3111\|consensus	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating)	Back alignment and domain information

>PRK01362 putative translaldolase; Provisional	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0474\|consensus	Back alignment and domain information

>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS)	Back alignment and domain information

>PRK08227 autoinducer 2 aldolase; Validated	Back alignment and domain information

>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09250 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PLN02623 pyruvate kinase	Back alignment and domain information

>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type	Back alignment and domain information

>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK12653 fructose-6-phosphate aldolase; Reviewed	Back alignment and domain information

>PRK12656 fructose-6-phosphate aldolase; Reviewed	Back alignment and domain information

>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism]	Back alignment and domain information

>PRK06852 aldolase; Validated	Back alignment and domain information

>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family	Back alignment and domain information

>PRK07315 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only]	Back alignment and domain information

>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein	Back alignment and domain information

>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative	Back alignment and domain information

>PRK06806 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>TIGR00693 thiE thiamine-phosphate pyrophosphorylase	Back alignment and domain information

>PRK13957 indole-3-glycerol-phosphate synthase; Provisional	Back alignment and domain information

>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK06801 hypothetical protein; Provisional	Back alignment and domain information

>PRK12655 fructose-6-phosphate aldolase; Reviewed	Back alignment and domain information

>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01163 rpe ribulose-phosphate 3-epimerase	Back alignment and domain information

>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed	Back alignment and domain information

>PRK12376 putative translaldolase; Provisional	Back alignment and domain information

>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed	Back alignment and domain information

>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		590
1b3o_A		514	Ternary Complex Of Human Type-Ii Inosine Monophosph		1e-145
1jr1_A		514	Crystal Structure Of Inosine Monophosphate Dehydrog		1e-144
1jcn_A		514	Binary Complex Of Human Type-I Inosine Monophosphat		1e-144
4af0_B		556	Crystal Structure Of Cryptococcal Inosine Monophosp		1e-114
4af0_A		556	Crystal Structure Of Cryptococcal Inosine Monophosp		1e-113
3tsb_A		511	Crystal Structure Of Inosine-5'-Monophosphate Dehyd		3e-56
1vrd_A		494	Crystal Structure Of Inosine-5'-Monophosphate Dehyd		3e-56
4fxs_A		496	Inosine 5'-Monophosphate Dehydrogenase From Vibrio		1e-51
3usb_A		511	Crystal Structure Of Bacillus Anthracis Inosine Mon		3e-50
2cu0_A		486	Crystal Structure Of Inosine-5'-Monophosphate Dehyd		1e-48
3zfh_A		510	Crystal Structure Of Pseudomonas Aeruginosa Inosine		4e-48
4avf_A		490	Crystal Structure Of Pseudomonas Aeruginosa Inosine		5e-48
1zfj_A		491	Inosine Monophosphate Dehydrogenase (Impdh; Ec 1.1.		1e-43
4fez_A		388	Inosine 5'-Monophosphate Dehydrogenase From Vibrio		1e-37
4fo4_A		366	Inosine 5'-Monophosphate Dehydrogenase From Vibrio		4e-33
1eep_A		404	2.4 A Resolution Crystal Structure Of Borrelia Burg		1e-32
3ffs_A		400	The Crystal Structure Of Cryptosporidium Parvum Ino		2e-29
1me8_A		503	Inosine Monophosphate Dehydrogenase (Impdh) From Tr		4e-29
1me7_A		503	Inosine Monophosphate Dehydrogenase (Impdh) From Tr		1e-28
3khj_A		361	C. Parvum Inosine Monophosphate Dehydrogenase Bound		1e-27
3r2g_A		361	Crystal Structure Of Inosine 5' Monophosphate Dehyd		4e-15
2a7r_A		366	Crystal Structure Of Human Guanosine Monophosphate		1e-14
2bzn_A		351	Crystal Structure Of Human Guanosine Monophosphate		2e-14
2ble_A		367	Structure Of Human Guanosine Monophosphate Reductas		4e-13
1pvn_A		376	The Crystal Structure Of The Complex Between Imp De		5e-12
1lrt_A		376	Crystal Structure Of Ternary Complex Of Tritrichomo		7e-12
1ypf_A		336	Crystal Structure Of Guac (Ba5705) From Bacillus An		8e-12
3kh5_A		280	Crystal Structure Of Protein Mj1225 From Methanocal		2e-05
2qr6_A		393	Crystal Structure Of Imp DehydrogenaseGMP REDUCTASE		3e-04

>pdb|1B3O|A Chain A, Ternary Complex Of Human Type-Ii Inosine Monophosphate Dehydrogenase With 6-Cl-Imp And Selenazole Adenine Dinucleotide Length = 514