Psyllid ID: psy10604


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MNVYNVDLGAFGTMLEKKEKEEERKEEEEEEEKNISAIGPAVTKLRQEAKIHNAVISLEPCYDCYSDPNTSFLRAARAGHLDKLRELLEAGVDINTSNASDPNTSFLRAARAGHLDKLRELLEAGVDINTSNATSKKLDNQLNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAALDSLVTDIASSAITDATSLPCSVILRTLRSS
cccccccccHHHHHHHHHHHHHHHHHHHcHHccccccHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHHccccccccccccccccc
cccccccHHHHHHHHHccccHHHHHHccccccccHccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHcccccccccccccHHHHcccc
mnvynvdlGAFGTMLEKKEKEEERKEEEEEEEKNISAIGPAVTKLRQEAKIHNAVislepcydcysdpntsFLRAARAGHLDKLRELLEAGvdintsnasdpntSFLRAARAGHLDKLRELLEAGvdintsnatskklDNQLNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKggckvdastkkgnTALHIAALDSLVTDIASsaitdatslpcSVILRTLRSS
mnvynvdlgafgtmlekkekeeerkeeeeeeeknisaigpavTKLRQEAKIHNAVISLEPCYDCYSDPNTSFLRAARAGHLDKLRELLEAGVdintsnasdpntsfLRAARAGHLDKLRELLEAGvdintsnatskkldnQLNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAALDSLVTDIASSAitdatslpcsvilrtlrss
MNVYNVDLGAFGTMLekkekeeerkeeeeeeekNISAIGPAVTKLRQEAKIHNAVISLEPCYDCYSDPNTSFLRAARAGHLDKLRELLEAGVDINTSNASDPNTSFLRAARAGHLDKLRELLEAGVDINTSNATSKKLDNQLNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAALDSLVTDIASSAITDATSLPCSVILRTLRSS
*****************************************VTKLRQEAKIHNAVISLEPCYDCYSDPNTSFLRAARAGHLDKLRELLEAGVDI************LRAARAGHLDKLRELLEAGVDI*************LNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAALDSLVTDIASSAITDATSLPCSVILR*****
MNVYNVDLGAFGTMLEKKEKEEERKEEEEEEEKNISAIGPAVTKLRQEAKIHNAVISLEPCYDCYSDPNTSFLRAARAGHLDKLRELLEAGVDINTSNASDPNTSFLRAARAGHLDKLRELLEAGVDINTSNATSKKLDNQLNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAALDSLVTDIASSAITDATSLPCSV********
MNVYNVDLGAFGTMLE*******************SAIGPAVTKLRQEAKIHNAVISLEPCYDCYSDPNTSFLRAARAGHLDKLRELLEAGVDINTSNASDPNTSFLRAARAGHLDKLRELLEAGVDINTSNATSKKLDNQLNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAALDSLVTDIASSAITDATSLPCSVILRTLRSS
*NVYNVDLGAFGTMLEKKEKEEERKEEEEEEEKNISAIGPAVTKLRQEAKIHNAVISLEPCYDCYSDPNTSFLRAARAGHLDKLRELLEAGVDINTSNASDPNTSFLRAARAGHLDKLRELLEAGVDINTSNATSKKLDNQLNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAALDSLVTDIASSAITDATSLPCSVILRTLRSS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVYNVDLGAxxxxxxxxxxxxxxxxxxxxxxxxxxxxGPAVTKLRQEAKIHNAVISLEPCYDCYSDPNTSFLRAARAGHLDKLRELLEAGVDINTSNASDPNTSFLRAARAGHLDKLRELLEAGVDINTSNATSKKLDNQLNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAALDSLVTDIASSAITDATSLPCSVILRTLRSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus yes N/A 0.346 0.020 0.562 4e-21
Q01484 3957 Ankyrin-2 OS=Homo sapiens yes N/A 0.346 0.019 0.562 5e-21
Q12955 4377 Ankyrin-3 OS=Homo sapiens no N/A 0.333 0.017 0.526 7e-18
G5E8K5 1961 Ankyrin-3 OS=Mus musculus yes N/A 0.346 0.039 0.520 7e-18
Q02357 1862 Ankyrin-1 OS=Mus musculus no N/A 0.346 0.041 0.5 4e-15
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.346 0.041 0.5 4e-15
Q7T163 1672 Kinase D-interacting subs no N/A 0.582 0.078 0.333 6e-11
Q9EQG6 1762 Kinase D-interacting subs no N/A 0.537 0.068 0.306 1e-09
Q495B1 522 Ankyrin repeat and death no N/A 0.475 0.204 0.365 1e-09
Q9ULH0 1771 Kinase D-interacting subs no N/A 0.528 0.067 0.328 2e-09
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function desciption
 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 64/96 (66%), Gaps = 18/96 (18%)

Query: 100 SDPNTSFLRAARAGHLDKLRELLEAGVDINTSNATSKKLDNQLNIHQKNIKNNGLNALHL 159
           SD N SFLRAARAG+LDK+ E L+ G+DINT N                   NGLNALHL
Sbjct: 29  SDSNASFLRAARAGNLDKVVEYLKGGIDINTCN------------------QNGLNALHL 70

Query: 160 AAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAAL 195
           AAK+GH  +V+ LL  G  VD++TKKGNTALHIA+L
Sbjct: 71  AAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASL 106




Attaches integral membrane proteins to cytoskeletal elements. Also binds to cytoskeletal proteins. Required for coordinate assembly of Na/Ca exchanger, Na/K ATPase and InsP3 receptor at sarcoplasmic reticulum sites in cardiomyocytes (By similarity). Required for the coordinated expression of the Na/K ATPase, Na/Ca exchanger and beta-2-spectrin (SPTBN1) in the inner segment of rod photoreceptors. Required for expression and targeting of SPTBN1 in neonatal cardiomyocytes and for the regulation of neonatal cardiomyocyte contraction rate.
Mus musculus (taxid: 10090)
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 Back     alignment and function description
>sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 Back     alignment and function description
>sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 Back     alignment and function description
>sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
328786387 6029 PREDICTED: hypothetical protein LOC40905 0.346 0.012 0.614 2e-22
345488337 7482 PREDICTED: hypothetical protein LOC10012 0.364 0.010 0.59 4e-22
340713436 6672 PREDICTED: hypothetical protein LOC10064 0.346 0.011 0.604 6e-22
350425715 4893 PREDICTED: hypothetical protein LOC10074 0.346 0.015 0.604 8e-22
332022332 7686 Ankyrin-2 [Acromyrmex echinatior] 0.342 0.010 0.6 1e-21
270004596 7005 hypothetical protein TcasGA2_TC003960 [T 0.346 0.011 0.583 2e-21
322778809 1346 hypothetical protein SINV_06859 [Solenop 0.346 0.057 0.604 5e-21
383847150 874 PREDICTED: ankyrin-2 [Megachile rotundat 0.346 0.089 0.604 1e-20
189235752 2692 PREDICTED: similar to ankyrin 2,3/unc44 0.346 0.028 0.581 3e-20
189235951 1719 PREDICTED: similar to ankyrin 2,3/unc44 0.373 0.048 0.549 7e-20
>gi|328786387|ref|XP_392578.4| PREDICTED: hypothetical protein LOC409051 [Apis mellifera] Back     alignment and taxonomy information
 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 68/96 (70%), Gaps = 18/96 (18%)

Query: 100 SDPNTSFLRAARAGHLDKLRELLEAGVDINTSNATSKKLDNQLNIHQKNIKNNGLNALHL 159
           SDP+T+FLRAARAG L+K+ E LE+GVDIN SNA                  NGLNALHL
Sbjct: 76  SDPSTAFLRAARAGQLEKVLEYLESGVDINASNA------------------NGLNALHL 117

Query: 160 AAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAAL 195
           AAKDGH  +V+ LLK G  VDA+TKKGNTALHIA+L
Sbjct: 118 AAKDGHLEIVRELLKRGAVVDAATKKGNTALHIASL 153




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345488337|ref|XP_001606081.2| PREDICTED: hypothetical protein LOC100122475 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340713436|ref|XP_003395249.1| PREDICTED: hypothetical protein LOC100642686 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350425715|ref|XP_003494210.1| PREDICTED: hypothetical protein LOC100742486, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|332022332|gb|EGI62644.1| Ankyrin-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|270004596|gb|EFA01044.1| hypothetical protein TcasGA2_TC003960 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322778809|gb|EFZ09225.1| hypothetical protein SINV_06859 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383847150|ref|XP_003699218.1| PREDICTED: ankyrin-2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|189235752|ref|XP_001807645.1| PREDICTED: similar to ankyrin 2,3/unc44 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189235951|ref|XP_001809144.1| PREDICTED: similar to ankyrin 2,3/unc44 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
UNIPROTKB|F1NG08 3694 Gga.53822 "Uncharacterized pro 0.564 0.034 0.398 6.9e-15
UNIPROTKB|J9NTH2 2063 ANK2 "Uncharacterized protein" 0.568 0.062 0.388 1.6e-14
UNIPROTKB|I6L894 3924 ANK2 "Ankyrin-2" [Homo sapiens 0.564 0.032 0.391 2.7e-14
UNIPROTKB|Q01484 3957 ANK2 "Ankyrin-2" [Homo sapiens 0.564 0.032 0.391 2.7e-14
ZFIN|ZDB-GENE-041010-165 3538 ank2b "ankyrin 2b, neuronal" [ 0.564 0.035 0.419 2.8e-14
UNIPROTKB|F1M5N3 3838 Ank2 "Protein Ank2" [Rattus no 0.564 0.033 0.391 5.1e-14
UNIPROTKB|F1S146 3896 ANK2 "Uncharacterized protein" 0.564 0.032 0.391 5.1e-14
MGI|MGI:88025 3898 Ank2 "ankyrin 2, brain" [Mus m 0.564 0.032 0.391 5.1e-14
UNIPROTKB|F1M9N9 3898 Ank2 "Protein Ank2" [Rattus no 0.564 0.032 0.391 5.1e-14
UNIPROTKB|F1LM42 3927 Ank2 "Protein Ank2" [Rattus no 0.564 0.032 0.391 5.2e-14
UNIPROTKB|F1NG08 Gga.53822 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 208 (78.3 bits), Expect = 6.9e-15, P = 6.9e-15
 Identities = 57/143 (39%), Positives = 79/143 (55%)

Query:    66 SDPNTSFLRAARAGHLDKLRELLEAGVDINTSNASDPNTSFLRAARAGHLDKLRELLEAG 125
             SD N SFLRAARAG+LDK+ E L++G+DINT N +  N   L AA+ GH+  ++ELLE G
Sbjct:     5 SDSNASFLRAARAGNLDKVVEYLKSGIDINTCNQNGLNALHL-AAKEGHVGLVQELLERG 63

Query:   126 --VDINTSNATSK----KLDNQLNIHQKNIKN---------NGLNALHLAAKDGHTTVVK 170
               VD  T    +      L  Q  + +  +K          NG   L++AA++ H  VVK
Sbjct:    64 SAVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIEVVK 123

Query:   171 ALLKGGCKVDASTKKGNTALHIA 193
              LL+ G     +T+ G T L +A
Sbjct:   124 YLLENGANQSTATEDGFTPLAVA 146


GO:0003283 "atrial septum development" evidence=IEA
GO:0005887 "integral to plasma membrane" evidence=IEA
GO:0006874 "cellular calcium ion homeostasis" evidence=IEA
GO:0010628 "positive regulation of gene expression" evidence=IEA
GO:0010881 "regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion" evidence=IEA
GO:0014704 "intercalated disc" evidence=IEA
GO:0015459 "potassium channel regulator activity" evidence=IEA
GO:0016323 "basolateral plasma membrane" evidence=IEA
GO:0019901 "protein kinase binding" evidence=IEA
GO:0030018 "Z disc" evidence=IEA
GO:0030315 "T-tubule" evidence=IEA
GO:0030507 "spectrin binding" evidence=IEA
GO:0030674 "protein binding, bridging" evidence=IEA
GO:0031430 "M band" evidence=IEA
GO:0033292 "T-tubule organization" evidence=IEA
GO:0034394 "protein localization to cell surface" evidence=IEA
GO:0043034 "costamere" evidence=IEA
GO:0043268 "positive regulation of potassium ion transport" evidence=IEA
GO:0044325 "ion channel binding" evidence=IEA
GO:0048471 "perinuclear region of cytoplasm" evidence=IEA
GO:0050821 "protein stabilization" evidence=IEA
GO:0051117 "ATPase binding" evidence=IEA
GO:0051928 "positive regulation of calcium ion transport" evidence=IEA
GO:0060048 "cardiac muscle contraction" evidence=IEA
GO:0060307 "regulation of ventricular cardiac muscle cell membrane repolarization" evidence=IEA
GO:0070972 "protein localization to endoplasmic reticulum" evidence=IEA
GO:0072661 "protein targeting to plasma membrane" evidence=IEA
GO:0086005 "regulation of ventricular cardiac muscle cell action potential" evidence=IEA
GO:0086014 "regulation of atrial cardiac muscle cell action potential" evidence=IEA
GO:0086015 "regulation of SA node cell action potential" evidence=IEA
GO:0086091 "regulation of heart rate by cardiac conduction" evidence=IEA
GO:1901018 "positive regulation of potassium ion transmembrane transporter activity" evidence=IEA
GO:1901021 "positive regulation of calcium ion transmembrane transporter activity" evidence=IEA
GO:2001259 "positive regulation of cation channel activity" evidence=IEA
UNIPROTKB|J9NTH2 ANK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I6L894 ANK2 "Ankyrin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q01484 ANK2 "Ankyrin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-165 ank2b "ankyrin 2b, neuronal" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1M5N3 Ank2 "Protein Ank2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S146 ANK2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:88025 Ank2 "ankyrin 2, brain" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1M9N9 Ank2 "Protein Ank2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM42 Ank2 "Protein Ank2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-08
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-06
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 5e-06
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-05
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 5e-04
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.001
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.002
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 83.2 bits (206), Expect = 2e-20
 Identities = 47/126 (37%), Positives = 64/126 (50%), Gaps = 19/126 (15%)

Query: 69  NTSFLRAARAGHLDKLRELLEAGVDINTSNASDPNTSFLRAARAGHLDKLRELLEAGVDI 128
            T    AA  GHL+ ++ LLE G D+N  +     T    AA+ GHL+ ++ LLE G D+
Sbjct: 8   RTPLHLAASNGHLEVVKLLLENGADVNAKDNDG-RTPLHLAAKNGHLEIVKLLLEKGADV 66

Query: 129 NTSNATSKKLDNQLNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNT 188
           N  +                   +G   LHLAA++G+  VVK LLK G  V+A  K G T
Sbjct: 67  NARD------------------KDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRT 108

Query: 189 ALHIAA 194
            LH+AA
Sbjct: 109 PLHLAA 114


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
KOG4412|consensus226 99.96
KOG4412|consensus226 99.96
PHA02791284 ankyrin-like protein; Provisional 99.94
KOG0509|consensus 600 99.93
PHA02791 284 ankyrin-like protein; Provisional 99.92
PHA02859209 ankyrin repeat protein; Provisional 99.91
PHA02741169 hypothetical protein; Provisional 99.91
KOG0509|consensus 600 99.91
PHA02875 413 ankyrin repeat protein; Provisional 99.91
PHA02875 413 ankyrin repeat protein; Provisional 99.9
PHA03100 480 ankyrin repeat protein; Provisional 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02874 434 ankyrin repeat protein; Provisional 99.9
PHA02878 477 ankyrin repeat protein; Provisional 99.9
PHA02874434 ankyrin repeat protein; Provisional 99.9
PHA02795 437 ankyrin-like protein; Provisional 99.89
PHA02878 477 ankyrin repeat protein; Provisional 99.89
PHA02989 494 ankyrin repeat protein; Provisional 99.89
PHA02884 300 ankyrin repeat protein; Provisional 99.89
PHA02798 489 ankyrin-like protein; Provisional 99.89
PHA02946 446 ankyin-like protein; Provisional 99.88
PHA02736154 Viral ankyrin protein; Provisional 99.88
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.87
KOG0508|consensus 615 99.87
KOG0502|consensus296 99.87
PHA03095 471 ankyrin-like protein; Provisional 99.87
PHA03100 480 ankyrin repeat protein; Provisional 99.87
PHA02859209 ankyrin repeat protein; Provisional 99.87
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.87
PHA03095 471 ankyrin-like protein; Provisional 99.87
KOG0514|consensus452 99.87
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.87
KOG0512|consensus228 99.86
PHA02917 661 ankyrin-like protein; Provisional 99.86
KOG0508|consensus 615 99.86
KOG0510|consensus 929 99.86
PHA02946 446 ankyin-like protein; Provisional 99.86
PHA02876 682 ankyrin repeat protein; Provisional 99.85
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.85
KOG0512|consensus228 99.84
PHA02989 494 ankyrin repeat protein; Provisional 99.84
PHA02876 682 ankyrin repeat protein; Provisional 99.84
PHA02798 489 ankyrin-like protein; Provisional 99.84
PHA02743166 Viral ankyrin protein; Provisional 99.83
KOG0510|consensus 929 99.83
PHA02730 672 ankyrin-like protein; Provisional 99.82
KOG4177|consensus 1143 99.82
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.81
PHA02730 672 ankyrin-like protein; Provisional 99.81
KOG0195|consensus 448 99.8
KOG0505|consensus 527 99.79
PHA02795 437 ankyrin-like protein; Provisional 99.79
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.79
KOG4177|consensus 1143 99.78
PHA02736154 Viral ankyrin protein; Provisional 99.77
KOG0502|consensus296 99.76
PHA02792 631 ankyrin-like protein; Provisional 99.76
KOG0195|consensus 448 99.75
PHA02792 631 ankyrin-like protein; Provisional 99.74
PHA02884300 ankyrin repeat protein; Provisional 99.74
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.73
PHA02741169 hypothetical protein; Provisional 99.72
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.72
KOG4214|consensus117 99.71
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.7
PHA02917 661 ankyrin-like protein; Provisional 99.7
KOG3676|consensus 782 99.69
KOG0514|consensus452 99.68
KOG0507|consensus 854 99.68
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.67
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.64
KOG0507|consensus 854 99.63
KOG3676|consensus 782 99.63
KOG0505|consensus 527 99.58
KOG1710|consensus 396 99.58
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.56
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.55
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.53
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.53
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.52
KOG0515|consensus752 99.49
KOG0515|consensus752 99.49
KOG4214|consensus117 99.49
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.44
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.42
KOG1710|consensus 396 99.38
KOG4369|consensus 2131 99.22
KOG4369|consensus 2131 99.19
KOG0783|consensus 1267 99.15
KOG0818|consensus 669 99.1
KOG0506|consensus622 99.05
KOG0818|consensus 669 98.98
PF1360630 Ank_3: Ankyrin repeat 98.97
KOG0783|consensus 1267 98.96
PF1360630 Ank_3: Ankyrin repeat 98.96
KOG0522|consensus 560 98.93
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.92
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.87
KOG0705|consensus749 98.86
KOG0782|consensus1004 98.8
KOG0506|consensus622 98.77
KOG0522|consensus 560 98.69
KOG0705|consensus749 98.59
KOG0782|consensus1004 98.5
KOG0521|consensus785 98.47
KOG0520|consensus 975 98.47
KOG0521|consensus785 98.4
KOG3609|consensus 822 98.3
KOG2384|consensus 223 98.24
KOG0511|consensus 516 98.2
KOG0511|consensus 516 98.06
KOG2384|consensus 223 97.99
KOG3609|consensus 822 97.78
KOG0520|consensus 975 97.72
KOG2505|consensus591 97.71
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.39
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.35
KOG2505|consensus591 97.23
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.45
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.59
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 91.95
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.04
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 84.81
>KOG4412|consensus Back     alignment and domain information
Probab=99.96  E-value=5.6e-29  Score=180.26  Aligned_cols=131  Identities=29%  Similarity=0.368  Sum_probs=119.4

Q ss_pred             ccCCCCchHHHHHHHcCCHHHHHHHHHc-CCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCcchhhHHHH
Q psy10604         63 DCYSDPNTSFLRAARAGHLDKLRELLEA-GVDINTSNASDPNTSFLRAARAGHLDKLRELLEAGVDINTSNATSKKLDNQ  141 (225)
Q Consensus        63 ~~~~~g~t~L~~A~~~g~~~~v~~Ll~~-g~~~~~~~~~~g~t~Lh~A~~~~~~~iv~~Ll~~g~~~~~~~~~~~~~~~~  141 (225)
                      +.+..|+||||+|+..|+.++|+.|+.+ |+|+|..+ ..|.||||||+..|+.+|+++|++.|+.++.+|.        
T Consensus        67 dkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~t-n~G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~--------  137 (226)
T KOG4412|consen   67 DKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATT-NGGQTCLHYAAGKGRLEIAQLLLEKGALIRIKDK--------  137 (226)
T ss_pred             CccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceec-CCCcceehhhhcCChhhHHHHHHhcCCCCccccc--------
Confidence            3478899999999999999999999998 99999988 7899999999999999999999999999998886        


Q ss_pred             hhhhhhccCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCChHHHHHHHcCChHHHHHHHhhcCCCC
Q psy10604        142 LNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAALDSLVTDIASSAITDATSL  213 (225)
Q Consensus       142 ~~~~~~~~d~~g~t~L~~A~~~~~~~~~~~Ll~~ga~~~~~d~~g~tpL~~A~~~~~~~~i~~~l~~~~~~~  213 (225)
                                .|.||||.|+..|..+++++|+..|+.+|.+|..|+||||.|..-|+ ..++.+|++.|+..
T Consensus       138 ----------~~qtplHRAAavGklkvie~Li~~~a~~n~qDk~G~TpL~~al~e~~-~d~a~lLV~~gAd~  198 (226)
T KOG4412|consen  138 ----------QGQTPLHRAAAVGKLKVIEYLISQGAPLNTQDKYGFTPLHHALAEGH-PDVAVLLVRAGADT  198 (226)
T ss_pred             ----------ccCchhHHHHhccchhhHHHHHhcCCCCCcccccCccHHHHHHhccC-chHHHHHHHhccce
Confidence                      99999999999999999999999999999999999999999987887 57888888887654



>KOG4412|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-15
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 8e-06
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-15
2xeh_A157 Structural Determinants For Improved Thermal Stabil 4e-15
2xee_A157 Structural Determinants For Improved Thermal Stabil 5e-15
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-13
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-13
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-12
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-12
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 7e-12
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 8e-12
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 9e-12
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 9e-12
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 9e-12
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-11
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-11
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-11
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-11
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-11
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-11
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 4e-11
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 8e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 6e-11
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-11
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-10
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 5e-10
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 7e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 9e-10
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-09
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-09
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 5e-09
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-08
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-08
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-08
2xen_A91 Structural Determinants For Improved Thermal Stabil 4e-08
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-08
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 7e-08
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 9e-08
1uoh_A226 Human Gankyrin Length = 226 1e-07
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-07
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-07
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-07
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 3e-06
1s70_B 299 Complex Between Protein Ser/thr Phosphatase-1 (delt 3e-05
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 4e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 7e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 9e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 9e-05
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 9e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 1e-04
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 1e-04
3deo_A183 Structural Basis For Specific Substrate Recognition 4e-04
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 4e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure

Iteration: 1

Score = 79.7 bits (195), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 52/125 (41%), Positives = 68/125 (54%), Gaps = 19/125 (15%) Query: 70 TSFLRAARAGHLDKLRELLEAGVDINTSNASDPNTSFLRAARAGHLDKLRELLEAGVDIN 129 T AAR GHL+ ++ LLEAG D+N + + T AAR GHL+ ++ LLEAG D+N Sbjct: 4 TPLHLAARNGHLEVVKLLLEAGADVNAKD-KNGRTPLHLAARNGHLEVVKLLLEAGADVN 62 Query: 130 TSNATSKKLDNQLNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTA 189 + NG LHLAA++GH VVK LL+ G V+A K G T Sbjct: 63 AKD------------------KNGRTPLHLAARNGHLEVVKLLLEAGADVNAKDKNGRTP 104 Query: 190 LHIAA 194 LH+AA Sbjct: 105 LHLAA 109
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-24
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-23
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-19
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-22
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-16
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-10
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-21
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-20
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-13
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-09
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-20
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-16
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-20
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-19
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-12
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-19
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 8e-13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-12
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 2e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-04
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-20
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-15
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-13
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-20
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 3e-19
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-14
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 6e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-07
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-19
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-16
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-19
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-04
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-19
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-15
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-12
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-06
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-14
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-07
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-19
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-15
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-14
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-14
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-17
3hra_A 201 Ankyrin repeat family protein; structural protein; 1e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-16
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-13
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-14
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 4e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-18
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-18
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-12
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 3e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-18
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-18
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-18
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-13
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-18
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-18
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-17
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 1e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-18
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-17
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-16
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-15
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-13
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-17
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-13
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-17
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-15
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-10
2rfa_A232 Transient receptor potential cation channel subfa 4e-17
2rfa_A232 Transient receptor potential cation channel subfa 2e-13
2rfa_A232 Transient receptor potential cation channel subfa 2e-10
2rfa_A232 Transient receptor potential cation channel subfa 3e-10
2rfa_A 232 Transient receptor potential cation channel subfa 1e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-17
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-12
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-14
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-11
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-08
2etb_A256 Transient receptor potential cation channel subfam 2e-15
2etb_A256 Transient receptor potential cation channel subfam 2e-13
2etb_A256 Transient receptor potential cation channel subfam 6e-11
2etb_A256 Transient receptor potential cation channel subfam 9e-11
2etb_A256 Transient receptor potential cation channel subfam 1e-05
2pnn_A273 Transient receptor potential cation channel subfa 4e-13
2pnn_A273 Transient receptor potential cation channel subfa 8e-13
2pnn_A273 Transient receptor potential cation channel subfa 3e-12
2pnn_A273 Transient receptor potential cation channel subfa 7e-09
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-09
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 1e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-06
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
 Score = 95.9 bits (240), Expect = 3e-25
 Identities = 31/126 (24%), Positives = 45/126 (35%), Gaps = 19/126 (15%)

Query: 69  NTSFLRAARAGHLDKLRELLEAGVDINTSNASDPNTSFLRAARAGHLDKLRELLEAGVDI 128
           + S  + A  G +  L   +E    IN ++     T  + AA  G +  +  LL+ G D 
Sbjct: 4   SLSVHQLAAQGEMLYLATRIEQENVINHTDEEG-FTPLMWAAAHGQIAVVEFLLQNGADP 62

Query: 129 NTSNATSKKLDNQLNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNT 188
                                     +AL LA   G+T +VK LL  G  V+     G T
Sbjct: 63  QLLG------------------KGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGT 104

Query: 189 ALHIAA 194
            L  A 
Sbjct: 105 PLLYAV 110


>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.96
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.94
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.94
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.94
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.94
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.94
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.94
2etb_A256 Transient receptor potential cation channel subfam 99.94
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.93
2rfa_A232 Transient receptor potential cation channel subfa 99.93
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.93
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
3hra_A201 Ankyrin repeat family protein; structural protein; 99.93
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.93
2rfa_A232 Transient receptor potential cation channel subfa 99.93
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.93
2pnn_A273 Transient receptor potential cation channel subfa 99.93
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.93
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.93
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.93
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.93
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.93
3hra_A201 Ankyrin repeat family protein; structural protein; 99.93
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.93
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.93
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.93
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.93
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.93
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.92
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.92
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.92
2etb_A256 Transient receptor potential cation channel subfam 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.92
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.92
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.92
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.92
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.92
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.92
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.92
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.92
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.92
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.92
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.92
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.91
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.91
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.91
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.91
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.91
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.91
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.91
2pnn_A273 Transient receptor potential cation channel subfa 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.91
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.9
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.9
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.9
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.9
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.87
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.87
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.87
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.85
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.85
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.85
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.84
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.83
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.83
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.82
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.8
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.79
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.79
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.75
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.97  E-value=1.6e-30  Score=194.19  Aligned_cols=132  Identities=31%  Similarity=0.474  Sum_probs=121.6

Q ss_pred             cccCCCCchHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCcchhhHHHH
Q psy10604         62 YDCYSDPNTSFLRAARAGHLDKLRELLEAGVDINTSNASDPNTSFLRAARAGHLDKLRELLEAGVDINTSNATSKKLDNQ  141 (225)
Q Consensus        62 ~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~g~t~Lh~A~~~~~~~iv~~Ll~~g~~~~~~~~~~~~~~~~  141 (225)
                      ...+..|.||||+|+..++.+++++|++.|++++.++ ..|+||||+|+..|+.+++++|++.|++++.++.        
T Consensus        31 n~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d-~~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d~--------  101 (169)
T 4gpm_A           31 NASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKD-SDGRTPLHHAAENGHKEVVKLLISKGADVNAKDS--------  101 (169)
T ss_dssp             TCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCC-TTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCT--------
T ss_pred             CCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhc-cCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCC--------
Confidence            3457889999999999999999999999999999998 8999999999999999999999999999999886        


Q ss_pred             hhhhhhccCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCChHHHHHHHcCChHHHHHHHhhcCCCC
Q psy10604        142 LNIHQKNIKNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAALDSLVTDIASSAITDATSL  213 (225)
Q Consensus       142 ~~~~~~~~d~~g~t~L~~A~~~~~~~~~~~Ll~~ga~~~~~d~~g~tpL~~A~~~~~~~~i~~~l~~~~~~~  213 (225)
                                .|+||||+|+..|+.+++++|+++|++++.+|..|+||||+|+..|+. .++++|++.|+.+
T Consensus       102 ----------~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~-~iv~~Ll~~GA~i  162 (169)
T 4gpm_A          102 ----------DGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGNE-EVVKLLEKQGGWL  162 (169)
T ss_dssp             ----------TSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCH-HHHHHHHTC----
T ss_pred             ----------CCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcCCH-HHHHHHHHCCCCc
Confidence                      999999999999999999999999999999999999999999999995 6778888887765



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-16
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-14
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-13
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-11
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-13
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-12
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-11
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-09
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-08
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-05
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-04
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.002
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 8e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.004
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-10
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-09
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-05
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-09
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-06
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-05
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-04
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.001
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 6e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.002
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-04
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-04
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.002
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 6e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 73.9 bits (180), Expect = 4e-16
 Identities = 31/91 (34%), Positives = 39/91 (42%), Gaps = 18/91 (19%)

Query: 104 TSFLRAARAGHLDKLRELLEAGVDINTSNATSKKLDNQLNIHQKNIKNNGLNALHLAAKD 163
           T    A+  GHL  ++ LL+ G   N SN                        LH+AA+ 
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSN------------------VKVETPLHMAARA 43

Query: 164 GHTTVVKALLKGGCKVDASTKKGNTALHIAA 194
           GHT V K LL+   KV+A  K   T LH AA
Sbjct: 44  GHTEVAKYLLQNKAKVNAKAKDDQTPLHCAA 74


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.95
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.95
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.95
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.92
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.92
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.92
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.91
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.88
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.87
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.86
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.85
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.8
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.8
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.78
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.77
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.7
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.69
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.69
d1k1aa_ 228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.63
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.95  E-value=1.2e-27  Score=186.90  Aligned_cols=63  Identities=27%  Similarity=0.257  Sum_probs=51.3

Q ss_pred             CCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCChHHHHHHHcCChHHHHHHHhhcCCCC
Q psy10604        150 KNNGLNALHLAAKDGHTTVVKALLKGGCKVDASTKKGNTALHIAALDSLVTDIASSAITDATSL  213 (225)
Q Consensus       150 d~~g~t~L~~A~~~~~~~~~~~Ll~~ga~~~~~d~~g~tpL~~A~~~~~~~~i~~~l~~~~~~~  213 (225)
                      +..|.||||+|+..++.+++++|+++|++++.+|..|+||||+|+..|+. .++++|+.+|++.
T Consensus       189 ~~~g~TpL~~A~~~~~~~~v~~Ll~~gadin~~d~~g~t~L~~A~~~~~~-~i~~~Ll~~Ga~~  251 (255)
T d1oy3d_         189 PTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNP-ILARLLRAHGAPE  251 (255)
T ss_dssp             TTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCH-HHHHHHHHTTCCC
T ss_pred             cccccccccccccccHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCH-HHHHHHHHcCCCC
Confidence            35688888888888888888888888888888888888888888888884 5677777777753



>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure