Psyllid ID: psy10606


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
VSIVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPENLLHKEYQTPVICRKIIQKIYSKRRVVRGCGYINEERDDCYRRTGTFDVDSTYCACKGDICNGSPSLGQSTSLVVTSLLAAVVLLAQNRLL
ccEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccEEEEEccEEccccccccccccccccEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccc
ccEEEEEEccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccEEEEEEccEccccccccccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHcc
vsivcyqcnsaydprcgdpfdpyslgtvncsllpipenllhkeyqtpvICRKIIQKIYSKrrvvrgcgyineerddcyrrtgtfdvdstycackgdicngspslgqsTSLVVTSLLAAVVLLAQNRLL
VSIVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPENLLHKEYQTPVICRKIIqkiyskrrvvrgcgyineerddcyrrtgTFDVDSTYCACKGDICNGSPSLGQSTSLVVTSLLAAVVLLAQNRLL
VSIVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPENLLHKEYQTPVICRKIIQKIYSKRRVVRGCGYINEERDDCYRRTGTFDVDSTYCACKGDICNGSPSLGQstslvvtsllaavvllaQNRLL
**IVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPENLLHKEYQTPVICRKIIQKIYSKRRVVRGCGYINEERDDCYRRTGTFDVDSTYCACKGDICNGSPSLGQSTSLVVTSLLAAVVLLA*****
VSIVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPE***HKEYQTPVICRKIIQKIYSKRRVVRGCGYINEERDDCYRRTGTFDVDSTYCACKGDICNGSPSLGQSTSLVVTSLLAAVVLLAQNRLL
VSIVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPENLLHKEYQTPVICRKIIQKIYSKRRVVRGCGYINEERDDCYRRTGTFDVDSTYCACKGDICNGSPSLGQSTSLVVTSLLAAVVLLAQNRLL
VSIVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPENLLHKEYQTPVICRKIIQKIYSKRRVVRGCGYINEERDDCYRRTGTFDVDSTYCACKGDICNGSPSLGQSTSLVVTSLLAAVVLLAQNRLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VSIVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPENLLHKEYQTPVICRKIIQKIYSKRRVVRGCGYINEERDDCYRRTGTFDVDSTYCACKGDICNGSPSLGQSTSLVVTSLLAAVVLLAQNRLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
380025596167 PREDICTED: uncharacterized protein LOC10 0.921 0.706 0.585 7e-34
383864743167 PREDICTED: uncharacterized protein LOC10 0.921 0.706 0.577 8e-33
340722308167 PREDICTED: hypothetical protein LOC10064 0.953 0.730 0.573 6e-32
350416695167 PREDICTED: hypothetical protein LOC10075 0.953 0.730 0.573 1e-31
66509585167 PREDICTED: hypothetical protein LOC41166 0.773 0.592 0.625 3e-30
307207771166 hypothetical protein EAI_14604 [Harpegna 0.757 0.584 0.627 3e-30
195024294155 GH21037 [Drosophila grimshawi] gi|193901 0.937 0.774 0.508 4e-30
195123637154 GI18639 [Drosophila mojavensis] gi|19391 0.937 0.779 0.516 6e-30
345489046160 PREDICTED: hypothetical protein LOC10011 0.765 0.612 0.586 9e-30
195381619154 GJ21652 [Drosophila virilis] gi|19414434 0.929 0.772 0.536 2e-29
>gi|380025596|ref|XP_003696556.1| PREDICTED: uncharacterized protein LOC100869121 [Apis florea] Back     alignment and taxonomy information
 Score =  148 bits (373), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 72/123 (58%), Positives = 88/123 (71%), Gaps = 5/123 (4%)

Query: 2   SIVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPENLLHKEYQTPVICRKIIQKIYSKR 61
           +I+CYQCNS YDPRCGDPFDPYSLGTVNCS  P  E+L H E   P +CRKI Q++Y K 
Sbjct: 26  AIICYQCNSEYDPRCGDPFDPYSLGTVNCSFQPRLEHLSHLE---PTLCRKISQRVYGKI 82

Query: 62  RVVRGCGYINEERD--DCYRRTGTFDVDSTYCACKGDICNGSPSLGQSTSLVVTSLLAAV 119
           RVVR CGYI ++RD  DC  R+GT DV + YCAC GD+CN + S   S  L +TSLL  +
Sbjct: 83  RVVRSCGYITDQRDNADCLMRSGTHDVHAAYCACTGDLCNSAESHTPSFLLPLTSLLTVI 142

Query: 120 VLL 122
           + +
Sbjct: 143 LTM 145




Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383864743|ref|XP_003707837.1| PREDICTED: uncharacterized protein LOC100880055 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340722308|ref|XP_003399549.1| PREDICTED: hypothetical protein LOC100644414 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350416695|ref|XP_003491058.1| PREDICTED: hypothetical protein LOC100750040 [Bombus impatiens] Back     alignment and taxonomy information
>gi|66509585|ref|XP_395132.2| PREDICTED: hypothetical protein LOC411664 [Apis mellifera] Back     alignment and taxonomy information
>gi|307207771|gb|EFN85389.1| hypothetical protein EAI_14604 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|195024294|ref|XP_001985845.1| GH21037 [Drosophila grimshawi] gi|193901845|gb|EDW00712.1| GH21037 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195123637|ref|XP_002006310.1| GI18639 [Drosophila mojavensis] gi|193911378|gb|EDW10245.1| GI18639 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|345489046|ref|XP_001603295.2| PREDICTED: hypothetical protein LOC100119541 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195381619|ref|XP_002049545.1| GJ21652 [Drosophila virilis] gi|194144342|gb|EDW60738.1| GJ21652 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
FB|FBgn0032421151 crok "crooked" [Drosophila mel 0.757 0.642 0.377 1.6e-15
FB|FBgn0032422143 atilla "atilla" [Drosophila me 0.75 0.671 0.336 1.4e-09
FB|FBgn0051675148 CG31675 [Drosophila melanogast 0.773 0.668 0.292 1e-06
FB|FBgn0032421 crok "crooked" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 195 (73.7 bits), Expect = 1.6e-15, P = 1.6e-15
 Identities = 40/106 (37%), Positives = 58/106 (54%)

Query:     2 SIVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPENLLHKEYQTPVICRKIIQKIYSKR 61
             +I C+ C S  DP+CGDPFD  +L   +C   P    L H +   P +CRKI QK++ + 
Sbjct:    23 AIKCWDCRSDNDPKCGDPFDNSTLAITDCQQAP---ELEHLKGVRPTMCRKIRQKVHGEW 79

Query:    62 RVVRGCGYINE---ERDD--CYRRTGTFDVDSTYCACKG-DICNGS 101
             R  R C Y+ E   E D+  C  RTG++++   +C C   D CN +
Sbjct:    80 RYFRSCAYMGEPGIEGDERFCLMRTGSYNIFMEFCTCNSKDGCNSA 125




GO:0035151 "regulation of tube size, open tracheal system" evidence=IMP
GO:0019991 "septate junction assembly" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
FB|FBgn0032422 atilla "atilla" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051675 CG31675 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
cd0011779 LU Ly-6 antigen / uPA receptor -like domain; occur 98.76
smart0013479 LU Ly-6 antigen / uPA receptor -like domain. Three 98.52
PF0002177 UPAR_LY6: u-PAR/Ly-6 domain omitted due to poor si 98.31
PF0106483 Activin_recp: Activin types I and II receptor doma 98.1
PF0008763 Toxin_1: Snake toxin; InterPro: IPR003571 Snake to 98.1
cd0020664 snake_toxin Snake toxin domain, present in short a 97.94
PF05444152 DUF753: Protein of unknown function (DUF753); Inte 97.32
PF06579129 Ly-6_related: Caenorhabditis elegans ly-6-related 97.07
KOG3653|consensus 534 95.36
PF0298883 PLA2_inh: Phospholipase A2 inhibitor; InterPro: IP 94.49
KOG2052|consensus 513 94.43
PF05444152 DUF753: Protein of unknown function (DUF753); Inte 93.76
PF0168482 ET: ET module; InterPro: IPR002603 The proteins in 86.66
>cd00117 LU Ly-6 antigen / uPA receptor -like domain; occurs singly in GPI-linked cell-surface glycoproteins (Ly-6 family,CD59, thymocyte B cell antigen, Sgp-2) or as three-fold repeated domain in urokinase-type plasminogen activator receptor Back     alignment and domain information
Probab=98.76  E-value=4e-08  Score=62.13  Aligned_cols=75  Identities=23%  Similarity=0.495  Sum_probs=49.7

Q ss_pred             ceEEecCCCCCCCCCCCCCCCCCCccCCCCCCCCCcccccCCCCCCceEEEEEEeC----CceEEEEceecCcccCcccc
Q psy10606          3 IVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPENLLHKEYQTPVICRKIIQKIY----SKRRVVRGCGYINEERDDCY   78 (128)
Q Consensus         3 L~CY~C~S~~~~~C~~~f~~~~~~~~~C~~~~~~~~l~~~~~~~~~~C~Ki~~~~~----g~~~v~R~C~~~~~~~~~C~   78 (128)
                      |+||+|.+..+..|..+        ++|+..             ..+|.|.+..+.    ....+.|+|+........  
T Consensus         1 L~C~~C~~~~~~~C~~~--------~~C~~~-------------~~~C~~~~~~~~~~~~~~~~~~rgC~~~C~~~~~--   57 (79)
T cd00117           1 LECYSCTGVSTSSCSTE--------TNCPSP-------------DDQCLTAVATVIEESVRLSLVVRGCASDCPFTNV--   57 (79)
T ss_pred             CccCcCCCCCCCCCCCC--------CccCCC-------------CCEeeEEEEEEEeeccccceEECcccCCCCCCCc--
Confidence            78999988656688753        478852             778999877643    245688999995443210  


Q ss_pred             cccccCCceeEEEeeCCCCCCCC
Q psy10606         79 RRTGTFDVDSTYCACKGDICNGS  101 (128)
Q Consensus        79 ~~~~~~~~~~~~C~C~~D~CN~a  101 (128)
                      ...+........| |++|+||++
T Consensus        58 ~~~~~~~~~~~~C-C~tD~CN~~   79 (79)
T cd00117          58 FGQLSITFLKVSC-CQEDLCNAA   79 (79)
T ss_pred             cCccccceEeeee-CCCCccCCC
Confidence            0001112345678 999999985



Topology of these domains is similar to that of snake venom neurotoxins.

>smart00134 LU Ly-6 antigen / uPA receptor -like domain Back     alignment and domain information
>PF00021 UPAR_LY6: u-PAR/Ly-6 domain omitted due to poor similarity Back     alignment and domain information
>PF01064 Activin_recp: Activin types I and II receptor domain; InterPro: IPR000472 Transforming growth factor-beta (TGF-beta) forms a family with other growth factors described in PDOC00223 from PROSITEDOC Back     alignment and domain information
>PF00087 Toxin_1: Snake toxin; InterPro: IPR003571 Snake toxins belong to a family of proteins [] which groups short and long neurotoxins, cytotoxins and short toxins, as well as a other miscellaneous venom peptides Back     alignment and domain information
>cd00206 snake_toxin Snake toxin domain, present in short and long neurotoxins, cytotoxins and short toxins, and in other miscellaneous venom peptides Back     alignment and domain information
>PF05444 DUF753: Protein of unknown function (DUF753); InterPro: IPR008472 This entry contains sequences which are repeated in several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>PF06579 Ly-6_related: Caenorhabditis elegans ly-6-related protein; InterPro: IPR010558 This family consists of several Caenorhabditis elegans specific ly-6-related HOT and ODR proteins Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>PF02988 PLA2_inh: Phospholipase A2 inhibitor; InterPro: IPR004126 Proteins in this entry inhibit basic phospholipase A2 isozymes in snake's venom [, ] Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>PF05444 DUF753: Protein of unknown function (DUF753); InterPro: IPR008472 This entry contains sequences which are repeated in several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>PF01684 ET: ET module; InterPro: IPR002603 The proteins in this entry have no known function, and are found in Caenorhabditis elegans and in Caenorhabditis briggsae Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
2l03_A74 LY-6/neurotoxin-like protein 1; LYNX1, acetylcholi 98.81
2j8b_A79 CD59 glycoprotein; lipid-binding protein, lipid-bi 98.78
3neq_A66 Muscarinic M1-toxin1, muscarinic toxin 1; chimeric 98.63
2h7z_B77 Irditoxin subunit B; three-finger toxin, neurotoxi 98.54
2h7z_A75 Irditoxin subunit A; three-finger toxin, neurotoxi 98.4
2pjy_C79 TGF-beta receptor type-1; ternary complex, three f 98.38
2jqp_A65 WEAK toxin 1; protein; NMR {Bungarus candidus} 98.36
1ff4_A65 Muscarinic toxin/acetylcholine receptor binding P; 98.34
1hc9_A74 Alpha-bungarotoxin; toxin/peptide, complex (toxin/ 98.34
2h5f_A77 Denmotoxin; three-finger toxin, neurotoxin, snake 98.32
2l5s_A88 TGF-beta receptor type-1; ALK5, transforming growt 98.28
1ywh_A313 Urokinase plasminogen activator surface receptor; 98.23
1vyc_A65 Bucain, neurotoxin; snake neurotoxin; NMR {Bungaru 98.2
1jgk_A66 Candoxin; beta sheet, snake venom protein, toxin; 98.16
1ntn_A72 Neurotoxin I; postsynaptic neurotoxin; 1.90A {Naja 98.16
1kba_A66 Kappa-bungarotoxin; 2.30A {Bungarus multicinctus} 98.1
1cvo_A62 Cardiotoxin V; cytotoxin; NMR {Naja atra} SCOP: g. 98.05
1mr6_A68 Neurotoxin; venom; NMR {Bungarus multicinctus} SCO 98.03
3era_A62 Erabutoxin A; snake neurotoxin, venom, postsynapti 97.87
3hh7_A65 Muscarinic toxin-like protein 3 homolog; haditoxin 97.83
3laq_U277 UPAR, U-PAR, urokinase plasminogen activator surfa 97.82
3laq_U277 UPAR, U-PAR, urokinase plasminogen activator surfa 97.82
1lsi_A66 LSIII; venom, multigene family, neurotoxin; NMR {L 97.78
1vb0_A61 Cobrotoxin B; short-chain neurotoxin, three-finger 97.76
3evs_C119 Bone morphogenetic protein receptor type-1B; ligan 97.75
3plc_A63 Beta-cardiotoxin OH-27; beta-sheet, novel cardioto 97.74
1ntx_A60 Alpha-neurotoxin; NMR {Dendroaspis polylepis polyl 97.72
2h62_C129 Bone morphogenetic protein receptor type IA; TGF-b 97.72
4aea_A71 Long neurotoxin 1; three-finger toxin, nicotinic a 97.68
1f94_A63 Bucandin; three-finger snake presynaptic neurotoxi 97.62
3vts_A61 Cytotoxin 1; three finger toxin, venom toxin; 2.43 97.56
2fd6_U276 Urokinase plasminogen activator surface receptor; 97.36
1ug4_A60 Cytotoxin 6, cardiotoxin VI; cobra, venom; 1.60A { 97.32
1tfs_A60 Toxin FS2; NMR {Dendroaspis polylepis polylepis} S 97.21
1fas_A61 Fasciculin 1; toxin; 1.80A {Dendroaspis angusticep 97.12
1ywh_A 313 Urokinase plasminogen activator surface receptor; 97.0
2fd6_U276 Urokinase plasminogen activator surface receptor; 96.72
4fao_C106 Serine/threonine-protein kinase receptor R3; TGF-b 96.66
1drs_A59 Dendroaspin; cell adhesion protein; NMR {Dendroasp 96.11
2h62_D98 ACVR2B protein; TGF-beta superfamily, ligand-recep 94.68
1bte_A97 Protein (activin receptor type II); serine kinase, 94.43
4fao_E124 Activin receptor type-2B; TGF-beta, CTK, cystine k 94.18
2hlr_A100 Bone morphogenetic protein receptor type-2; three- 93.84
>2l03_A LY-6/neurotoxin-like protein 1; LYNX1, acetylcholine receptor, endogenic neuromodulator, Thr toxins, signaling protein; NMR {Homo sapiens} Back     alignment and structure
Probab=98.81  E-value=3.1e-08  Score=61.22  Aligned_cols=72  Identities=22%  Similarity=0.434  Sum_probs=48.5

Q ss_pred             cceEEecCCCCCCCCCCCCCCCCCCccCCCCCCCCCcccccCCCCCCceEEEEEE-eCCceEEEEceecCcccCcccccc
Q psy10606          2 SIVCYQCNSAYDPRCGDPFDPYSLGTVNCSLLPIPENLLHKEYQTPVICRKIIQK-IYSKRRVVRGCGYINEERDDCYRR   80 (128)
Q Consensus         2 aL~CY~C~S~~~~~C~~~f~~~~~~~~~C~~~~~~~~l~~~~~~~~~~C~Ki~~~-~~g~~~v~R~C~~~~~~~~~C~~~   80 (128)
                      .|+||+|.+ ....|..        .+.|+.             ...+|.|.... .....+|.|+|+........    
T Consensus         1 ~L~C~~C~~-~~~~c~~--------~~~C~~-------------~~~~C~t~~~~~~~~~~~v~rgC~~~Cp~~~~----   54 (74)
T 2l03_A            1 MLDCHVCAY-NGDNCFN--------PMRCPA-------------MVAYCMTTRTYYTPTRMKVSKSCVPRCFETVY----   54 (74)
T ss_dssp             CCEEECEEE-SSSCCCC--------EEECCT-------------TCCEEEEEEEEEETTEEEEEEEEESCCCCCCC----
T ss_pred             CCEeeECCC-CCCcCCC--------CeEcCC-------------CCCEEEEEEEEccCCCceEeccccCcCcCCcc----
Confidence            489999996 3457754        478985             17889887553 33457889999976554321    


Q ss_pred             cccCC-ceeEEEeeCCCCCCC
Q psy10606         81 TGTFD-VDSTYCACKGDICNG  100 (128)
Q Consensus        81 ~~~~~-~~~~~C~C~~D~CN~  100 (128)
                      .+.+. .....| |++|+||+
T Consensus        55 ~~~~~~~~~v~C-C~tDlCN~   74 (74)
T 2l03_A           55 DGYSKHASTTSC-CQYDLCNG   74 (74)
T ss_dssp             CSSSCCSEEEEE-ECSTTTTC
T ss_pred             ccccccceEeEe-CCCCCCCC
Confidence            11111 246788 99999995



>2j8b_A CD59 glycoprotein; lipid-binding protein, lipid-binding protein MAC, membrane, GPI-anchor, complement, lipoprotein; 1.15A {Homo sapiens} SCOP: g.7.1.3 PDB: 2ux2_A 2uwr_A 1cdq_A 1cdr_A* 1cds_A* 2ofs_A 1erg_A 1erh_A Back     alignment and structure
>3neq_A Muscarinic M1-toxin1, muscarinic toxin 1; chimeric muscarinic toxin, HM1-muscarinic receptor, snake to green mamba; 1.25A {Dendroaspis angusticeps} PDB: 2vlw_A* 3fev_A 4do8_A Back     alignment and structure
>2h7z_B Irditoxin subunit B; three-finger toxin, neurotoxin, snake venom; 1.50A {Boiga irregularis} SCOP: g.7.1.1 Back     alignment and structure
>2h7z_A Irditoxin subunit A; three-finger toxin, neurotoxin, snake venom; 1.50A {Boiga irregularis} SCOP: g.7.1.1 Back     alignment and structure
>2pjy_C TGF-beta receptor type-1; ternary complex, three finger toxin, cytokine-cytokine recep complex; 3.00A {Homo sapiens} PDB: 3kfd_I Back     alignment and structure
>2jqp_A WEAK toxin 1; protein; NMR {Bungarus candidus} Back     alignment and structure
>1ff4_A Muscarinic toxin/acetylcholine receptor binding P; three fingers motif; 1.50A {Dendroaspis angusticeps} SCOP: g.7.1.1 Back     alignment and structure
>1hc9_A Alpha-bungarotoxin; toxin/peptide, complex (toxin/peptide), acetylcholine receptor mimitope, alpha-bungarotoxin, 3- finger; 1.8A {Bungarus multicinctus} SCOP: g.7.1.1 PDB: 2qc1_A* 1abt_A 1bxp_A 1haa_A 1haj_A 1hc9_B 1hoy_A 1idg_A 1idh_A 1idi_A 1idl_A 1ik8_A 1ikc_A 1jbd_A 1kc4_A 1kfh_A 1kl8_A 1l4w_A 1ljz_A 1rgj_A ... Back     alignment and structure
>2h5f_A Denmotoxin; three-finger toxin, neurotoxin, snake venom; 1.90A {Boiga dendrophila} SCOP: g.7.1.1 Back     alignment and structure
>2l5s_A TGF-beta receptor type-1; ALK5, transforming growth factor beta, type I receptor, SIGN protein; NMR {Homo sapiens} Back     alignment and structure
>1ywh_A Urokinase plasminogen activator surface receptor; UPAR, three-finger fold, protein-peptide complex, hydrolase; HET: ALC NAG FUC NDG BMA MAN; 2.70A {Homo sapiens} SCOP: g.7.1.3 g.7.1.3 g.7.1.3 Back     alignment and structure
>1vyc_A Bucain, neurotoxin; snake neurotoxin; NMR {Bungarus candidus} SCOP: g.7.1.1 PDB: 2h8u_A Back     alignment and structure
>1jgk_A Candoxin; beta sheet, snake venom protein, toxin; NMR {Bungarus candidus} SCOP: g.7.1.1 Back     alignment and structure
>1ntn_A Neurotoxin I; postsynaptic neurotoxin; 1.90A {Naja oxiana} SCOP: g.7.1.1 PDB: 1w6b_A Back     alignment and structure
>1kba_A Kappa-bungarotoxin; 2.30A {Bungarus multicinctus} SCOP: g.7.1.1 PDB: 2nbt_A Back     alignment and structure
>1cvo_A Cardiotoxin V; cytotoxin; NMR {Naja atra} SCOP: g.7.1.1 PDB: 1kxi_A Back     alignment and structure
>1mr6_A Neurotoxin; venom; NMR {Bungarus multicinctus} SCOP: g.7.1.1 Back     alignment and structure
>3era_A Erabutoxin A; snake neurotoxin, venom, postsynaptic neurotoxin; 1.70A {Laticauda semifasciata} SCOP: g.7.1.1 PDB: 2era_A Back     alignment and structure
>3hh7_A Muscarinic toxin-like protein 3 homolog; haditoxin, three finger toxin, snake venom, neurotoxin, nicotinic acetylcholine receptors; 1.55A {Ophiophagus hannah} SCOP: g.7.1.0 Back     alignment and structure
>3laq_U UPAR, U-PAR, urokinase plasminogen activator surface receptor; ATF, supar, smupar, MATF, disulfide bond, EGF-LIK hydrolase, kringle; HET: NAG; 3.20A {Mus musculus} Back     alignment and structure
>3laq_U UPAR, U-PAR, urokinase plasminogen activator surface receptor; ATF, supar, smupar, MATF, disulfide bond, EGF-LIK hydrolase, kringle; HET: NAG; 3.20A {Mus musculus} Back     alignment and structure
>1lsi_A LSIII; venom, multigene family, neurotoxin; NMR {Laticauda semifasciata} SCOP: g.7.1.1 Back     alignment and structure
>1vb0_A Cobrotoxin B; short-chain neurotoxin, three-finger toxin; HET: SO4; 0.92A {Naja atra} SCOP: g.7.1.1 PDB: 1onj_A* 1je9_A 1nor_A 1iq9_A 1nea_A 3nds_A 1cod_A 1coe_A 1v6p_A 1g6m_A 1qkd_A 1qke_A 5ebx_A 1era_A 1fra_A 3ebx_A 6ebx_A 1nxb_A Back     alignment and structure
>3evs_C Bone morphogenetic protein receptor type-1B; ligand-receptor complex, cystin-knot ligand, three-finger to (receptor); 2.10A {Mus musculus} Back     alignment and structure
>3plc_A Beta-cardiotoxin OH-27; beta-sheet, novel cardiotoxin; 2.41A {Ophiophagus hannah} SCOP: g.7.1.1 Back     alignment and structure
>1ntx_A Alpha-neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.7.1.1 Back     alignment and structure
>2h62_C Bone morphogenetic protein receptor type IA; TGF-beta superfamily, ligand-receptor complex, hormone/growth factor complex; 1.85A {Homo sapiens} SCOP: g.7.1.3 PDB: 2h64_B 3nh7_A 1rew_C 3qb4_B 2goo_B* 2qj9_D 2qja_C 2qjb_C 2k3g_A 1es7_B Back     alignment and structure
>4aea_A Long neurotoxin 1; three-finger toxin, nicotinic acetylcholine receptor; 1.94A {Naja kaouthia} SCOP: g.7.1.1 PDB: 1lxg_A 1lxh_A 1yi5_F 1ctx_A 2ctx_A 1txa_A 1txb_A Back     alignment and structure
>1f94_A Bucandin; three-finger snake presynaptic neurotoxin; 0.97A {Bungarus candidus} SCOP: g.7.1.1 PDB: 1ijc_A Back     alignment and structure
>3vts_A Cytotoxin 1; three finger toxin, venom toxin; 2.43A {Hemachatus haemachatus} Back     alignment and structure
>2fd6_U Urokinase plasminogen activator surface receptor; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.7.1.3 g.7.1.3 g.7.1.3 PDB: 3bt2_U* 3bt1_U* 2i9b_E* 3u74_U* 3u73_U* Back     alignment and structure
>1ug4_A Cytotoxin 6, cardiotoxin VI; cobra, venom; 1.60A {Naja atra} PDB: 1h0j_A* 1i02_A 1xt3_A* 2bhi_A* 2crs_A 2crt_A 1cxn_A 1cxo_A 1tgx_A 1cb9_A 1ccq_A 1ffj_A 1chv_S 2ccx_A 1cre_A 1crf_A 1kbs_A 1kbt_A 1rl5_A 1zad_A ... Back     alignment and structure
>1tfs_A Toxin FS2; NMR {Dendroaspis polylepis polylepis} SCOP: g.7.1.1 Back     alignment and structure
>1fas_A Fasciculin 1; toxin; 1.80A {Dendroaspis angusticeps} SCOP: g.7.1.1 PDB: 1fsc_A 1f8u_B* 1b41_B 1fss_B* 1ku6_B* 1mah_F* 2x8b_B* 1qm7_A Back     alignment and structure
>1ywh_A Urokinase plasminogen activator surface receptor; UPAR, three-finger fold, protein-peptide complex, hydrolase; HET: ALC NAG FUC NDG BMA MAN; 2.70A {Homo sapiens} SCOP: g.7.1.3 g.7.1.3 g.7.1.3 Back     alignment and structure
>2fd6_U Urokinase plasminogen activator surface receptor; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.7.1.3 g.7.1.3 g.7.1.3 PDB: 3bt2_U* 3bt1_U* 2i9b_E* 3u74_U* 3u73_U* Back     alignment and structure
>4fao_C Serine/threonine-protein kinase receptor R3; TGF-beta, CTK, cystine knot, extracellular domain, signaling protein-signaling protein complex; HET: NAG; 3.36A {Homo sapiens} PDB: 2lcr_A Back     alignment and structure
>1drs_A Dendroaspin; cell adhesion protein; NMR {Dendroaspis jamesoni kaimosae} SCOP: g.7.1.2 PDB: 2la1_A Back     alignment and structure
>2h62_D ACVR2B protein; TGF-beta superfamily, ligand-receptor complex, hormone/growth factor complex; 1.85A {Homo sapiens} SCOP: g.7.1.3 PDB: 1nys_A 1nyu_A 2h64_C 1s4y_A Back     alignment and structure
>1bte_A Protein (activin receptor type II); serine kinase, ligand binding domain, three-finger transferase; HET: NAG; 1.50A {Mus musculus} SCOP: g.7.1.3 PDB: 2goo_C* 1lx5_B* Back     alignment and structure
>4fao_E Activin receptor type-2B; TGF-beta, CTK, cystine knot, extracellular domain, signaling protein-signaling protein complex; HET: NAG; 3.36A {Homo sapiens} Back     alignment and structure
>2hlr_A Bone morphogenetic protein receptor type-2; three-finger toxin, BMP receptor, TGF-beta, transferase; 1.20A {Ovis aries} PDB: 2hlq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d2h62c184 BMP receptor Ia ectodomain {Human (Homo sapiens) [ 97.88
d1ff4a_65 Muscarinic toxin {Green mamba (Dendroaspis angusti 97.74
d2h8ua165 Bucain {Malaysian krait (Bungarus candidus) [TaxId 97.57
d1kxia_62 Cardiotoxin V {Taiwan cobra (Naja naja atra) [TaxI 97.54
d1jgka_66 Candoxin {Malayan krait (Bungarus candidus) [TaxId 97.34
d1mr6a_68 Bungarotoxin {Many-banded krait (Bungarus multicin 97.28
d2j8ba177 CD59 {Human (Homo sapiens) [TaxId: 9606]} 97.27
d2fd6u180 Urokinase plasminogen activator surface receptor, 97.21
d2fd6u287 Urokinase plasminogen activator surface receptor, 97.2
d1tgxa_60 gamma-Cardiotoxin {Snake (Naja nigricollis) [TaxId 97.0
d1ntna_72 Neurotoxin I {Snake (Naja naja oxiana) [TaxId: 865 96.87
d2h7zb177 Irditoxin subunit B {Brown tree snake (Boiga irreg 96.25
d1hc9a_74 Bungarotoxin {Many-banded krait (Bungarus multicin 96.11
d1v6pa_62 Cobrotoxin II (ct2) {Taiwan cobra (Naja naja atra) 95.86
d2h5fa175 Denmotoxin {Mangrove snake (Boiga dendrophila) [Ta 95.6
d2h7za175 Irditoxin subunit A {Brown tree snake (Boiga irreg 95.58
d3ebxa_62 Erabutoxin B (also neurotoxin B) {Sea snake (Latic 95.42
d1btea_96 Type II activin receptor {Mouse (Mus musculus) [Ta 95.01
d2h62d191 Type II activin receptor {Mouse (Mus musculus), is 94.95
d1kbaa_66 Bungarotoxin {Many-banded krait (Bungarus multicin 94.73
d1lsia_66 Long neurotoxin 1 (component LSIII) {Sea snake (La 94.44
d2fd6u397 Urokinase plasminogen activator surface receptor, 93.68
d1ntxa_60 alpha-Toxin {Black mamba (Dendroaspis polylepis po 92.79
d1tfsa_60 FS2 toxin {Black mamba (Dendroaspis polylepis poly 91.31
d2ctxa_71 alpha-Cobratoxin {Cobra (Naja siamensis) [TaxId: 8 90.27
d1fasa_61 Fasciculin {Green mamba (Dendroaspis angusticeps) 89.01
d1f94a_63 Bucandin {Malayan krait (Bungarus candidus) [TaxId 88.48
d1drsa_59 Dendroaspin {Dendroaspis jamesoni kaimosae [TaxId: 86.77
>d2h62c1 g.7.1.3 (C:34-117) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Snake toxin-like
superfamily: Snake toxin-like
family: Extracellular domain of cell surface receptors
domain: BMP receptor Ia ectodomain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.88  E-value=7.1e-06  Score=50.44  Aligned_cols=56  Identities=18%  Similarity=0.333  Sum_probs=37.8

Q ss_pred             CCceEEEEEEe-CCceEEEEceecCcccCcccccccccCCceeEEEeeCCCCCCCCCC
Q psy10606         47 PVICRKIIQKI-YSKRRVVRGCGYINEERDDCYRRTGTFDVDSTYCACKGDICNGSPS  103 (128)
Q Consensus        47 ~~~C~Ki~~~~-~g~~~v~R~C~~~~~~~~~C~~~~~~~~~~~~~C~C~~D~CN~a~~  103 (128)
                      ...|.+.++.. +|+..+.+||.........|+............| |++|+||.-..
T Consensus        23 ~g~Cf~s~~~~~~g~~~~~~GCl~~~~~~~~C~~~~~~~~~~~~~C-C~~D~CN~~l~   79 (84)
T d2h62c1          23 NGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIEC-CRTNLCNQYLQ   79 (84)
T ss_dssp             SSEEEEEEEECSSSCEEEEEEEECSTTHHHHHHCCTTCSSCEEEEE-ECSTTGGGGCC
T ss_pred             CCEEeEEEEEcCCCcEEEEEcCCCCCCCceEeCCCCCCCCceEEEe-CCCCccCcCCc
Confidence            67799998875 5677888999864221126765443333445566 99999997543



>d1ff4a_ g.7.1.1 (A:) Muscarinic toxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d2h8ua1 g.7.1.1 (A:1-65) Bucain {Malaysian krait (Bungarus candidus) [TaxId: 92438]} Back     information, alignment and structure
>d1kxia_ g.7.1.1 (A:) Cardiotoxin V {Taiwan cobra (Naja naja atra) [TaxId: 8656]} Back     information, alignment and structure
>d1jgka_ g.7.1.1 (A:) Candoxin {Malayan krait (Bungarus candidus) [TaxId: 92438]} Back     information, alignment and structure
>d1mr6a_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), gamma-bungarotoxin [TaxId: 8616]} Back     information, alignment and structure
>d2j8ba1 g.7.1.3 (A:1-77) CD59 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fd6u1 g.7.1.3 (U:1-80) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fd6u2 g.7.1.3 (U:189-275) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tgxa_ g.7.1.1 (A:) gamma-Cardiotoxin {Snake (Naja nigricollis) [TaxId: 8654]} Back     information, alignment and structure
>d1ntna_ g.7.1.1 (A:) Neurotoxin I {Snake (Naja naja oxiana) [TaxId: 8657]} Back     information, alignment and structure
>d2h7zb1 g.7.1.1 (B:1-77) Irditoxin subunit B {Brown tree snake (Boiga irregularis) [TaxId: 92519]} Back     information, alignment and structure
>d1hc9a_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]} Back     information, alignment and structure
>d1v6pa_ g.7.1.1 (A:) Cobrotoxin II (ct2) {Taiwan cobra (Naja naja atra) [TaxId: 8656]} Back     information, alignment and structure
>d2h5fa1 g.7.1.1 (A:3-77) Denmotoxin {Mangrove snake (Boiga dendrophila) [TaxId: 46286]} Back     information, alignment and structure
>d2h7za1 g.7.1.1 (A:1-75) Irditoxin subunit A {Brown tree snake (Boiga irregularis) [TaxId: 92519]} Back     information, alignment and structure
>d3ebxa_ g.7.1.1 (A:) Erabutoxin B (also neurotoxin B) {Sea snake (Laticauda semifasciata) [TaxId: 8631]} Back     information, alignment and structure
>d1btea_ g.7.1.3 (A:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h62d1 g.7.1.3 (D:8-98) Type II activin receptor {Mouse (Mus musculus), isoform IIB [TaxId: 10090]} Back     information, alignment and structure
>d1kbaa_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), kappa-bungarotoxin [TaxId: 8616]} Back     information, alignment and structure
>d1lsia_ g.7.1.1 (A:) Long neurotoxin 1 (component LSIII) {Sea snake (Laticauda semifasciata) [TaxId: 8631]} Back     information, alignment and structure
>d2fd6u3 g.7.1.3 (U:92-188) Urokinase plasminogen activator surface receptor, UPAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntxa_ g.7.1.1 (A:) alpha-Toxin {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Back     information, alignment and structure
>d1tfsa_ g.7.1.1 (A:) FS2 toxin {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Back     information, alignment and structure
>d2ctxa_ g.7.1.1 (A:) alpha-Cobratoxin {Cobra (Naja siamensis) [TaxId: 84476]} Back     information, alignment and structure
>d1fasa_ g.7.1.1 (A:) Fasciculin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Back     information, alignment and structure
>d1f94a_ g.7.1.1 (A:) Bucandin {Malayan krait (Bungarus candidus) [TaxId: 92438]} Back     information, alignment and structure
>d1drsa_ g.7.1.2 (A:) Dendroaspin {Dendroaspis jamesoni kaimosae [TaxId: 8619]} Back     information, alignment and structure