Psyllid ID: psy10623

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MRGWNSLDEENESSEKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTFARMKNEMKSGRRIANVSFLTLILFSLKSGEELSVTKIILPYSAVLCVRESGSPMNQIVSQMMDADKKKMMYERLNRDLLEYLPVYHARKNNLFDS
ccccccccccccHHHHccHHHHHHHHHHHHHccccccEEccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
ccccEEEEEcccccccccHHHHHHHHHHHHcccccccccccccHHHcccHHHHHHHHHHcHHHccHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccccccEEEcccEEEEEccHHHHHHHHHcccc
mrgwnsldeenessekksAKDALLLWCQrktngypgvniqdftgswrsglgFNALihahrpdlidfsqlqptrhidnlnnafdvastelgiprlldaedvdttrpdekSVITYVASYYHTFARMKNEMKSGRRIANVSFLTLILFSLksgeelsvtkIILPYSAVLCvresgspmnQIVSQMMDADKKKMMYERLNRDLLEYLPVyharknnlfds
mrgwnsldeenessekksaKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVAstelgiprlldaedvdttrpdeksviTYVASYYHTFARMKNEMKSGRRIANVSFLTLILFSLKSGEELSVTKIILPYSAVLCVRESGSPMNQIVSQMMDADKKKMMYERLNRDLLeylpvyharknnlfds
MRGWnsldeenessekksakdalllWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTFARMKNEMKSGRRIANVSFLTLILFSLKSGEELSVTKIILPYSAVLCVRESGSPMNQIVSQMMDADKKKMMYERLNRDLLEYLPVYHARKNNLFDS
*********************ALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVASTELGIPRLLDAEDVDTT**DEKSVITYVASYYHTFARMKNEMKSGRRIANVSFLTLILFSLKSGEELSVTKIILPYSAVLCVRE*******************MMYERLNRDLLEYLPVYHAR*******
*********************ALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTF***************VSFLTLILFSLKSGEELSVTKIILPYSAVLC*****************ADKKKMMYERLNRDLLEYLPVYHARK*N****
*******************KDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTFARMKNEMKSGRRIANVSFLTLILFSLKSGEELSVTKIILPYSAVLCVRESGSPMNQIVSQMMDADKKKMMYERLNRDLLEYLPVYHARKNNLFDS
*RGWNSLDEENESSEKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTFARMKNEMKSGRRIANVSFLTLILFSLKSGEELSVTKIILPYSAVLCVRESGSPMNQIVSQMMDADKKKMMYERLNRDLLEYLPVYHARKNNLFD*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGWNSLDEENESSEKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTFARMKNEMKSGRRIANVSFLTLILFSLKSGEELSVTKIILPYSAVLCVRESGSPMNQIVSQMMDADKKKMMYERLNRDLLEYLPVYHARKNNLFDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query216 2.2.26 [Sep-21-2011]
Q00963 2291 Spectrin beta chain OS=Dr no N/A 0.597 0.056 0.612 2e-43
Q62261 2363 Spectrin beta chain, non- no N/A 0.597 0.054 0.589 3e-41
Q01082 2364 Spectrin beta chain, non- no N/A 0.597 0.054 0.589 3e-41
O15020 2390 Spectrin beta chain, non- no N/A 0.597 0.053 0.589 1e-40
Q9QWN8 2388 Spectrin beta chain, non- no N/A 0.597 0.054 0.589 2e-40
P15508 2128 Spectrin beta chain, eryt no N/A 0.587 0.059 0.590 8e-40
Q9H254 2564 Spectrin beta chain, non- no N/A 0.597 0.050 0.596 3e-39
P11277 2137 Spectrin beta chain, eryt no N/A 0.587 0.059 0.582 7e-39
P57780 912 Alpha-actinin-4 OS=Mus mu no N/A 0.578 0.137 0.539 4e-35
A5D7D1 911 Alpha-actinin-4 OS=Bos ta no N/A 0.578 0.137 0.539 4e-35
>sp|Q00963|SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster GN=beta-Spec PE=1 SV=2 Back     alignment and function desciption
 Score =  175 bits (443), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 96/129 (74%)

Query: 9   EENESSEKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQ 68
           EE ++ E KSAKDALLLWCQ KT GY  VN+++FT SWR GL FNA+IH HRPDL+ F +
Sbjct: 161 EEVDNKETKSAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEK 220

Query: 69  LQPTRHIDNLNNAFDVASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTFARMKNEM 128
           L  T  I NLNNAFDVA  +LG+ +LLDAEDV    PDEKS+ITYV +YYH F+++K E 
Sbjct: 221 LSKTNAIHNLNNAFDVAEDKLGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQET 280

Query: 129 KSGRRIANV 137
             G+RI  V
Sbjct: 281 VQGKRIGKV 289
Spectrin is the major constituent of the cytoskeletal network underlying the erythrocyte plasma membrane. It associates with band 4.1 and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane. Interacts with calmodulin in a calcium-dependent manner.
Drosophila melanogaster (taxid: 7227)
>sp|Q62261|SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus GN=Sptbn1 PE=1 SV=2 Back     alignment and function description
>sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2 Back     alignment and function description
>sp|O15020|SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3 Back     alignment and function description
>sp|Q9QWN8|SPTN2_RAT Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus GN=Sptbn2 PE=1 SV=2 Back     alignment and function description
>sp|P15508|SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus GN=Sptb PE=1 SV=4 Back     alignment and function description
>sp|Q9H254|SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2 Back     alignment and function description
>sp|P11277|SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5 Back     alignment and function description
>sp|P57780|ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus GN=Actn4 PE=1 SV=1 Back     alignment and function description
>sp|A5D7D1|ACTN4_BOVIN Alpha-actinin-4 OS=Bos taurus GN=ACTN4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
340717274 4143 PREDICTED: spectrin beta chain, brain 4- 0.731 0.038 0.658 8e-70
340717276 4224 PREDICTED: spectrin beta chain, brain 4- 0.731 0.037 0.658 1e-69
345481110 4271 PREDICTED: spectrin beta chain, brain 1- 0.722 0.036 0.664 2e-69
383856370 4280 PREDICTED: spectrin beta chain, brain 4- 0.731 0.036 0.653 4e-69
380030708 4164 PREDICTED: LOW QUALITY PROTEIN: spectrin 0.731 0.037 0.653 4e-69
350407651 4247 PREDICTED: spectrin beta chain, brain 4- 0.731 0.037 0.653 5e-69
328777761 4216 PREDICTED: spectrin beta chain [Apis mel 0.731 0.037 0.653 5e-69
242020108 4215 Spectrin beta chain, putative [Pediculus 0.722 0.037 0.654 5e-68
427793723 3165 hypothetical protein, partial [Rhipiceph 0.745 0.050 0.623 2e-67
427798219 3912 hypothetical protein, partial [Rhipiceph 0.745 0.041 0.623 2e-67
>gi|340717274|ref|XP_003397110.1| PREDICTED: spectrin beta chain, brain 4-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 131/199 (65%), Positives = 148/199 (74%), Gaps = 41/199 (20%)

Query: 7   LDEENESSEKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDF 66
           +DEEN+SSEKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDL+D+
Sbjct: 135 VDEENDSSEKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLVDW 194

Query: 67  SQLQPTRHIDNLNNAFDVASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTFARMKN 126
           S+LQ  ++IDNLN AFDVA++ELGIPRLLDAEDVDT RPDEKS+ITYVASYYHTFARMKN
Sbjct: 195 SELQQNKNIDNLNYAFDVANSELGIPRLLDAEDVDTARPDEKSIITYVASYYHTFARMKN 254

Query: 127 EMKSGRRIANVSFLTLILFSLKSGEELSVTKIILPYSAVLCVRESGSPMNQIVSQMMDAD 186
           E+KSG+RIAN                                         IV QMMDAD
Sbjct: 255 EIKSGKRIAN-----------------------------------------IVGQMMDAD 273

Query: 187 KKKMMYERLNRDLLEYLPV 205
           K K+ YE+L  DLLE++ +
Sbjct: 274 KMKIHYEKLTTDLLEWIKM 292

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340717276|ref|XP_003397111.1| PREDICTED: spectrin beta chain, brain 4-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|345481110|ref|XP_001606391.2| PREDICTED: spectrin beta chain, brain 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383856370|ref|XP_003703682.1| PREDICTED: spectrin beta chain, brain 4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380030708|ref|XP_003698985.1| PREDICTED: LOW QUALITY PROTEIN: spectrin beta chain, brain 4-like [Apis florea] Back     alignment and taxonomy information
>gi|350407651|ref|XP_003488149.1| PREDICTED: spectrin beta chain, brain 4-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328777761|ref|XP_396777.4| PREDICTED: spectrin beta chain [Apis mellifera] Back     alignment and taxonomy information
>gi|242020108|ref|XP_002430498.1| Spectrin beta chain, putative [Pediculus humanus corporis] gi|212515655|gb|EEB17760.1| Spectrin beta chain, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|427793723|gb|JAA62313.1| hypothetical protein, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427798219|gb|JAA64561.1| hypothetical protein, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
FB|FBgn0004167 4337 kst "karst" [Drosophila melano 0.518 0.025 0.736 2.6e-48
WB|WBGene00004855 4166 sma-1 [Caenorhabditis elegans 0.518 0.026 0.696 2.1e-39
WB|WBGene00006803 2326 unc-70 [Caenorhabditis elegans 0.518 0.048 0.553 1.6e-34
FB|FBgn0250788 2291 beta-Spec "beta Spectrin" [Dro 0.518 0.048 0.598 3.1e-34
UNIPROTKB|F1NV58 3622 SPTBN5 "Uncharacterized protei 0.620 0.036 0.537 5.1e-33
UNIPROTKB|G3N3E8 1948 LOC531014 "Uncharacterized pro 0.518 0.057 0.571 1.4e-31
UNIPROTKB|J9NT02 935 SPTBN2 "Uncharacterized protei 0.518 0.119 0.571 1.5e-31
ZFIN|ZDB-GENE-081031-8 1226 si:ch73-262h23.4 "si:ch73-262h 0.518 0.091 0.580 1.6e-31
UNIPROTKB|F8W6C1 690 SPTBN1 "Spectrin beta chain, n 0.518 0.162 0.571 2.3e-31
UNIPROTKB|J9NSY0 625 SPTBN4 "Uncharacterized protei 0.518 0.179 0.598 2.7e-31
FB|FBgn0004167 kst "karst" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 472 (171.2 bits), Expect = 2.6e-48, Sum P(2) = 2.6e-48
 Identities = 84/114 (73%), Positives = 101/114 (88%)

Query:    26 WCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRH--IDNLNNAFD 83
             WCQRKT+GYPGVNI DFT SWRSGLGFNALIH+HRPDL ++S +  +++  +DNLN+AFD
Sbjct:   205 WCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFD 264

Query:    84 VASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTFARMKNEMKSGRRIANV 137
              A+ ELGIP LLDAED+D+ RPDEKS++TYVASYYHTFARMKNE KSG+RIAN+
Sbjct:   265 TAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANI 318
GO:0030707 "ovarian follicle cell development" evidence=TAS
GO:0007009 "plasma membrane organization" evidence=TAS
GO:0003779 "actin binding" evidence=ISS;IDA
GO:0008017 "microtubule binding" evidence=IDA
GO:0008092 "cytoskeletal protein binding" evidence=ISS
GO:0008091 "spectrin" evidence=ISS
GO:0016327 "apicolateral plasma membrane" evidence=TAS
GO:0045186 "zonula adherens assembly" evidence=TAS
GO:0000910 "cytokinesis" evidence=IMP
GO:0005543 "phospholipid binding" evidence=IEA
GO:0006897 "endocytosis" evidence=IMP
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0005912 "adherens junction" evidence=IDA
GO:0032432 "actin filament bundle" evidence=IDA
GO:0042060 "wound healing" evidence=IMP
GO:0010797 "regulation of multivesicular body size involved in endosome transport" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0032509 "endosome transport via multivesicular body sorting pathway" evidence=IMP
WB|WBGene00004855 sma-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00006803 unc-70 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0250788 beta-Spec "beta Spectrin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV58 SPTBN5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3N3E8 LOC531014 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NT02 SPTBN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081031-8 si:ch73-262h23.4 "si:ch73-262h23.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F8W6C1 SPTBN1 "Spectrin beta chain, non-erythrocytic 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSY0 SPTBN4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O13728AIN1_SCHPONo assigned EC number0.51610.56480.1964yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
pfam00307104 pfam00307, CH, Calponin homology (CH) domain 3e-32
COG5069 612 COG5069, SAC6, Ca2+-binding actin-bundling protein 4e-30
cd00014107 cd00014, CH, Calponin homology domain; actin-bindi 7e-28
smart00033101 smart00033, CH, Calponin homology domain 1e-23
pfam1197185 pfam11971, CAMSAP_CH, CAMSAP CH domain 0.001
>gnl|CDD|215849 pfam00307, CH, Calponin homology (CH) domain Back     alignment and domain information 
 Score =  112 bits (282), Expect = 3e-32
 Identities = 35/104 (33%), Positives = 56/104 (53%), Gaps = 3/104 (2%)

Query: 20  KDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTR--HIDN 77
           + ALL W       Y G+ + +F    R GL   AL++  RP LID  ++   R   ++N
Sbjct: 1   EKALLRWINEVLGEYGGLPVTNFFEDLRDGLALCALLNKLRPGLIDLKKVNKNRFDKLEN 60

Query: 78  LNNAFDVASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTF 121
           LN A + A  +LG+P++L+ ED+     +EK V+T +A  +  F
Sbjct: 61  LNLALEFAEKKLGVPKVLEPEDLV-EDGNEKLVLTLLAQLFRRF 103

The CH domain is found in both cytoskeletal proteins and signal transduction proteins. The CH domain is involved in actin binding in some members of the family. However in calponins there is evidence that the CH domain is not involved in its actin binding activity. Most member proteins have from two to four copies of the CH domain, however some proteins such as calponin have only a single copy. Length = 104
>gnl|CDD|227401 COG5069, SAC6, Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|237981 cd00014, CH, Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>gnl|CDD|214479 smart00033, CH, Calponin homology domain Back     alignment and domain information
>gnl|CDD|221350 pfam11971, CAMSAP_CH, CAMSAP CH domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 216
KOG0517|consensus 2473 100.0
KOG0035|consensus 890 99.98
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 99.93
PF00307108 CH: Calponin homology (CH) domain; InterPro: IPR00 99.82
KOG0046|consensus 627 99.81
cd00014107 CH Calponin homology domain; actin-binding domain 99.78
smart00033103 CH Calponin homology domain. Actin binding domains 99.7
PF1197185 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 T 99.29
COG5069 612 SAC6 Ca2+-binding actin-bundling protein fimbrin/p 98.44
KOG0035|consensus 890 98.26
KOG0046|consensus627 97.77
PF06294158 DUF1042: Domain of Unknown Function (DUF1042); Int 96.92
KOG0518|consensus 1113 95.79
KOG3631|consensus365 95.25
KOG2046|consensus193 94.08
KOG3000|consensus295 88.76
KOG2996|consensus 865 83.55
>KOG0517|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.1e-55  Score=444.62  Aligned_cols=162  Identities=53%  Similarity=0.920  Sum_probs=157.5

Q ss_pred             ccccccCCCHHHHHHHHHHHhhCCCCCcccCCCCCccccchhhHHHHHHhCCCCCCCCCCCcccHHhhHHHHHHHHHHhc
Q psy10623         10 ENESSEKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVASTEL   89 (216)
Q Consensus        10 ~~~~~~~~sak~~LL~Wcq~~t~~Y~~v~V~nFstSW~DG~Af~ALIh~~rPdlid~~~L~~~~~~enl~~Af~vAe~~L   89 (216)
                      +++..|++|||++||.|||++|+|||||+|+|||+||+||+||+||||+|||||+||++|.++++.+|++.||++||++|
T Consensus       159 ~edn~E~rSAKDALLLWCQmKTAGYpnVNI~nFTtSWRdGLaFNALIHkHRPDLvDf~~L~k~na~~NL~~AFdvAE~~L  238 (2473)
T KOG0517|consen  159 TEDNRETRSAKDALLLWCQMKTAGYPNVNITNFTTSWRDGLAFNALIHKHRPDLVDFDKLKKSNALYNLQHAFDVAEQEL  238 (2473)
T ss_pred             cccchhhhhHHHHHHHHHHhhccCCCCcccccCccchhcchhHHHHHHhcCcchhhhcccCCCchhhHHHHHHHHHHHHc
Confidence            34567999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCcccCCCCCCChhHHHHHHHHHHHHhhhcchhhhhcccccchhhhHHHHHhhccccchhhhhcccCcccccccc
Q psy10623         90 GIPRLLDAEDVDTTRPDEKSVITYVASYYHTFARMKNEMKSGRRIANVSFLTLILFSLKSGEELSVTKIILPYSAVLCVR  169 (216)
Q Consensus        90 gIp~lLdpeDv~~~~pDeksimtYvs~~y~~f~~~~~~~~~~~ri~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  169 (216)
                      ||+++||||||.+..||||||||||+.|||||++|+...+.||||+|                                 
T Consensus       239 Gia~LLDpEDV~v~~PDEKSIITYV~~YYHyFsKmK~~~v~gKRIgk---------------------------------  285 (2473)
T KOG0517|consen  239 GIAKLLDPEDVNVEQPDEKSIITYVVTYYHYFSKMKQLAVEGKRIGK---------------------------------  285 (2473)
T ss_pred             CchhcCCHhhcCccCCCcchHHHHHHHHHHHHHHHHHHHhhhhHHHH---------------------------------
Confidence            99999999999999999999999999999999999999999999999                                 


Q ss_pred             cCCCCchhHHHhhhhHHHHHHHHHHHHHHHHHhHHHHHHHhhh
Q psy10623        170 ESGSPMNQIVSQMMDADKKKMMYERLNRDLLEYLPVYHARKNN  212 (216)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~l~~~ye~~~~~ll~wi~~~~~~~~~  212 (216)
                              |++++|++++|+++||.++++||+||++||-.+|+
T Consensus       286 --------Vl~~lme~ekm~~~YE~LasdLL~WI~~ti~~L~~  320 (2473)
T KOG0517|consen  286 --------VLDQLMETEKMIEQYEGLASDLLEWIEQTIQTLES  320 (2473)
T ss_pred             --------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence                    67899999999999999999999999999999886

>KOG0035|consensus Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>PF00307 CH: Calponin homology (CH) domain; InterPro: IPR001715 The calponin homology domain (also known as CH-domain) is a superfamily of actin-binding domains found in both cytoskeletal proteins and signal transduction proteins [] Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>cd00014 CH Calponin homology domain; actin-binding domain which may be present as a single copy or in tandem repeats (which increases binding affinity) Back     alignment and domain information
>smart00033 CH Calponin homology domain Back     alignment and domain information
>PF11971 CAMSAP_CH: CAMSAP CH domain; InterPro: IPR022613 This domain is the N-terminal CH domain from calmodulin-regulated spectrin-associated proteins - CAMSAP proteins Back     alignment and domain information
>COG5069 SAC6 Ca2+-binding actin-bundling protein fimbrin/plastin (EF-Hand superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF06294 DUF1042: Domain of Unknown Function (DUF1042); InterPro: IPR010441 This is a family of proteins of unknown function Back     alignment and domain information
>KOG0518|consensus Back     alignment and domain information
>KOG3631|consensus Back     alignment and domain information
>KOG2046|consensus Back     alignment and domain information
>KOG3000|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
1wyq_A127 Solution Structure Of The Second Ch Domain Of Human 2e-34
1bkr_A109 Calponin Homology (Ch) Domain From Human Beta-Spect 3e-33
1aa2_A108 Calponin Homology (Ch) Domain From Human Beta-Spect 4e-33
2eyi_A234 Crystal Structure Of The Actin-Binding Domain Of Hu 5e-31
2r0o_A237 Crystal Structure Of The Actin-Binding Domain Of Hu 1e-30
1sjj_A 863 Cryo-Em Structure Of Chicken Gizzard Smooth Muscle 2e-30
1tjt_A250 X-Ray Structure Of The Human Alpha-Actinin Isoform 3e-29
1wku_A254 High Resolution Structure Of The Human Alpha-Actini 3e-29
3f7p_A296 Crystal Structure Of A Complex Between Integrin Bet 4e-25
1mb8_A243 Crystal Structure Of The Actin Binding Domain Of Pl 4e-25
1sh5_A245 Crystal Structure Of Actin-Binding Domain Of Mouse 6e-25
1dxx_A246 N-Terminal Actin-Binding Domain Of Human Dystrophin 3e-22
2d88_A121 Solution Structure Of The Ch Domain From Human Mica 1e-20
1bhd_A118 Second Calponin Homology Domain From Utrophin Lengt 4e-19
2e9k_A121 Solution Structure Of The Ch Domain From Human Mica 6e-19
1qag_A226 Actin Binding Region Of The Dystrophin Homologue Ut 1e-18
2d87_A128 Solution Structure Of The Ch Domain From Human Smoo 4e-18
2d89_A119 Solution Structure Of The Ch Domain From Human Eh D 6e-15
2jv9_A119 The Solution Structure Of Calponin Homology Domain 7e-15
2dk9_A118 Solution Structure Of Calponin Homology Domain Of H 4e-14
1wyl_A116 Solution Structure Of The Ch Domain Of Human Nedd9 2e-13
2wa6_A245 Structure Of The W148r Mutant Of Human Filamin B Ac 9e-08
2wa5_A245 Crystal Structure Of Human Filamin B Actin Binding 1e-07
4b7l_A347 Crystal Structure Of Human Filamin B Actin Binding 2e-07
2wa7_A245 Structure Of The M202v Mutant Of Human Filamin B Ac 2e-07
3hop_A272 Structure Of The Actin-Binding Domain Of Human Fila 4e-07
2wfn_A278 Filamin A Actin Binding Domain Length = 278 4e-07
3fer_A262 Crystal Structure Of N-Terminal Actin-Binding Domai 6e-07
3hoc_A272 Structure Of The Actin-Binding Domain Of Human Fila 1e-06
>pdb|1WYQ|A Chain A, Solution Structure Of The Second Ch Domain Of Human Spectrin Beta Chain, Brain 2 Length = 127 Back     alignment and structure 
Iteration: 1

 Score =  141 bits (356), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 64/109 (58%), Positives = 80/109 (73%), Gaps = 3/109 (2%)
Query: 26  WCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVA 85
           WCQ KT GYP VN+ +FT SWR GL FNA++H HRPDL+DF  L+      NL NAF++A
Sbjct: 15  WCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLA 74
Query: 86  STELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTFARMKN---EMKSG 131
             ELG+ +LLD EDV+  +PDEKS+ITYVA+YYH F++MK    E KSG
Sbjct: 75  EKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKSG 123
>pdb|1BKR|A Chain A, Calponin Homology (Ch) Domain From Human Beta-Spectrin At 1.1 Angstrom Resolution Length = 109 Back     alignment and structure
>pdb|1AA2|A Chain A, Calponin Homology (Ch) Domain From Human Beta-Spectrin Length = 108 Back     alignment and structure
>pdb|2EYI|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin 1 At 1.7 Angstrom Resolution Length = 234 Back     alignment and structure
>pdb|2R0O|A Chain A, Crystal Structure Of The Actin-Binding Domain Of Human Alpha-Actinin-4 Mutant(K255e) Length = 237 Back     alignment and structure
>pdb|1SJJ|A Chain A, Cryo-Em Structure Of Chicken Gizzard Smooth Muscle Alpha- Actinin Length = 863 Back     alignment and structure
>pdb|1TJT|A Chain A, X-Ray Structure Of The Human Alpha-Actinin Isoform 3 At 2.2a Resolution Length = 250 Back     alignment and structure
>pdb|1WKU|A Chain A, High Resolution Structure Of The Human Alpha-Actinin Isoform 3 Length = 254 Back     alignment and structure
>pdb|3F7P|A Chain A, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 296 Back     alignment and structure
>pdb|1MB8|A Chain A, Crystal Structure Of The Actin Binding Domain Of Plectin Length = 243 Back     alignment and structure
>pdb|1SH5|A Chain A, Crystal Structure Of Actin-Binding Domain Of Mouse Plectin Length = 245 Back     alignment and structure
>pdb|1DXX|A Chain A, N-Terminal Actin-Binding Domain Of Human Dystrophin Length = 246 Back     alignment and structure
>pdb|2D88|A Chain A, Solution Structure Of The Ch Domain From Human Mical-3 Protein Length = 121 Back     alignment and structure
>pdb|1BHD|A Chain A, Second Calponin Homology Domain From Utrophin Length = 118 Back     alignment and structure
>pdb|2E9K|A Chain A, Solution Structure Of The Ch Domain From Human Mical-2 Length = 121 Back     alignment and structure
>pdb|1QAG|A Chain A, Actin Binding Region Of The Dystrophin Homologue Utrophin Length = 226 Back     alignment and structure
>pdb|2D87|A Chain A, Solution Structure Of The Ch Domain From Human Smoothelin Splice Isoform L2 Length = 128 Back     alignment and structure
>pdb|2D89|A Chain A, Solution Structure Of The Ch Domain From Human Eh Domain Binding Protein 1 Length = 119 Back     alignment and structure
>pdb|2JV9|A Chain A, The Solution Structure Of Calponin Homology Domain From Smoothelin-Like 1 Length = 119 Back     alignment and structure
>pdb|2DK9|A Chain A, Solution Structure Of Calponin Homology Domain Of Human Mical-1 Length = 118 Back     alignment and structure
>pdb|1WYL|A Chain A, Solution Structure Of The Ch Domain Of Human Nedd9 Interacting Protein With Calponin Homology And Lim Domains Length = 116 Back     alignment and structure
>pdb|2WA6|A Chain A, Structure Of The W148r Mutant Of Human Filamin B Actin Binding Domain At 1.95 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|2WA5|A Chain A, Crystal Structure Of Human Filamin B Actin Binding Domain At 1.9 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|4B7L|A Chain A, Crystal Structure Of Human Filamin B Actin Binding Domain With 1st Filamin Repeat Length = 347 Back     alignment and structure
>pdb|2WA7|A Chain A, Structure Of The M202v Mutant Of Human Filamin B Actin Binding Domain At 1.85 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|3HOP|A Chain A, Structure Of The Actin-Binding Domain Of Human Filamin A Length = 272 Back     alignment and structure
>pdb|2WFN|A Chain A, Filamin A Actin Binding Domain Length = 278 Back     alignment and structure
>pdb|3FER|A Chain A, Crystal Structure Of N-Terminal Actin-Binding Domain From Human Filamin B (Tandem Ch-Domains). Northeast Structural Genomics Consortium Target Hr5571a. Length = 262 Back     alignment and structure
>pdb|3HOC|A Chain A, Structure Of The Actin-Binding Domain Of Human Filamin A Mutant E254k Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 3e-71
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 1e-69
1bhd_A118 Utrophin; calponin homology, actin binding, struct 6e-69
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 3e-68
2d88_A121 Protein mical-3; all alpha, calponin homology doma 4e-67
1wyl_A116 NEDD9 interacting protein with calponin homology a 2e-66
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 2e-65
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 2e-53
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 5e-53
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 6e-52
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 2e-47
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 3e-41
3hoc_A272 Filamin-A; calponin homology domain, actin binding 3e-40
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 5e-40
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 5e-37
1rt8_A513 Fimbrin; filamentous actin binding domain (ABD), c 1e-34
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 3e-33
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 8e-33
1pxy_A506 Fimbrin-like protein; calponin homology, F-actin-b 2e-32
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 1e-06
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
 Score =  211 bits (540), Expect = 3e-71
 Identities = 70/120 (58%), Positives = 87/120 (72%)

Query: 13  SSEKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPT 72
           SS    AKDALLLWCQ KT GYP VN+ +FT SWR GL FNA++H HRPDL+DF  L+  
Sbjct: 2   SSGSSGAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKC 61

Query: 73  RHIDNLNNAFDVASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYHTFARMKNEMKSGR 132
               NL NAF++A  ELG+ +LLD EDV+  +PDEKS+ITYVA+YYH F++MK     G+
Sbjct: 62  NAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGK 121
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Length = 109 Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Length = 118 Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Length = 128 Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Length = 121 Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Length = 116 Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Length = 254 Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Length = 245 Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Length = 296 Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Length = 246 Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Length = 275 Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A 2wfn_A Length = 272 Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Length = 245 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Length = 513 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Length = 506 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Length = 124 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
1wyq_A127 Spectrin beta chain, brain 2; NPPSFA, structural g 100.0
1bkr_A109 Spectrin beta chain; filamentous actin-binding dom 100.0
1wyl_A116 NEDD9 interacting protein with calponin homology a 100.0
1bhd_A118 Utrophin; calponin homology, actin binding, struct 100.0
2d88_A121 Protein mical-3; all alpha, calponin homology doma 100.0
2d87_A128 Smoothelin splice isoform L2; all alpha, calponin 100.0
2d89_A119 EHBP1 protein; all alpha, calponin homology domain 100.0
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 100.0
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 100.0
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 100.0
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 100.0
4b7l_A347 Filamin-B; structural protein, FR 1 filamin hinge 99.98
3hoc_A272 Filamin-A; calponin homology domain, actin binding 99.97
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 99.97
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 99.97
1rt8_A 513 Fimbrin; filamentous actin binding domain (ABD), c 99.96
1pxy_A 506 Fimbrin-like protein; calponin homology, F-actin-b 99.95
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 99.94
1rt8_A513 Fimbrin; filamentous actin binding domain (ABD), c 99.93
1pxy_A506 Fimbrin-like protein; calponin homology, F-actin-b 99.93
1wjo_A124 T-plastin; CH domain, actin binding, structural ge 99.92
2vzc_A131 Alpha-parvin; membrane, cytoplasm, cytoskeleton, c 98.94
2yrn_A129 Neuron navigator 2 isoform 4; calponin homolgy dom 98.64
2wa7_A245 Filamin-B; disease mutation, skeletal dysplasia, s 98.51
3hoc_A272 Filamin-A; calponin homology domain, actin binding 98.42
1wku_A254 Alpha-actinin 3; calponin homology domain, actin b 98.37
1aoa_A275 T-fimbrin; actin-binding protein, calcium-binding, 98.28
1sh5_A245 Plectin 1, PLTN, PCN; actin-binding domain, calpon 98.23
3f7p_A296 Plectin-1; plakin, hemidesmosome, cell adhesion, e 98.22
4b7l_A 347 Filamin-B; structural protein, FR 1 filamin hinge 98.21
1dxx_A246 Dystrophin; structural protein, muscular dystrophy 98.17
1wyo_A159 Protein EB3, microtubule-associated protein RP/EB 98.11
2qjz_A123 Microtubule-associated protein RP/EB family member 98.11
1sjj_A 863 Actinin; 3-helix bundle, calponin homology domain, 97.94
1wyp_A136 Calponin 1; CH domain, F-actin binding, all-alpha, 97.55
2ee7_A127 Sperm flagellar protein 1; all alpha protein, CH d 97.51
1h67_A108 Calponin alpha; cytoskeleton, calponin homology do 97.5
1ujo_A144 Transgelin; CH domain, actin binding, structural g 97.47
1p2x_A159 RNG2 protein, RAS GTPase-activating-like protein; 97.4
1wyn_A146 Calponin-2; CH domain, F-actin binding, all alpha 97.33
2r8u_A268 Microtubule-associated protein RP/EB family member 97.33
3i6x_A193 P195, RAS GTPase-activating-like protein iqgap1; a 97.27
1wym_A155 Transgelin-2; CH domain, F-actin binding, all heli 97.17
1p5s_A203 RAS GTPase-activating-like protein RNG2; alpha-hel 97.14
2rr8_A190 Iqgap1 protein; F-actin binding protein, protein b 97.06
1wyr_A121 RHO guanine nucleotide exchange factor 6; CH domai 97.01
2l3g_A126 RHO guanine nucleotide exchange factor 7; structur 96.98
2qjx_A127 Protein BIM1; calponin homology domain, protein bi 96.95
4abo_I145 MAL3, microtubule integrity protein MAL3; structur 96.93
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 94.25
>1wyq_A Spectrin beta chain, brain 2; NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=5.9e-45  Score=288.89  Aligned_cols=124  Identities=56%  Similarity=0.980  Sum_probs=119.9

Q ss_pred             cccCCCHHHHHHHHHHHhhCCCCCcccCCCCCccccchhhHHHHHHhCCCCCCCCCCCcccHHhhHHHHHHHHHHhcCCC
Q psy10623         13 SSEKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVASTELGIP   92 (216)
Q Consensus        13 ~~~~~sak~~LL~Wcq~~t~~Y~~v~V~nFstSW~DG~Af~ALIh~~rPdlid~~~L~~~~~~enl~~Af~vAe~~LgIp   92 (216)
                      +.++.++|++||+|||++|++|++++|+|||+||+||+|||||||+|+|++|||+.|.+.++.+|+++||++||++||||
T Consensus         2 ~~~~~s~k~~LL~W~q~~~~~y~~v~V~nFs~sw~DG~Af~aLih~~~P~lid~~~l~~~~~~~n~~~af~~Ae~~Lgi~   81 (127)
T 1wyq_A            2 SSGSSGAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLT   81 (127)
T ss_dssp             CCSCCCSTHHHHHHHHHHHHTSSSCCCSCSSTTSSSSHHHHHHHHHHCTTTCCTTTSCSSCCHHHHHHHHHHHHHTTCCC
T ss_pred             CCCcCCHHHHHHHHHHHHHhcCCCCCCCCCcccccccHHHHHHHHHHCcCcCCHHHhCcCCHHHHHHHHHHHHHHHcCCC
Confidence            35788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcccCCCCCCChhHHHHHHHHHHHHhhhcchhhhhcccccc
Q psy10623         93 RLLDAEDVDTTRPDEKSVITYVASYYHTFARMKNEMKSGRRIAN  136 (216)
Q Consensus        93 ~lLdpeDv~~~~pDeksimtYvs~~y~~f~~~~~~~~~~~ri~~  136 (216)
                      ++|+||||..+.||+++|||||++||++|+++++++.+++||+.
T Consensus        82 ~ll~~eDv~~~~pDeksimtYvs~l~~~~~~~~~~~~~~~r~~~  125 (127)
T 1wyq_A           82 KLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKSGPS  125 (127)
T ss_dssp             CCSCTTTSCSSSCCHHHHHHHHHHHHHHHHHSSSCCSSCCCCCC
T ss_pred             cccCHHHhccCCCcHHHHHHHHHHHHHHhhcCCccccccccccC
Confidence            99999999889999999999999999999999999999999875
>1bkr_A Spectrin beta chain; filamentous actin-binding domain, cytoskeleton; 1.10A {Homo sapiens} SCOP: a.40.1.1 PDB: 1aa2_A Back     alignment and structure
>1wyl_A NEDD9 interacting protein with calponin homology and LIM domains; CH domain, mical, structural genomics; NMR {Homo sapiens} PDB: 2dk9_A Back     alignment and structure
>1bhd_A Utrophin; calponin homology, actin binding, structural protein; 2.00A {Homo sapiens} SCOP: a.40.1.1 Back     alignment and structure
>2d88_A Protein mical-3; all alpha, calponin homology domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2e9k_A Back     alignment and structure
>2d87_A Smoothelin splice isoform L2; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2jv9_A 2k3s_A Back     alignment and structure
>2d89_A EHBP1 protein; all alpha, calponin homology domain, actin binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1rt8_A Fimbrin; filamentous actin binding domain (ABD), calponin homology, actin-crosslinking, structural protein; 2.00A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1pxy_A Fimbrin-like protein; calponin homology, F-actin-binding domain (ABD), F-actin- crosslinking, structural genomics; 2.40A {Arabidopsis thaliana} SCOP: a.40.1.1 PDB: 3byh_B Back     alignment and structure
>1wjo_A T-plastin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: a.40.1.1 PDB: 2d85_A Back     alignment and structure
>2vzc_A Alpha-parvin; membrane, cytoplasm, cytoskeleton, cell junction, alternative splicing, calponin homology domain, actin-binding, cell membrane; 1.05A {Homo sapiens} PDB: 2vzd_A* 2vzg_B* 2vzi_B* 2k2r_A 3kmu_B 3kmw_B* 3rep_B* Back     alignment and structure
>2yrn_A Neuron navigator 2 isoform 4; calponin homolgy domain, helicase, all alpha, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wa7_A Filamin-B; disease mutation, skeletal dysplasia, structural protein, actin-crosslinking, myogenesis, cytoskeleton; 1.85A {Homo sapiens} PDB: 2wa5_A 2wa6_A 3fer_A Back     alignment and structure
>3hoc_A Filamin-A; calponin homology domain, actin binding domain, acetylation, actin-binding, alternative splicing, cytoplasm, cytoskeleton; 2.30A {Homo sapiens} PDB: 3hop_A 3hor_A Back     alignment and structure
>1wku_A Alpha-actinin 3; calponin homology domain, actin binding domain, contractIle protein; 1.60A {Homo sapiens} PDB: 1tjt_A 2r0o_A 2eyi_A 2eyn_A 3lue_K Back     alignment and structure
>1aoa_A T-fimbrin; actin-binding protein, calcium-binding, phosphorylation; 2.40A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 Back     alignment and structure
>1sh5_A Plectin 1, PLTN, PCN; actin-binding domain, calponin-homology domain, structural protein; 2.00A {Mus musculus} SCOP: a.40.1.1 a.40.1.1 PDB: 1sh6_A 1mb8_A Back     alignment and structure
>3f7p_A Plectin-1; plakin, hemidesmosome, cell adhesion, epidermolysis bullosa, actin-binding, alternative splicing, coiled coil, cytoplasm; 2.75A {Homo sapiens} Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>1dxx_A Dystrophin; structural protein, muscular dystrophy, calponin homology domain, actin-binding, utrophin; 2.6A {Homo sapiens} SCOP: a.40.1.1 a.40.1.1 PDB: 1qag_A Back     alignment and structure
>1wyo_A Protein EB3, microtubule-associated protein RP/EB family member 3; CH domain, microtubule-binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qjz_A Microtubule-associated protein RP/EB family member 1; calponin homology domain, microtubule plus END, +TIP, protein binding; 1.25A {Homo sapiens} SCOP: a.40.1.1 PDB: 1pa7_A 1ueg_A 3co1_A 1v5k_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1wyp_A Calponin 1; CH domain, F-actin binding, all-alpha, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2ee7_A Sperm flagellar protein 1; all alpha protein, CH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h67_A Calponin alpha; cytoskeleton, calponin homology domain, actin binding,; NMR {Gallus gallus} SCOP: a.40.1.1 Back     alignment and structure
>1ujo_A Transgelin; CH domain, actin binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: a.40.1.1 Back     alignment and structure
>1p2x_A RNG2 protein, RAS GTPase-activating-like protein; helices, bundle, protein binding; 2.21A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>1wyn_A Calponin-2; CH domain, F-actin binding, all alpha helix, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2r8u_A Microtubule-associated protein RP/EB family member 1; cytoskeleton, acetylation, cell cycle, cell division, cytoplasm, mitosis, phosphorylation; 1.35A {Homo sapiens} SCOP: a.40.1.1 PDB: 1vka_A 1txq_B 1wu9_A 2hkq_A 2hl5_A 3tq7_A 3gjo_A 1yib_A 1yig_A Back     alignment and structure
>3i6x_A P195, RAS GTPase-activating-like protein iqgap1; all helical, calmodulin-binding, cell membrane, membrane, phosphoprotein, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>1wym_A Transgelin-2; CH domain, F-actin binding, all helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p5s_A RAS GTPase-activating-like protein RNG2; alpha-helical bundle, cytokine; 2.22A {Schizosaccharomyces pombe} SCOP: a.40.1.1 Back     alignment and structure
>2rr8_A Iqgap1 protein; F-actin binding protein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1wyr_A RHO guanine nucleotide exchange factor 6; CH domain, all-alpha, NPPSFA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2l3g_A RHO guanine nucleotide exchange factor 7; structural genomics, northeast structural genomics consortiu PSI-biology, calponin-homology domain; NMR {Homo sapiens} Back     alignment and structure
>2qjx_A Protein BIM1; calponin homology domain, protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4abo_I MAL3, microtubule integrity protein MAL3; structural protein, cytoskeleton, GTPase, END binding; HET: GTP GSP; 8.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 216
d1bhda_108 a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxI 8e-50
d1sh5a2110 a.40.1.1 (A:128-237) Actin binding domain of plect 6e-49
d1bkra_108 a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) 1e-48
d1dxxa2127 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapie 6e-46
d1pxya_ 500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 7e-35
d1pxya_500 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 7e-34
d1rt8a_505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 1e-34
d1rt8a_ 505 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 1e-31
d1aoaa2116 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-cros 4e-23
d1wjoa_124 a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinkin 5e-19
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure

class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Utrophin
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  155 bits (394), Expect = 8e-50
 Identities = 43/105 (40%), Positives = 65/105 (61%)

Query: 15  EKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRH 74
           ++ +++  LL W ++ T  Y  VN+ +FT SW  GL FNA++H H+PDL  + ++     
Sbjct: 2   QQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWTDGLAFNAVLHRHKPDLFSWDKVVKMSP 61

Query: 75  IDNLNNAFDVASTELGIPRLLDAEDVDTTRPDEKSVITYVASYYH 119
           I+ L +AF  A T LGI +LLD EDV    PD+KS+I Y+ S + 
Sbjct: 62  IERLEHAFSKAQTYLGIEKLLDPEDVAVRLPDKKSIIMYLTSLFE 106
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 500 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 505 Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
d1sh5a2110 Actin binding domain of plectin {Human (Homo sapie 100.0
d1bkra_108 beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1bhda_108 Utrophin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1dxxa2127 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1rt8a_ 505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 99.96
d1pxya_ 500 Fimbrin (Plastin), actin-crosslinking domain {Thal 99.94
d1pxya_500 Fimbrin (Plastin), actin-crosslinking domain {Thal 99.91
d1rt8a_505 Fimbrin (Plastin), actin-crosslinking domain {Fiss 99.91
d1aoaa2116 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.89
d1wjoa_124 Fimbrin (Plastin), actin-crosslinking domain {Huma 99.84
d1dxxa1111 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1sh5a1120 Actin binding domain of plectin {Human (Homo sapie 99.09
d1aoaa1131 Fimbrin (Plastin), actin-crosslinking domain {Huma 98.99
d2qjza1120 Microtubule-associated protein eb1, N-terminal mic 98.07
d1p2xa_159 Ras GTPase-activating-like protein rng2 {Fission y 97.98
d1ujoa_144 Transgelin {Mouse (Mus musculus) [TaxId: 10090]} 97.88
d1h67a_108 Calponin {Chicken (Gallus gallus) [TaxId: 9031]} 97.28
>d1sh5a2 a.40.1.1 (A:128-237) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: CH domain-like
superfamily: Calponin-homology domain, CH-domain
family: Calponin-homology domain, CH-domain
domain: Actin binding domain of plectin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.4e-42  Score=265.76  Aligned_cols=109  Identities=51%  Similarity=0.911  Sum_probs=106.2

Q ss_pred             ccCCCHHHHHHHHHHHhhCCCCCcccCCCCCccccchhhHHHHHHhCCCCCCCCCCCcccHHhhHHHHHHHHHHhcCCCC
Q psy10623         14 SEKKSAKDALLLWCQRKTNGYPGVNIQDFTGSWRSGLGFNALIHAHRPDLIDFSQLQPTRHIDNLNNAFDVASTELGIPR   93 (216)
Q Consensus        14 ~~~~sak~~LL~Wcq~~t~~Y~~v~V~nFstSW~DG~Af~ALIh~~rPdlid~~~L~~~~~~enl~~Af~vAe~~LgIp~   93 (216)
                      .++.|+|++||.|||+++++|+||+|+|||+||+||+|||||||+|+|++|||+.+++.++.+|++.||++|+++||||+
T Consensus         2 ~e~~s~k~~LL~W~~~~~~~y~~v~v~nFs~sw~DG~afcaLih~~~P~~id~~~l~~~~~~~~~~~a~~~Ae~~lgip~   81 (110)
T d1sh5a2           2 SEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTR   81 (110)
T ss_dssp             CSSCCHHHHHHHHHHHHTTTSTTCCCCCSSGGGTTSHHHHHHHHTTCTTTCCHHHHHHSCHHHHHHHHHHHHHHHHCCCC
T ss_pred             ccccCHHHHHHHHHHHHcCCCCCeeccCCcccccCcHHHHHHHHHHCcccCChhhcCccCHHHHHHHHHHHHHHcCCCCC
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccCCCCCCChhHHHHHHHHHHHHhh
Q psy10623         94 LLDAEDVDTTRPDEKSVITYVASYYHTFA  122 (216)
Q Consensus        94 lLdpeDv~~~~pDeksimtYvs~~y~~f~  122 (216)
                      +++|+||..+.||+++||+||++||++|+
T Consensus        82 ll~~eD~~~~~pD~~sv~~Yvs~ly~~~P  110 (110)
T d1sh5a2          82 LLDPEDVDVPQPDEKSIITYVSSLYDAMP  110 (110)
T ss_dssp             CCCHHHHSSSSCCHHHHHHHHHHHHHHCC
T ss_pred             CCCHHHHccCCCcHHHHHHHHHHHHHhCc
Confidence            99999999999999999999999999885
>d1bkra_ a.40.1.1 (A:) beta-spectrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhda_ a.40.1.1 (A:) Utrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa2 a.40.1.1 (A:120-246) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pxya_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rt8a_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1aoaa2 a.40.1.1 (A:260-375) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjoa_ a.40.1.1 (A:) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxxa1 a.40.1.1 (A:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sh5a1 a.40.1.1 (A:8-127) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoaa1 a.40.1.1 (A:121-251) Fimbrin (Plastin), actin-crosslinking domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qjza1 a.40.1.1 (A:13-132) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ujoa_ a.40.1.1 (A:) Transgelin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h67a_ a.40.1.1 (A:) Calponin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure