Psyllid ID: psy10664
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| 328712780 | 489 | PREDICTED: seryl-tRNA synthetase, cytopl | 1.0 | 0.153 | 0.76 | 6e-28 | |
| 383854318 | 534 | PREDICTED: serine--tRNA ligase, cytoplas | 1.0 | 0.140 | 0.72 | 4e-26 | |
| 387018622 | 514 | Seryl-tRNA synthetase, cytoplasmic-like | 1.0 | 0.145 | 0.72 | 7e-26 | |
| 332374480 | 492 | unknown [Dendroctonus ponderosae] | 1.0 | 0.152 | 0.706 | 8e-26 | |
| 148231408 | 510 | seryl-tRNA synthetase [Xenopus laevis] g | 1.0 | 0.147 | 0.72 | 1e-25 | |
| 449677187 | 450 | PREDICTED: serine--tRNA ligase, cytoplas | 1.0 | 0.166 | 0.733 | 2e-25 | |
| 357606091 | 494 | hypothetical protein KGM_16833 [Danaus p | 1.0 | 0.151 | 0.746 | 3e-25 | |
| 224085041 | 492 | PREDICTED: serine--tRNA ligase, cytoplas | 1.0 | 0.152 | 0.706 | 3e-25 | |
| 47498044 | 511 | seryl-tRNA synthetase [Xenopus (Silurana | 1.0 | 0.146 | 0.706 | 3e-25 | |
| 270010395 | 529 | hypothetical protein TcasGA2_TC009786 [T | 1.0 | 0.141 | 0.706 | 5e-25 |
| >gi|328712780|ref|XP_001945803.2| PREDICTED: seryl-tRNA synthetase, cytoplasmic-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 127 bits (320), Expect = 6e-28, Method: Composition-based stats.
Identities = 57/75 (76%), Positives = 65/75 (86%)
Query: 1 MIDGVDSEAGAIVAGGRGYFLKGPAVCLQVGLVQYALSKWIEKGYTPLYTPFFMRKEVMQ 60
MIDGVD++AG V+G RGY+LKGPAV LQ LVQ AL +W +KGY PLYTPFFMRKE+MQ
Sbjct: 175 MIDGVDADAGTTVSGTRGYYLKGPAVFLQSALVQEALRRWDDKGYKPLYTPFFMRKEIMQ 234
Query: 61 EVAQLAQFDEELYKM 75
EVAQLAQFDEELYK+
Sbjct: 235 EVAQLAQFDEELYKV 249
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383854318|ref|XP_003702668.1| PREDICTED: serine--tRNA ligase, cytoplasmic-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|387018622|gb|AFJ51429.1| Seryl-tRNA synthetase, cytoplasmic-like [Crotalus adamanteus] | Back alignment and taxonomy information |
|---|
| >gi|332374480|gb|AEE62381.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|148231408|ref|NP_001080487.1| seryl-tRNA synthetase [Xenopus laevis] gi|27697084|gb|AAH43975.1| Sars-prov protein [Xenopus laevis] | Back alignment and taxonomy information |
|---|
| >gi|449677187|ref|XP_002157171.2| PREDICTED: serine--tRNA ligase, cytoplasmic-like [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|357606091|gb|EHJ64911.1| hypothetical protein KGM_16833 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|224085041|ref|XP_002196082.1| PREDICTED: serine--tRNA ligase, cytoplasmic [Taeniopygia guttata] | Back alignment and taxonomy information |
|---|
| >gi|47498044|ref|NP_998852.1| seryl-tRNA synthetase [Xenopus (Silurana) tropicalis] gi|45708834|gb|AAH67920.1| seryl-aminoacyl-tRNA synthetase 1 [Xenopus (Silurana) tropicalis] gi|89269852|emb|CAJ83597.1| seryl-tRNA synthetase [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|270010395|gb|EFA06843.1| hypothetical protein TcasGA2_TC009786 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| MGI|MGI:102809 | 512 | Sars "seryl-aminoacyl-tRNA syn | 1.0 | 0.146 | 0.706 | 2.9e-24 | |
| WB|WBGene00005663 | 487 | sars-1 [Caenorhabditis elegans | 1.0 | 0.154 | 0.693 | 6.5e-24 | |
| RGD|628813 | 512 | Sars "seryl-tRNA synthetase" [ | 1.0 | 0.146 | 0.693 | 2.9e-23 | |
| UNIPROTKB|Q6P799 | 512 | Sars "Serine--tRNA ligase, cyt | 1.0 | 0.146 | 0.693 | 2.9e-23 | |
| UNIPROTKB|E2R4D5 | 513 | SARS "Uncharacterized protein" | 1.0 | 0.146 | 0.693 | 2.9e-23 | |
| UNIPROTKB|F1S5Z3 | 514 | SARS "Uncharacterized protein" | 1.0 | 0.145 | 0.693 | 2.9e-23 | |
| UNIPROTKB|Q9GMB8 | 514 | SARS "Serine--tRNA ligase, cyt | 1.0 | 0.145 | 0.68 | 3.7e-23 | |
| UNIPROTKB|P49591 | 514 | SARS "Serine--tRNA ligase, cyt | 1.0 | 0.145 | 0.68 | 1.3e-22 | |
| UNIPROTKB|Q5T5C7 | 536 | SARS "Serine--tRNA ligase, cyt | 1.0 | 0.139 | 0.68 | 1.5e-22 | |
| FB|FBgn0031497 | 501 | CG17259 [Drosophila melanogast | 1.0 | 0.149 | 0.68 | 2e-22 |
| MGI|MGI:102809 Sars "seryl-aminoacyl-tRNA synthetase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Score = 283 (104.7 bits), Expect = 2.9e-24, P = 2.9e-24
Identities = 53/75 (70%), Positives = 62/75 (82%)
Query: 1 MIDGVDSEAGAIVAGGRGYFLKGPAVCLQVGLVQYALSKWIEKGYTPLYTPFFMRKEVMQ 60
M+DG + E GA+VAG RGYFLKGP V L+ L+QYAL +GYTP+YTPFFMRKEVMQ
Sbjct: 176 MVDGFEGEKGAVVAGSRGYFLKGPLVFLEQALIQYALRTLGSRGYTPIYTPFFMRKEVMQ 235
Query: 61 EVAQLAQFDEELYKM 75
EVAQL+QFDEELYK+
Sbjct: 236 EVAQLSQFDEELYKV 250
|
|
| WB|WBGene00005663 sars-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| RGD|628813 Sars "seryl-tRNA synthetase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6P799 Sars "Serine--tRNA ligase, cytoplasmic" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4D5 SARS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S5Z3 SARS "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GMB8 SARS "Serine--tRNA ligase, cytoplasmic" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49591 SARS "Serine--tRNA ligase, cytoplasmic" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5T5C7 SARS "Serine--tRNA ligase, cytoplasmic" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031497 CG17259 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 75 | |||
| PLN02678 | 448 | PLN02678, PLN02678, seryl-tRNA synthetase | 3e-33 | |
| cd00770 | 297 | cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) | 8e-29 | |
| COG0172 | 429 | COG0172, SerS, Seryl-tRNA synthetase [Translation, | 4e-18 | |
| TIGR00414 | 418 | TIGR00414, serS, seryl-tRNA synthetase | 4e-17 | |
| PRK05431 | 425 | PRK05431, PRK05431, seryl-tRNA synthetase; Provisi | 5e-17 | |
| PLN02320 | 502 | PLN02320, PLN02320, seryl-tRNA synthetase | 1e-10 | |
| pfam00587 | 171 | pfam00587, tRNA-synt_2b, tRNA synthetase class II | 8e-06 |
| >gnl|CDD|215364 PLN02678, PLN02678, seryl-tRNA synthetase | Back alignment and domain information |
|---|
Score = 117 bits (295), Expect = 3e-33
Identities = 45/74 (60%), Positives = 56/74 (75%)
Query: 1 MIDGVDSEAGAIVAGGRGYFLKGPAVCLQVGLVQYALSKWIEKGYTPLYTPFFMRKEVMQ 60
++ VD+E GA VAGGRGY+LKG V L L+ + L+ ++GYTPL TPFFMRK+VM
Sbjct: 149 LLGIVDTERGADVAGGRGYYLKGAGVLLNQALINFGLAFLRKRGYTPLQTPFFMRKDVMA 208
Query: 61 EVAQLAQFDEELYK 74
+ AQLAQFDEELYK
Sbjct: 209 KCAQLAQFDEELYK 222
|
Length = 448 |
| >gnl|CDD|238393 cd00770, SerRS_core, Seryl-tRNA synthetase (SerRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|223250 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|232965 TIGR00414, serS, seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|235461 PRK05431, PRK05431, seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177954 PLN02320, PLN02320, seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|216009 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 75 | |||
| COG0172 | 429 | SerS Seryl-tRNA synthetase [Translation, ribosomal | 99.93 | |
| PLN02678 | 448 | seryl-tRNA synthetase | 99.93 | |
| TIGR00414 | 418 | serS seryl-tRNA synthetase. This model represents | 99.9 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 99.9 | |
| PLN02320 | 502 | seryl-tRNA synthetase | 99.9 | |
| KOG2509|consensus | 455 | 99.89 | ||
| cd00770 | 297 | SerRS_core Seryl-tRNA synthetase (SerRS) class II | 99.88 | |
| PLN02837 | 614 | threonine-tRNA ligase | 99.85 | |
| cd00771 | 298 | ThrRS_core Threonyl-tRNA synthetase (ThrRS) class | 99.75 | |
| PRK00960 | 517 | seryl-tRNA synthetase; Provisional | 99.73 | |
| PRK14799 | 545 | thrS threonyl-tRNA synthetase; Provisional | 99.72 | |
| PLN02908 | 686 | threonyl-tRNA synthetase | 99.71 | |
| cd00778 | 261 | ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) | 99.68 | |
| TIGR00415 | 520 | serS_MJ seryl-tRNA synthetase, Methanococcus janna | 99.67 | |
| KOG1637|consensus | 560 | 99.65 | ||
| PRK03991 | 613 | threonyl-tRNA synthetase; Validated | 99.62 | |
| TIGR00418 | 563 | thrS threonyl-tRNA synthetase. This model represen | 99.61 | |
| PRK12305 | 575 | thrS threonyl-tRNA synthetase; Reviewed | 99.61 | |
| COG0441 | 589 | ThrS Threonyl-tRNA synthetase [Translation, riboso | 99.57 | |
| cd00779 | 255 | ProRS_core_prok Prolyl-tRNA synthetase (ProRS) cla | 99.55 | |
| PRK12444 | 639 | threonyl-tRNA synthetase; Reviewed | 99.51 | |
| PRK04173 | 456 | glycyl-tRNA synthetase; Provisional | 99.49 | |
| PRK12325 | 439 | prolyl-tRNA synthetase; Provisional | 99.48 | |
| PRK00413 | 638 | thrS threonyl-tRNA synthetase; Reviewed | 99.4 | |
| PRK08661 | 477 | prolyl-tRNA synthetase; Provisional | 99.39 | |
| PRK09194 | 565 | prolyl-tRNA synthetase; Provisional | 99.38 | |
| cd00772 | 264 | ProRS_core Prolyl-tRNA synthetase (ProRS) class II | 99.35 | |
| TIGR00409 | 568 | proS_fam_II prolyl-tRNA synthetase, family II. Pro | 99.31 | |
| TIGR00408 | 472 | proS_fam_I prolyl-tRNA synthetase, family I. Proly | 99.22 | |
| PF00587 | 173 | tRNA-synt_2b: tRNA synthetase class II core domain | 99.09 | |
| cd00670 | 235 | Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t | 98.99 | |
| COG0442 | 500 | ProS Prolyl-tRNA synthetase [Translation, ribosoma | 98.47 | |
| TIGR00389 | 551 | glyS_dimeric glycyl-tRNA synthetase, dimeric type. | 98.19 | |
| cd00774 | 254 | GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-lik | 98.08 | |
| PRK00037 | 412 | hisS histidyl-tRNA synthetase; Reviewed | 98.05 | |
| cd00773 | 261 | HisRS-like_core Class II Histidinyl-tRNA synthetas | 97.91 | |
| CHL00201 | 430 | syh histidine-tRNA synthetase; Provisional | 97.8 | |
| TIGR00442 | 397 | hisS histidyl-tRNA synthetase. This model finds a | 97.7 | |
| TIGR00443 | 314 | hisZ_biosyn_reg ATP phosphoribosyltransferase, reg | 97.57 | |
| COG0423 | 558 | GRS1 Glycyl-tRNA synthetase (class II) [Translatio | 97.44 | |
| PRK09537 | 417 | pylS pyrolysyl-tRNA synthetase; Reviewed | 97.37 | |
| PLN02734 | 684 | glycyl-tRNA synthetase | 97.3 | |
| PRK14894 | 539 | glycyl-tRNA synthetase; Provisional | 97.0 | |
| PLN02530 | 487 | histidine-tRNA ligase | 96.94 | |
| cd00768 | 211 | class_II_aaRS-like_core Class II tRNA amino-acyl s | 96.59 | |
| PRK12420 | 423 | histidyl-tRNA synthetase; Provisional | 96.54 | |
| KOG2324|consensus | 457 | 96.09 | ||
| PF13393 | 311 | tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI | 95.7 | |
| TIGR02367 | 453 | PylS pyrrolysyl-tRNA synthetase. PylS is the archa | 95.5 | |
| PRK12292 | 391 | hisZ ATP phosphoribosyltransferase regulatory subu | 95.44 | |
| PRK12293 | 281 | hisZ ATP phosphoribosyltransferase regulatory subu | 94.42 | |
| KOG2298|consensus | 599 | 93.0 | ||
| cd00775 | 329 | LysRS_core Lys_tRNA synthetase (LysRS) class II co | 92.7 | |
| COG0124 | 429 | HisS Histidyl-tRNA synthetase [Translation, riboso | 92.69 | |
| PF00152 | 335 | tRNA-synt_2: tRNA synthetases class II (D, K and N | 92.47 | |
| PRK09350 | 306 | poxB regulator PoxA; Provisional | 92.34 | |
| PRK12421 | 392 | ATP phosphoribosyltransferase regulatory subunit; | 92.08 | |
| cd00777 | 280 | AspRS_core Asp tRNA synthetase (aspRS) class II co | 91.77 | |
| PLN02221 | 572 | asparaginyl-tRNA synthetase | 91.36 | |
| cd00669 | 269 | Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase cl | 91.22 | |
| PLN02532 | 633 | asparagine-tRNA synthetase | 91.09 | |
| TIGR00462 | 304 | genX lysyl-tRNA synthetase-like protein GenX. Many | 90.7 | |
| COG0017 | 435 | AsnS Aspartyl/asparaginyl-tRNA synthetases [Transl | 90.58 | |
| PRK06462 | 335 | asparagine synthetase A; Reviewed | 90.34 | |
| PRK02983 | 1094 | lysS lysyl-tRNA synthetase; Provisional | 90.03 | |
| PRK12295 | 373 | hisZ ATP phosphoribosyltransferase regulatory subu | 89.9 | |
| PTZ00401 | 550 | aspartyl-tRNA synthetase; Provisional | 89.89 | |
| TIGR00458 | 428 | aspS_arch aspartyl-tRNA synthetase, archaeal type. | 89.55 | |
| PLN02972 | 763 | Histidyl-tRNA synthetase | 89.54 | |
| PLN02603 | 565 | asparaginyl-tRNA synthetase | 89.12 | |
| PRK12294 | 272 | hisZ ATP phosphoribosyltransferase regulatory subu | 89.11 | |
| TIGR00457 | 453 | asnS asparaginyl-tRNA synthetase. In a multiple se | 88.99 | |
| cd00776 | 322 | AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class | 88.9 | |
| PRK05159 | 437 | aspC aspartyl-tRNA synthetase; Provisional | 88.81 | |
| PLN02850 | 530 | aspartate-tRNA ligase | 88.69 | |
| PRK00476 | 588 | aspS aspartyl-tRNA synthetase; Validated | 88.52 | |
| TIGR00459 | 583 | aspS_bact aspartyl-tRNA synthetase, bacterial type | 88.51 | |
| PF13590 | 151 | DUF4136: Domain of unknown function (DUF4136) | 88.47 | |
| KOG0555|consensus | 545 | 88.3 | ||
| PTZ00417 | 585 | lysine-tRNA ligase; Provisional | 88.25 | |
| TIGR00499 | 496 | lysS_bact lysyl-tRNA synthetase, eukaryotic and no | 88.13 | |
| PRK03932 | 450 | asnC asparaginyl-tRNA synthetase; Validated | 87.94 | |
| PTZ00425 | 586 | asparagine-tRNA ligase; Provisional | 87.37 | |
| PRK12445 | 505 | lysyl-tRNA synthetase; Reviewed | 87.29 | |
| PRK12820 | 706 | bifunctional aspartyl-tRNA synthetase/aspartyl/glu | 87.0 | |
| PRK00484 | 491 | lysS lysyl-tRNA synthetase; Reviewed | 86.29 | |
| PLN02502 | 553 | lysyl-tRNA synthetase | 86.07 | |
| PTZ00385 | 659 | lysyl-tRNA synthetase; Provisional | 84.96 | |
| PRK07080 | 317 | hypothetical protein; Validated | 84.4 | |
| PLN02903 | 652 | aminoacyl-tRNA ligase | 83.81 |
| >COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.5e-26 Score=171.50 Aligned_cols=75 Identities=35% Similarity=0.598 Sum_probs=73.3
Q ss_pred CCCcccccccchhccCcceeecchHHHHHHHHHHHHHHHHHhCCCeeeccCccchHHHHHHcCCCCCCccccccC
Q psy10664 1 MIDGVDSEAGAIVAGGRGYFLKGPAVCLQVGLVQYALSKWIEKGYTPLYTPFFMRKEVMQEVAQLAQFDEELYKM 75 (75)
Q Consensus 1 ~l~~~d~~~~~k~~G~~~~~l~~~ga~L~~aL~~f~~~~~~~~Gy~~v~~P~i~~~~~~~~sG~~~~~~e~~y~i 75 (75)
++|++||++|+|+||+||||++|+||+|++||+||++|++.++||+++.||+||+.+++.+|||+|+|+|+||+|
T Consensus 149 ~l~~~Df~~aaKvsGsrf~~~~~~~a~L~rAL~~f~ld~~~~~Gf~e~~~P~lv~~e~m~gtgqlpkf~e~~y~v 223 (429)
T COG0172 149 KLGLLDFERAAKVSGSRFYFYKGKGARLERALIQFMLDLHTKHGFTEVLPPYLVNLESMFGTGQLPKFEEDLYKV 223 (429)
T ss_pred hcCcchhhhhcccCCCceEEEcCHHHHHHHHHHHHHHHHHHHcCceEeeCceeecHHHhhccCCCCCCcccceEe
Confidence 478999999999999999999999999999999999999999999999999999999999999999999999986
|
|
| >PLN02678 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00414 serS seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02320 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >KOG2509|consensus | Back alignment and domain information |
|---|
| >cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >PLN02837 threonine-tRNA ligase | Back alignment and domain information |
|---|
| >cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >PRK00960 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14799 thrS threonyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02908 threonyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >TIGR00415 serS_MJ seryl-tRNA synthetase, Methanococcus jannaschii family | Back alignment and domain information |
|---|
| >KOG1637|consensus | Back alignment and domain information |
|---|
| >PRK03991 threonyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR00418 thrS threonyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK12305 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >PRK12444 threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK04173 glycyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12325 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00413 thrS threonyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK08661 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09194 prolyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain | Back alignment and domain information |
|---|
| >TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II | Back alignment and domain information |
|---|
| >TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I | Back alignment and domain information |
|---|
| >PF00587 tRNA-synt_2b: tRNA synthetase class II core domain (G, H, P, S and T) This Prosite entry contains all class II enzymes | Back alignment and domain information |
|---|
| >cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain | Back alignment and domain information |
|---|
| >COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00389 glyS_dimeric glycyl-tRNA synthetase, dimeric type | Back alignment and domain information |
|---|
| >cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain | Back alignment and domain information |
|---|
| >PRK00037 hisS histidyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain | Back alignment and domain information |
|---|
| >CHL00201 syh histidine-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00442 hisS histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit | Back alignment and domain information |
|---|
| >COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN02734 glycyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK14894 glycyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02530 histidine-tRNA ligase | Back alignment and domain information |
|---|
| >cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain | Back alignment and domain information |
|---|
| >PRK12420 histidyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG2324|consensus | Back alignment and domain information |
|---|
| >PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A | Back alignment and domain information |
|---|
| >TIGR02367 PylS pyrrolysyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >KOG2298|consensus | Back alignment and domain information |
|---|
| >cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain | Back alignment and domain information |
|---|
| >COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00152 tRNA-synt_2: tRNA synthetases class II (D, K and N) ; InterPro: IPR004364 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK09350 poxB regulator PoxA; Provisional | Back alignment and domain information |
|---|
| >PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain | Back alignment and domain information |
|---|
| >PLN02221 asparaginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain | Back alignment and domain information |
|---|
| >PLN02532 asparagine-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00462 genX lysyl-tRNA synthetase-like protein GenX | Back alignment and domain information |
|---|
| >COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06462 asparagine synthetase A; Reviewed | Back alignment and domain information |
|---|
| >PRK02983 lysS lysyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00401 aspartyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type | Back alignment and domain information |
|---|
| >PLN02972 Histidyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PLN02603 asparaginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00457 asnS asparaginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain | Back alignment and domain information |
|---|
| >PRK05159 aspC aspartyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02850 aspartate-tRNA ligase | Back alignment and domain information |
|---|
| >PRK00476 aspS aspartyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR00459 aspS_bact aspartyl-tRNA synthetase, bacterial type | Back alignment and domain information |
|---|
| >PF13590 DUF4136: Domain of unknown function (DUF4136) | Back alignment and domain information |
|---|
| >KOG0555|consensus | Back alignment and domain information |
|---|
| >PTZ00417 lysine-tRNA ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR00499 lysS_bact lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial | Back alignment and domain information |
|---|
| >PRK03932 asnC asparaginyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >PTZ00425 asparagine-tRNA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK12445 lysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional | Back alignment and domain information |
|---|
| >PRK00484 lysS lysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN02502 lysyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PTZ00385 lysyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07080 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02903 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 75 | ||||
| 3vbb_A | 522 | Crystal Structure Of Seryl-Trna Synthetase From Hum | 5e-26 | ||
| 3lsq_A | 484 | Trypanosoma Brucei Seryl-Trna Synthetase Length = 4 | 2e-17 | ||
| 3qne_A | 485 | Candida Albicans Seryl-Trna Synthetase Length = 485 | 2e-16 | ||
| 3qo5_A | 485 | Crystal Structure Of The Seryl-Trna Synthetase From | 1e-15 | ||
| 2dq0_A | 455 | Crystal Structure Of Seryl-Trna Synthetase From Pyr | 9e-09 | ||
| 1wle_A | 501 | Crystal Structure Of Mammalian Mitochondrial Seryl- | 4e-06 | ||
| 2dq3_A | 425 | Crystal Structure Of Aq_298 Length = 425 | 4e-05 |
| >pdb|3VBB|A Chain A, Crystal Structure Of Seryl-Trna Synthetase From Human At 2.9 Angstroms Length = 522 | Back alignment and structure |
|
| >pdb|3LSQ|A Chain A, Trypanosoma Brucei Seryl-Trna Synthetase Length = 484 | Back alignment and structure |
| >pdb|3QNE|A Chain A, Candida Albicans Seryl-Trna Synthetase Length = 485 | Back alignment and structure |
| >pdb|3QO5|A Chain A, Crystal Structure Of The Seryl-Trna Synthetase From Candida Albicans Length = 485 | Back alignment and structure |
| >pdb|2DQ0|A Chain A, Crystal Structure Of Seryl-Trna Synthetase From Pyrococcus Horikoshii Complexed With A Seryl-Adenylate Analog Length = 455 | Back alignment and structure |
| >pdb|1WLE|A Chain A, Crystal Structure Of Mammalian Mitochondrial Seryl-Trna Synthetase Complexed With Seryl-Adenylate Length = 501 | Back alignment and structure |
| >pdb|2DQ3|A Chain A, Crystal Structure Of Aq_298 Length = 425 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 75 | |||
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 6e-31 | |
| 3vbb_A | 522 | Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l | 1e-30 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 5e-28 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 2e-20 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 1e-16 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 1e-15 | |
| 3err_A | 536 | Fusion protein of microtubule binding domain from | 2e-15 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 2e-11 | |
| 3mf2_A | 346 | BLL0957 protein; aminoacyl-tRNA synthetase, seryl- | 3e-08 | |
| 2cja_A | 522 | Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE | 1e-07 |
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Length = 485 | Back alignment and structure |
|---|
Score = 111 bits (279), Expect = 6e-31
Identities = 39/74 (52%), Positives = 45/74 (60%)
Query: 1 MIDGVDSEAGAIVAGGRGYFLKGPAVCLQVGLVQYALSKWIEKGYTPLYTPFFMRKEVMQ 60
+DG D E G + G RGYFL+ V L L+ Y LS KGY PL P M KEVM
Sbjct: 160 RLDGYDPERGVRIVGHRGYFLRNYGVFLNQALINYGLSFLSSKGYVPLQAPVMMNKEVMA 219
Query: 61 EVAQLAQFDEELYK 74
+ AQL+QFDEELYK
Sbjct: 220 KTAQLSQFDEELYK 233
|
| >3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Length = 484 | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Length = 455 | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Length = 501 | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Length = 421 | Back alignment and structure |
|---|
| >3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} Length = 536 | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Length = 425 | Back alignment and structure |
|---|
| >3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* Length = 346 | Back alignment and structure |
|---|
| >2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Length = 522 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 75 | |||
| 3vbb_A | 522 | Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l | 99.92 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 99.92 | |
| 3err_A | 536 | Fusion protein of microtubule binding domain from | 99.91 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 99.91 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 99.9 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 99.86 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 99.85 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 99.85 | |
| 3uh0_A | 460 | Threonyl-tRNA synthetase, mitochondrial; threonine | 99.69 | |
| 3mf2_A | 346 | BLL0957 protein; aminoacyl-tRNA synthetase, seryl- | 99.63 | |
| 1qf6_A | 642 | THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m | 99.59 | |
| 4hvc_A | 519 | Bifunctional glutamate/proline--tRNA ligase; ligas | 99.57 | |
| 1nyr_A | 645 | Threonyl-tRNA synthetase 1; ATP, threonine, ligase | 99.53 | |
| 1evl_A | 401 | Threonyl-tRNA synthetase; amino acid recognition, | 99.52 | |
| 2cja_A | 522 | Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE | 99.52 | |
| 3ial_A | 518 | Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 99.48 | |
| 1nj1_A | 501 | PROR, proline-tRNA synthetase, proline--tRNA ligas | 99.44 | |
| 2j3l_A | 572 | Prolyl-tRNA synthetase; class II aminoacyl- T synt | 99.38 | |
| 1ati_A | 505 | Glycyl-tRNA synthetase; protein biosynthesis, liga | 99.33 | |
| 3a32_A | 471 | Probable threonyl-tRNA synthetase 1; aeropyrum per | 99.29 | |
| 1nj8_A | 459 | Proline-tRNA synthetase, proline--tRNA ligase; cla | 99.28 | |
| 1hc7_A | 477 | Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 99.23 | |
| 2i4l_A | 458 | Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud | 99.21 | |
| 1qe0_A | 420 | Histidyl-tRNA synthetase; class II tRNA synthetase | 99.1 | |
| 4e51_A | 467 | Histidine--tRNA ligase; seattle structural genomic | 99.01 | |
| 2zt5_A | 693 | Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP | 98.97 | |
| 1h4v_B | 421 | Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA | 98.79 | |
| 1htt_A | 423 | Histidyl-tRNA synthetase; complex (tRNA synthetase | 98.73 | |
| 1z7m_A | 344 | ATP phosphoribosyltransferase regulatory subunit; | 98.69 | |
| 1wu7_A | 434 | Histidyl-tRNA synthetase; ligase, structural genom | 98.66 | |
| 3rac_A | 373 | Histidine-tRNA ligase; structural genomics, PSI-bi | 98.51 | |
| 3od1_A | 400 | ATP phosphoribosyltransferase regulatory subunit; | 98.4 | |
| 3ikl_A | 459 | DNA polymerase subunit gamma-2, mitochondrial; tra | 98.19 | |
| 3lc0_A | 456 | Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t | 98.15 | |
| 3net_A | 465 | Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas | 97.94 | |
| 4g84_A | 464 | Histidine--tRNA ligase, cytoplasmic; synthetase; 2 | 97.86 | |
| 1g5h_A | 454 | Mitochondrial DNA polymerase accessory subunit; in | 97.76 | |
| 3dsq_A | 288 | Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t | 97.71 | |
| 4g85_A | 517 | Histidine-tRNA ligase, cytoplasmic; synthetase; 3. | 97.67 | |
| 3qtc_A | 290 | Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet | 96.35 | |
| 1usy_A | 275 | ATP phosphoribosyltransferase regulatory subunit; | 94.61 | |
| 3a5y_A | 345 | GENX, putative lysyl-tRNA synthetase; aminoacyl-tR | 92.2 | |
| 2xgt_A | 435 | Asparaginyl-tRNA synthetase, cytoplasmic; ligase, | 91.12 | |
| 3m4p_A | 456 | Ehasnrs, asparaginyl-tRNA synthetase, putative; am | 91.09 | |
| 1nnh_A | 294 | Asparaginyl-tRNA synthetase-related peptide; struc | 90.72 | |
| 1eov_A | 487 | ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy | 89.59 | |
| 1c0a_A | 585 | Aspartyl tRNA synthetase; protein-RNA complex, lig | 89.54 | |
| 3nem_A | 438 | Aspartyl-tRNA synthetase; rossmann fold, OB fold, | 89.3 | |
| 1l0w_A | 580 | Aspartyl-tRNA synthetase; space-grown crystal, dim | 89.06 | |
| 1e1o_A | 504 | Lysyl-tRNA synthetase, heat inducible; ligase, ami | 88.87 | |
| 3a74_A | 493 | Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, | 88.87 | |
| 3i7f_A | 548 | Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi | 88.82 | |
| 1n9w_A | 422 | Aspartyl-tRNA synthetase 2; biosynthetic protein; | 88.34 | |
| 3bju_A | 521 | Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, | 88.22 | |
| 4ex5_A | 529 | Lysine--tRNA ligase; structural genomics, niaid, n | 87.83 | |
| 1wyd_A | 429 | Hypothetical aspartyl-tRNA synthetase; archaea, LI | 87.6 | |
| 1x54_A | 434 | Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe | 86.6 | |
| 4f54_A | 197 | Uncharacterized protein; PF13590 family protein, D | 82.46 | |
| 4ah6_A | 617 | Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo | 81.94 |
| >3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.92 E-value=8.3e-26 Score=169.68 Aligned_cols=75 Identities=68% Similarity=1.125 Sum_probs=72.0
Q ss_pred CCCcccccccchhccCcceeecchHHHHHHHHHHHHHHHHHhCCCeeeccCccchHHHHHHcCCCCCCccccccC
Q psy10664 1 MIDGVDSEAGAIVAGGRGYFLKGPAVCLQVGLVQYALSKWIEKGYTPLYTPFFMRKEVMQEVAQLAQFDEELYKM 75 (75)
Q Consensus 1 ~l~~~d~~~~~k~~G~~~~~l~~~ga~L~~aL~~f~~~~~~~~Gy~~v~~P~i~~~~~~~~sG~~~~~~e~~y~i 75 (75)
++|++||++|+|++|+|||+|+|.||+|++||++|+++++.++||++|.||+|++.++|++||||++|+|+||++
T Consensus 176 ~l~l~dfe~~~kvsGsgfy~l~p~GarL~raL~~f~~d~~~~~Gy~EV~~P~lv~~el~~~sG~l~~f~eemy~v 250 (522)
T 3vbb_A 176 MVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKV 250 (522)
T ss_dssp HTTCEECHHHHHHHSTTCCEEETHHHHHHHHHHHHHHHHHHHTTCEEEECCSEEEHHHHHHHSCCC-CCSCCCEE
T ss_pred hcCcEecccccccCCcceEEEcCHHHHHHHHHHHHHHHHHHHcCCEEEECCcccchHHHhhcCCcccCcccceEe
Confidence 479999999999999999999999999999999999999999999999999999999999999999999999974
|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* | Back alignment and structure |
|---|
| >3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} PDB: 3j1t_A 3j1u_A | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* | Back alignment and structure |
|---|
| >3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* | Back alignment and structure |
|---|
| >1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* | Back alignment and structure |
|---|
| >1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* | Back alignment and structure |
|---|
| >2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A | Back alignment and structure |
|---|
| >3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} | Back alignment and structure |
|---|
| >1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* | Back alignment and structure |
|---|
| >2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* | Back alignment and structure |
|---|
| >1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* | Back alignment and structure |
|---|
| >3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A | Back alignment and structure |
|---|
| >1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 | Back alignment and structure |
|---|
| >1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A | Back alignment and structure |
|---|
| >2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* | Back alignment and structure |
|---|
| >1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A | Back alignment and structure |
|---|
| >1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A | Back alignment and structure |
|---|
| >1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* | Back alignment and structure |
|---|
| >1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* | Back alignment and structure |
|---|
| >1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 | Back alignment and structure |
|---|
| >3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A | Back alignment and structure |
|---|
| >3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} | Back alignment and structure |
|---|
| >4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* | Back alignment and structure |
|---|
| >3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A | Back alignment and structure |
|---|
| >4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* | Back alignment and structure |
|---|
| >1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* | Back alignment and structure |
|---|
| >3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* | Back alignment and structure |
|---|
| >2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* | Back alignment and structure |
|---|
| >3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A | Back alignment and structure |
|---|
| >1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* | Back alignment and structure |
|---|
| >1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* | Back alignment and structure |
|---|
| >1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* | Back alignment and structure |
|---|
| >3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* | Back alignment and structure |
|---|
| >1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A | Back alignment and structure |
|---|
| >1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A | Back alignment and structure |
|---|
| >3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* | Back alignment and structure |
|---|
| >3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* | Back alignment and structure |
|---|
| >3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A | Back alignment and structure |
|---|
| >4f54_A Uncharacterized protein; PF13590 family protein, DUF4136, structural genomics, joint for structural genomics, JCSG; HET: MLY; 1.60A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ah6_A Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 75 | ||||
| d1seta2 | 311 | d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS | 4e-10 | |
| d1nyra4 | 291 | d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (Th | 3e-05 |
| >d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Length = 311 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain domain: Seryl-tRNA synthetase (SerRS) species: Thermus thermophilus, strain hb27 [TaxId: 274]
Score = 51.3 bits (122), Expect = 4e-10
Identities = 14/73 (19%), Positives = 35/73 (47%)
Query: 3 DGVDSEAGAIVAGGRGYFLKGPAVCLQVGLVQYALSKWIEKGYTPLYTPFFMRKEVMQEV 62
+G + V+G R Y LKG ++ L+++A+ +G+ P+ P + R++
Sbjct: 33 NGWWEPRISQVSGSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGT 92
Query: 63 AQLAQFDEELYKM 75
+ ++++ +
Sbjct: 93 GHFPAYRDQVWAI 105
|
| >d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} Length = 291 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 75 | |||
| d1seta2 | 311 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 99.94 | |
| d1nyra4 | 291 | Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a | 99.87 | |
| d1qf6a4 | 291 | Threonyl-tRNA synthetase (ThrRS) {Escherichia coli | 99.78 | |
| d1hc7a2 | 272 | Prolyl-tRNA synthetase (ProRS) {Thermus thermophil | 99.6 | |
| d1nj8a3 | 268 | Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc | 99.55 | |
| d1nj1a3 | 265 | Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanoth | 99.53 | |
| d1b76a2 | 331 | Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil | 99.18 | |
| d1atia2 | 394 | Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil | 97.24 | |
| d1z7ma1 | 318 | ATP phosphoribosyltransferase regulatory subunit H | 96.66 | |
| d1g5ha2 | 290 | The aaRS-like accessory subunit of mitochondrial p | 96.65 | |
| d1wu7a2 | 327 | Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop | 95.23 | |
| d1qe0a2 | 325 | Histidyl-tRNA synthetase (HisRS) {Staphylococcus a | 95.06 | |
| d1kmma2 | 322 | Histidyl-tRNA synthetase (HisRS) {Escherichia coli | 93.95 | |
| d1eova2 | 353 | Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S | 93.7 | |
| d1n9wa2 | 304 | Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph | 93.69 | |
| d1c0aa3 | 346 | Aspartyl-tRNA synthetase (AspRS) {Escherichia coli | 93.37 | |
| d1h4vb2 | 324 | Histidyl-tRNA synthetase (HisRS) {Thermus thermoph | 93.01 | |
| d1b8aa2 | 335 | Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ | 92.98 | |
| d1nnha_ | 293 | Hypothetical protein PF1951 {Archaeon Pyrococcus f | 92.24 | |
| d1l0wa3 | 356 | Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph | 91.99 | |
| d1e1oa2 | 342 | Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g | 90.41 |
| >d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain domain: Seryl-tRNA synthetase (SerRS) species: Thermus thermophilus, strain hb27 [TaxId: 274]
Probab=99.94 E-value=9.6e-28 Score=169.02 Aligned_cols=73 Identities=18% Similarity=0.430 Sum_probs=70.7
Q ss_pred CCcccccccchhccCcceeecchHHHHHHHHHHHHHHHHHhCCCeeeccCccchHHHHHHcCCCCCCccccccC
Q psy10664 2 IDGVDSEAGAIVAGGRGYFLKGPAVCLQVGLVQYALSKWIEKGYTPLYTPFFMRKEVMQEVAQLAQFDEELYKM 75 (75)
Q Consensus 2 l~~~d~~~~~k~~G~~~~~l~~~ga~L~~aL~~f~~~~~~~~Gy~~v~~P~i~~~~~~~~sG~~~~~~e~~y~i 75 (75)
+|++| ++|+|+||+|||||+|+||+|++||++|++|.+.++||++|.||+||+++++++|||+|+|+|++|++
T Consensus 33 l~l~d-~~~~k~sG~rfy~l~g~~a~Le~AL~~~~ld~~~~~gy~~v~~P~lv~~~~~~~~G~~p~f~~~~y~~ 105 (311)
T d1seta2 33 NGWWE-PRISQVSGSRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAI 105 (311)
T ss_dssp HTCBC-TTHHHHHCSSCCCEEHHHHHHHHHHHHHHHHHHHHTTCEEEECCSEEEHHHHHHHTCTTTTGGGSCBB
T ss_pred cCCcc-hhhceeecCceEEEECHHHHHHHHHHHHHHHhhhcccceEEeechhhccchhhhcccccccccccccc
Confidence 68999 68999999999999999999999999999999999999999999999999999999999999999975
|
| >d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1g5ha2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} | Back information, alignment and structure |
|---|
| >d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} | Back information, alignment and structure |
|---|