Psyllid ID: psy10674


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
YTLAENKTFHVKHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQDSPGSH
cEEEccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccEEEEccccccHHHHHHHcccccccccccccccccEEEEcccccccccccccccccccccccEEEcccccccccccccc
cccccccccccccEEEHHcccccccccEEEEEccccccccccccccEEEHHHHHHccccEEEEccccccccHHHHHHHccccccHcccEEEccccEEEcccccccccEEEccccccccccccEEcccccccccccccc
ytlaenktfhvkhfccyecdkkvqfenytgkitqsqesevlwhpqcfvcstCDELLVDLMYFhykgnvyclrdyatmldiprchacdelifvneytlaenktfhvkhfccyecdkelcnqsyipvtesrpgqdspgsh
ytlaenktfhvkhfCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSyipvtesrpgqdspgsh
YTLAENKTFHVKHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQDSPGSH
******KTFHVKHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPV*************
YTLAENKTFHVKHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRP*Q******
YTLAENKTFHVKHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVT************
*T**ENKTFHVKHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPV*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YTLAENKTFHVKHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRPGQDSPGSH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
Q90Z06 835 Prickle-like protein 1-A N/A N/A 0.847 0.140 0.466 4e-25
Q90WV2 832 Prickle-like protein 1-B N/A N/A 0.847 0.140 0.466 5e-25
Q2QLB2421 Testin OS=Equus caballus yes N/A 0.869 0.285 0.472 1e-24
Q07E27421 Testin OS=Mustela putoriu N/A N/A 0.862 0.282 0.467 1e-24
Q7Z3G6 844 Prickle-like protein 2 OS yes N/A 0.644 0.105 0.560 2e-24
A1Z6W3 1299 Protein prickle OS=Drosop no N/A 0.630 0.066 0.550 2e-24
P47226423 Testin OS=Mus musculus GN yes N/A 0.623 0.203 0.574 2e-24
Q2IBC3421 Testin OS=Rhinolophus fer N/A N/A 0.623 0.204 0.574 3e-24
Q28FG2 833 Prickle-like protein 1 OS yes N/A 0.847 0.140 0.458 3e-24
A0M8U6421 Testin OS=Canis familiari yes N/A 0.862 0.282 0.459 5e-24
>sp|Q90Z06|PRI1A_XENLA Prickle-like protein 1-A OS=Xenopus laevis GN=prickle1-a PE=1 SV=1 Back     alignment and function desciption
 Score =  113 bits (282), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/120 (46%), Positives = 78/120 (65%), Gaps = 3/120 (2%)

Query: 11  VKHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYC 70
           V H  C +C +K+        ++++    V WHP CFVCSTC+ELLVDL+YF+  G ++C
Sbjct: 121 VMHATCEKCGEKINGGEVAIFVSRAGPG-VCWHPSCFVCSTCNELLVDLIYFYQDGKIHC 179

Query: 71  LRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRP 130
            R +A +L  PRC ACDE+IF +E T AE + +H+ HFCCYEC+  L  Q YI + + RP
Sbjct: 180 GRHHAELLK-PRCSACDEIIFADECTEAEGRHWHMNHFCCYECETVLGGQRYI-MKDGRP 237




Acts in a planar cell polarity (PCP) complex; polarization along the apical/basal axis of epithelial cells. Regulates the polarized assembly of fibronectrin on the surface of the mesoderm during gastrulation. Essential for gastrulation cell movements, cooperating with dvl2/dsh to activate jnk. Acts together with tes to control axial elongation.
Xenopus laevis (taxid: 8355)
>sp|Q90WV2|PRI1B_XENLA Prickle-like protein 1-B OS=Xenopus laevis GN=prickle1-b PE=2 SV=2 Back     alignment and function description
>sp|Q2QLB2|TES_HORSE Testin OS=Equus caballus GN=TES PE=3 SV=1 Back     alignment and function description
>sp|Q07E27|TES_MUSPF Testin OS=Mustela putorius furo GN=TES PE=3 SV=1 Back     alignment and function description
>sp|Q7Z3G6|PRIC2_HUMAN Prickle-like protein 2 OS=Homo sapiens GN=PRICKLE2 PE=1 SV=2 Back     alignment and function description
>sp|A1Z6W3|PRIC1_DROME Protein prickle OS=Drosophila melanogaster GN=pk PE=1 SV=1 Back     alignment and function description
>sp|P47226|TES_MOUSE Testin OS=Mus musculus GN=Tes PE=1 SV=1 Back     alignment and function description
>sp|Q2IBC3|TES_RHIFE Testin OS=Rhinolophus ferrumequinum GN=TES PE=3 SV=1 Back     alignment and function description
>sp|Q28FG2|PRIC1_XENTR Prickle-like protein 1 OS=Xenopus tropicalis GN=prickle1 PE=2 SV=1 Back     alignment and function description
>sp|A0M8U6|TES_CANFA Testin OS=Canis familiaris GN=TES PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
194755335 817 GF11783 [Drosophila ananassae] gi|190621 0.818 0.138 0.535 6e-31
170043587 817 testin [Culex quinquefasciatus] gi|16786 0.818 0.138 0.530 2e-30
195027275 831 GH20485 [Drosophila grimshawi] gi|193902 0.847 0.140 0.525 2e-30
328724369 559 PREDICTED: testin-like [Acyrthosiphon pi 0.818 0.202 0.547 4e-30
383852121 799 PREDICTED: uncharacterized protein LOC10 0.804 0.138 0.530 6e-30
195455875 807 GK23303 [Drosophila willistoni] gi|19417 0.811 0.138 0.539 2e-29
195123843 836 GI21028 [Drosophila mojavensis] gi|19391 0.847 0.139 0.508 3e-29
357627628 703 testin [Danaus plexippus] 0.855 0.167 0.478 6e-29
195150369 816 GL10662 [Drosophila persimilis] gi|19410 0.326 0.055 0.622 6e-29
198457161 816 GA19661 [Drosophila pseudoobscura pseudo 0.326 0.055 0.622 6e-29
>gi|194755335|ref|XP_001959947.1| GF11783 [Drosophila ananassae] gi|190621245|gb|EDV36769.1| GF11783 [Drosophila ananassae] Back     alignment and taxonomy information
 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 61/114 (53%), Positives = 74/114 (64%), Gaps = 1/114 (0%)

Query: 11  VKHFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYC 70
           V    C +C + + F     K  ++ + E+ WHP CF C TC ELL DL+YF ++G VYC
Sbjct: 623 VSSILCCDCSQPIAFGEVAVKADRAGK-EIAWHPNCFKCHTCRELLADLVYFFHQGQVYC 681

Query: 71  LRDYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIP 124
            RD A  L IPRC ACDELIF  EYT AE  TFH+KHFCCY+CD+ L  Q YIP
Sbjct: 682 GRDLAIKLKIPRCRACDELIFTKEYTAAEGATFHIKHFCCYQCDEPLAGQQYIP 735




Source: Drosophila ananassae

Species: Drosophila ananassae

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170043587|ref|XP_001849464.1| testin [Culex quinquefasciatus] gi|167866870|gb|EDS30253.1| testin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195027275|ref|XP_001986509.1| GH20485 [Drosophila grimshawi] gi|193902509|gb|EDW01376.1| GH20485 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|328724369|ref|XP_001949083.2| PREDICTED: testin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383852121|ref|XP_003701577.1| PREDICTED: uncharacterized protein LOC100875736 [Megachile rotundata] Back     alignment and taxonomy information
>gi|195455875|ref|XP_002074904.1| GK23303 [Drosophila willistoni] gi|194170989|gb|EDW85890.1| GK23303 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195123843|ref|XP_002006411.1| GI21028 [Drosophila mojavensis] gi|193911479|gb|EDW10346.1| GI21028 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|357627628|gb|EHJ77266.1| testin [Danaus plexippus] Back     alignment and taxonomy information
>gi|195150369|ref|XP_002016127.1| GL10662 [Drosophila persimilis] gi|194109974|gb|EDW32017.1| GL10662 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198457161|ref|XP_001360570.2| GA19661 [Drosophila pseudoobscura pseudoobscura] gi|198135882|gb|EAL25145.2| GA19661 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
FB|FBgn0034223816 Tes "Testin ortholog" [Drosoph 0.775 0.131 0.527 2.5e-29
UNIPROTKB|Q07E27421 TES "Testin" [Mustela putorius 0.876 0.287 0.472 3.9e-28
UNIPROTKB|Q2QLB2421 TES "Testin" [Equus caballus ( 0.869 0.285 0.472 3.9e-28
MGI|MGI:105081423 Tes "testis derived transcript 0.811 0.264 0.482 1.7e-27
UNIPROTKB|A0M8U6421 TES "Testin" [Canis lupus fami 0.876 0.287 0.456 2.2e-27
UNIPROTKB|E2RDJ9412 TES "Testin" [Canis lupus fami 0.876 0.293 0.456 2.2e-27
UNIPROTKB|F1PFX9421 TES "Testin" [Canis lupus fami 0.876 0.287 0.456 2.2e-27
UNIPROTKB|Q2IBC3421 TES "Testin" [Rhinolophus ferr 0.826 0.270 0.470 2.8e-27
RGD|1566346419 Tes "testis derived transcript 0.884 0.291 0.444 3.5e-27
UNIPROTKB|Q09YJ2421 TES "Testin" [Ovis aries (taxi 0.876 0.287 0.456 4.5e-27
FB|FBgn0034223 Tes "Testin ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 335 (123.0 bits), Expect = 2.5e-29, P = 2.5e-29
 Identities = 57/108 (52%), Positives = 72/108 (66%)

Query:    16 CYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYA 75
             C +C++ +       K  ++ + E+ WHP CF C TC ELL DL+YF ++G V+C RD A
Sbjct:   627 CADCNQPIAMGEVAVKADRAGK-EIAWHPGCFKCITCRELLADLVYFFHQGQVFCGRDLA 685

Query:    76 TMLDIPRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYI 123
               L IPRC ACDELIF  EYT AE  TFH+KHFCCY+CD+ L  Q YI
Sbjct:   686 IRLKIPRCRACDELIFTKEYTAAEEATFHIKHFCCYQCDEPLAGQQYI 733


GO:0008270 "zinc ion binding" evidence=IEA
GO:0015629 "actin cytoskeleton" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
UNIPROTKB|Q07E27 TES "Testin" [Mustela putorius furo (taxid:9669)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QLB2 TES "Testin" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
MGI|MGI:105081 Tes "testis derived transcript" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A0M8U6 TES "Testin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDJ9 TES "Testin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PFX9 TES "Testin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2IBC3 TES "Testin" [Rhinolophus ferrumequinum (taxid:59479)] Back     alignment and assigned GO terms
RGD|1566346 Tes "testis derived transcript" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q09YJ2 TES "Testin" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P47226TES_MOUSENo assigned EC number0.57470.62310.2033yesN/A
Q7Z3G6PRIC2_HUMANNo assigned EC number0.56040.64490.1054yesN/A
Q09YN8TES_RABITNo assigned EC number0.56320.62310.2042yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
cd0934156 cd09341, LIM2_Testin_like, The second LIM domain o 1e-18
cd0934058 cd09340, LIM1_Testin_like, The first LIM domain of 7e-15
cd0941559 cd09415, LIM1_Prickle, The first LIM domain of Pri 5e-14
cd0941656 cd09416, LIM2_Testin, The second LIM domain of Tes 9e-13
cd0941856 cd09418, LIM2_Prickle, The second LIM domain of Pr 1e-12
cd0984159 cd09841, LIM1_Prickle_3, The first LIM domain of P 3e-11
cd0948459 cd09484, LIM1_Prickle_2, The first LIM domain of P 4e-11
cd0948359 cd09483, LIM1_Prickle_1, The first LIM domain of P 2e-10
cd0941358 cd09413, LIM1_Testin, The first LIM domain of Test 2e-10
cd0941458 cd09414, LIM1_LIMPETin, The first LIM domain of pr 1e-09
cd0941756 cd09417, LIM2_LIMPETin_like, The second LIM domain 7e-09
cd0934156 cd09341, LIM2_Testin_like, The second LIM domain o 2e-05
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 2e-05
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 2e-04
cd0933159 cd09331, LIM1_PINCH, The first LIM domain of prote 2e-04
pfam0041258 pfam00412, LIM, LIM domain 3e-04
pfam0041258 pfam00412, LIM, LIM domain 3e-04
COG0068 750 COG0068, HypF, Hydrogenase maturation factor [Post 8e-04
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 0.001
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 0.001
cd0941656 cd09416, LIM2_Testin, The second LIM domain of Tes 0.002
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 0.003
>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family Back     alignment and domain information
 Score = 73.8 bits (182), Expect = 1e-18
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%)

Query: 81  PRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTESRP 130
           PRC ACDELIF  EYT AE K +H+KHFCC++CD+ L  Q Y+   E +P
Sbjct: 1   PRCAACDELIFSGEYTQAEGKNWHLKHFCCFQCDEPLGGQRYVLR-EGKP 49


The second LIM domain of Testin-like family: This family includes testin, prickle, dyxin and LIMPETin. Structurally, testin and prickle proteins contain three LIM domains at C-terminal; LIMPETin has six LIM domains; and dyxin presents only two LIM domains. However, all members of the family contain a PET protein-protein interaction domain. Testin is a cytoskeleton associated focal adhesion protein that localizes along actin stress fibers, at cell-cell-contact areas, and at focal adhesion plaques. Testin interacts with a variety of cytoskeletal proteins, including zyxin, mena, VASP, talin, and actin and it is involved in cell motility and adhesion events. Prickles have been implicated in roles of regulating tissue polarity or planar cell polarity (PCP). Dyxin involves in lung and heart development by interaction with GATA6 and blocking GATA6 activated target genes. LIMPETin might be the recombinant product of genes coding testin and four and half LIM proteins and its function is not well understood. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 56

>gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188799 cd09415, LIM1_Prickle, The first LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188800 cd09416, LIM2_Testin, The second LIM domain of Testin Back     alignment and domain information
>gnl|CDD|188802 cd09418, LIM2_Prickle, The second LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188872 cd09841, LIM1_Prickle_3, The first LIM domain of Prickle 3 Back     alignment and domain information
>gnl|CDD|188868 cd09484, LIM1_Prickle_2, The first LIM domain of Prickle 2 Back     alignment and domain information
>gnl|CDD|188867 cd09483, LIM1_Prickle_1, The first LIM domain of Prickle 1 Back     alignment and domain information
>gnl|CDD|188797 cd09413, LIM1_Testin, The first LIM domain of Testin Back     alignment and domain information
>gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188801 cd09417, LIM2_LIMPETin_like, The second LIM domain of protein LIMPETin and related proteins Back     alignment and domain information
>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|223146 COG0068, HypF, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188800 cd09416, LIM2_Testin, The second LIM domain of Testin Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
KOG1701|consensus468 99.93
KOG1701|consensus468 99.92
KOG2272|consensus332 99.9
KOG4577|consensus 383 99.87
KOG2272|consensus332 99.87
KOG1044|consensus 670 99.86
KOG1703|consensus479 99.84
KOG1044|consensus 670 99.75
KOG1703|consensus479 99.73
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.56
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.5
KOG1700|consensus200 99.3
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 99.04
KOG4577|consensus 383 98.96
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.64
KOG1700|consensus 200 97.84
KOG0490|consensus 235 97.67
KOG1702|consensus 264 97.18
KOG1702|consensus 264 97.15
PF0839437 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: 95.17
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 94.2
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 90.79
PF10083158 DUF2321: Uncharacterized protein conserved in bact 90.44
COG4357105 Zinc finger domain containing protein (CHY type) [ 89.39
PF1324023 zinc_ribbon_2: zinc-ribbon domain 88.76
PF09943101 DUF2175: Uncharacterized protein conserved in arch 88.01
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 87.68
KOG0490|consensus 235 86.69
PF1023590 Cript: Microtubule-associated protein CRIPT; Inter 85.62
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 84.39
PF1324826 zf-ribbon_3: zinc-ribbon domain 84.35
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 84.26
smart0050463 Ubox Modified RING finger domain. Modified RING fi 84.24
PF1178136 RRN7: RNA polymerase I-specific transcription init 83.94
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 83.44
PF1088654 DUF2685: Protein of unknown function (DUF2685); In 81.33
PF0206952 Metallothio_Pro: Prokaryotic metallothionein; Inte 81.24
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 80.19
>KOG1701|consensus Back     alignment and domain information
Probab=99.93  E-value=1.2e-26  Score=172.71  Aligned_cols=131  Identities=25%  Similarity=0.573  Sum_probs=113.5

Q ss_pred             eeecCCCcCcCCcccccccccccCCCeEEEecc-------------------------ccCCCCCCcccCcccccCCccc
Q psy10674          2 TLAENKTFHVKHFCCYECDKKVQFENYTGKITQ-------------------------SQESEVLWHPQCFVCSTCDELL   56 (138)
Q Consensus         2 ~~a~g~~~h~~~~~C~~C~~~i~~~~~~~~~~~-------------------------~~~~~~~~H~~Cf~C~~C~~~l   56 (138)
                      ++||++.||.+||+|..|++.|....|+...++                         +-++|+.||+.||+|.+|.+.|
T Consensus       291 c~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tlekC~~Cg~~I~d~iLrA~GkayHp~CF~Cv~C~r~l  370 (468)
T KOG1701|consen  291 VEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTLEKCNKCGEPIMDRILRALGKAYHPGCFTCVVCARCL  370 (468)
T ss_pred             HHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHHHHHhhhhhHHHHHHHHhcccccCCCceEEEEecccc
Confidence            479999999999999999999997777665443                         1278899999999999999999


Q ss_pred             cCCceee-eCCeeecHHHHHhhcCCCcccccCcccccCc------EEEeCCCccccCCccccccccccC----CCCeeec
Q psy10674         57 VDLMYFH-YKGNVYCLRDYATMLDIPRCHACDELIFVNE------YTLAENKTFHVKHFCCYECDKELC----NQSYIPV  125 (138)
Q Consensus        57 ~~~~~~~-~~~~~yC~~c~~~~~~~~~C~~C~~~I~~~~------~~~~~~~~~H~~CF~C~~C~~~l~----~~~f~~~  125 (138)
                      .+..|.+ .++++||-.||.+.| +++|+.|+++|++.+      .|+++++.||.+|++|..|+..|+    ++..|..
T Consensus       371 dgipFtvd~~n~v~Cv~dfh~kf-APrCs~C~~PI~P~~G~~etvRvvamdr~fHv~CY~CEDCg~~LS~e~e~qgCyPl  449 (468)
T KOG1701|consen  371 DGIPFTVDSQNNVYCVPDFHKKF-APRCSVCGNPILPRDGKDETVRVVAMDRDFHVNCYKCEDCGLLLSSEEEGQGCYPL  449 (468)
T ss_pred             CCccccccCCCceeeehhhhhhc-CcchhhccCCccCCCCCcceEEEEEccccccccceehhhcCccccccCCCCcceec
Confidence            9988866 789999999999999 799999999999642      344999999999999999999998    5667878


Q ss_pred             CCCCCccCC
Q psy10674        126 TESRPGQDS  134 (138)
Q Consensus       126 ~~~~~y~~~  134 (138)
                      | |.+.|..
T Consensus       450 d-~HllCk~  457 (468)
T KOG1701|consen  450 D-GHLLCKT  457 (468)
T ss_pred             c-Cceeech
Confidence            8 8887765



>KOG1701|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 Back     alignment and domain information
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown] Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF10886 DUF2685: Protein of unknown function (DUF2685); InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins Back     alignment and domain information
>PF02069 Metallothio_Pro: Prokaryotic metallothionein; InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
2xqn_T126 Complex Of The 2nd And 3rd Lim Domains Of Tes With 4e-11
2dfy_X195 Crystal Structure Of A Cyclized Protein Fusion Of L 3e-05
1rut_X188 Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L 3e-05
>pdb|2XQN|T Chain T, Complex Of The 2nd And 3rd Lim Domains Of Tes With The Evh1 Domain Of Mena And The N-Terminal Domain Of Actin-Like Protein Arp7a Length = 126 Back     alignment and structure

Iteration: 1

Score = 63.5 bits (153), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 27/47 (57%), Positives = 35/47 (74%) Query: 81 PRCHACDELIFVNEYTLAENKTFHVKHFCCYECDKELCNQSYIPVTE 127 PRC CDELIF NEYT AEN+ +H+KHFCC++CD L + Y+ V + Sbjct: 4 PRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVND 50
>pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 Back     alignment and structure
>pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 2e-17
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 2e-05
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 1e-14
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 6e-06
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 1e-14
2rgt_A 169 Fusion of LIM/homeobox protein LHX3, linker, INSU 3e-05
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 2e-13
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 3e-13
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 7e-12
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 4e-07
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 8e-13
1rut_X 188 Flinc4, fusion protein of LMO4 protein and LIM dom 1e-04
2cuq_A80 Four and A half LIM domains 3; structural genomics 3e-12
2cuq_A80 Four and A half LIM domains 3; structural genomics 3e-05
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 1e-10
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 8e-05
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 2e-10
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 2e-06
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 2e-09
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 2e-06
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 3e-09
1b8t_A 192 Protein (CRP1); LIM domain, muscle differentiation 5e-05
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 3e-04
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 4e-04
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 6e-09
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 1e-05
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 7e-09
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 5e-04
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 1e-08
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 7e-06
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-08
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 8e-04
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 2e-08
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 4e-07
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 3e-08
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 4e-06
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 4e-08
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 9e-06
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 5e-08
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 2e-05
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 1e-07
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 1e-05
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 1e-07
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 6e-06
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 1e-07
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 3e-04
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 1e-06
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 1e-05
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 2e-06
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 2e-05
3f6q_B72 LIM and senescent cell antigen-like-containing dom 5e-06
3f6q_B72 LIM and senescent cell antigen-like-containing dom 3e-05
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 5e-06
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 6e-06
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 8e-05
2co8_A82 NEDD9 interacting protein with calponin homology a 8e-06
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 1e-05
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 7e-05
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 2e-05
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 1e-04
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 2e-05
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 3e-05
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 3e-05
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 5e-04
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 4e-05
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 4e-04
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 7e-05
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 7e-05
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 1e-04
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 9e-05
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 4e-04
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 1e-04
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 6e-04
2cor_A79 Pinch protein; LIM domain, particularly interestin 3e-04
2cor_A79 Pinch protein; LIM domain, particularly interestin 7e-04
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
 Score = 71.3 bits (175), Expect = 2e-17
 Identities = 20/99 (20%), Positives = 33/99 (33%), Gaps = 7/99 (7%)

Query: 16  CYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYA 75
           C EC K +  ++              WH  CF C+ C   L +  +      + C +   
Sbjct: 8   CVECRKPIGADSKEVHY-----KNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCT- 61

Query: 76  TMLDIPRCHACDELIFVNE-YTLAENKTFHVKHFCCYEC 113
           T  D P+C  C + I   +     +   +H   F     
Sbjct: 62  TREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFSGPSS 100


>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.97
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.96
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.96
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.95
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.95
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.95
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.94
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.87
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.78
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.78
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.77
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.76
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.76
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.75
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.74
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.73
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.72
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.71
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.68
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.66
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.65
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.65
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.65
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.65
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.63
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.63
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.63
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.62
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.62
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.62
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.6
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.6
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.6
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.59
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.59
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.59
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.58
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.58
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.58
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.58
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.58
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.58
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.58
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.57
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.57
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.56
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.56
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.56
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.56
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.55
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.55
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.55
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.55
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.54
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.54
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.54
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.54
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.54
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.54
2co8_A82 NEDD9 interacting protein with calponin homology a 99.54
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.53
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.53
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.53
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.51
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.51
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.51
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.5
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.5
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.5
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.5
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.49
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.48
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.48
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.47
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.46
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.46
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.46
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.46
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.45
2co8_A82 NEDD9 interacting protein with calponin homology a 99.44
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.44
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.42
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.41
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.23
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 98.2
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.02
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 88.62
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 88.18
2ysl_A73 Tripartite motif-containing protein 31; ring-type 87.78
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 87.16
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 85.76
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 82.94
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 82.8
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 82.11
1jjd_A55 Metallothionein, SMTA; zinc finger, zinc cluster, 81.53
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 80.29
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=3.6e-31  Score=172.26  Aligned_cols=113  Identities=25%  Similarity=0.475  Sum_probs=101.8

Q ss_pred             CcccccccccccCCCeEEEeccccCCCCCCcccCcccccCCccccCCceeeeCCeeecHHHHHhhcCCCcccccCccccc
Q psy10674         13 HFCCYECDKKVQFENYTGKITQSQESEVLWHPQCFVCSTCDELLVDLMYFHYKGNVYCLRDYATMLDIPRCHACDELIFV   92 (138)
Q Consensus        13 ~~~C~~C~~~i~~~~~~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~yC~~c~~~~~~~~~C~~C~~~I~~   92 (138)
                      ..+|..|+++|.+++.+..      +++.||++||+|..|+++|.+..|+.++|++||+.||.++++ ++|++|+++|.+
T Consensus         3 ~~~C~~C~~~I~~~~~~~a------~~~~~H~~CF~C~~C~~~L~~~~f~~~~g~~yC~~cy~~~~~-~~C~~C~~~I~~   75 (126)
T 2xqn_T            3 KPRCAGCDELIFSNEYTQA------ENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHA-VVCQGCHNAIDP   75 (126)
T ss_dssp             CCBBTTTSSBCCSSCEEEE------TTEEECGGGSBCTTTCCBCTTSEEEEETTEEEEHHHHHHHSC-CBCTTTCSBCCT
T ss_pred             CCCCccCCCEeCCceEEee------CCCCccCCCCCcCCCCCCCCcCEEEeECCEEechHHhCcCcC-ccCcccCCcCCc
Confidence            3689999999997666544      466999999999999999988889999999999999999995 899999999986


Q ss_pred             C-cEEEeCCCccc--cCCccccccccccCCCCeeecCCCCCccC
Q psy10674         93 N-EYTLAENKTFH--VKHFCCYECDKELCNQSYIPVTESRPGQD  133 (138)
Q Consensus        93 ~-~~~~~~~~~~H--~~CF~C~~C~~~l~~~~f~~~~~~~~y~~  133 (138)
                      + .++.++++.||  ++||+|..|+++|.++.|++.+ |+|||.
T Consensus        76 ~~~~~~a~~~~~H~~~~CF~C~~C~~~l~~~~f~~~~-~~~yC~  118 (126)
T 2xqn_T           76 EVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVE-GMVFCS  118 (126)
T ss_dssp             TSCEEEETTEEEESSTTTSBCTTTCCBCTTSEEEEET-TEEESS
T ss_pred             CceEEECCCCEeeCCCCCcCcCCCCCccCCCeeEeEC-CEEcch
Confidence            4 46779999999  9999999999999999999988 999996



>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jjd_A Metallothionein, SMTA; zinc finger, zinc cluster, metal binding PR; NMR {Synechococcus elongatus} SCOP: g.46.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1g47a235 Pinch (particularly interesting new Cys-His) prote 99.01
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.96
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.88
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.8
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.74
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.66
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.65
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.58
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.53
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.52
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 98.49
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 98.48
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.46
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.44
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 98.39
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.37
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.35
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.33
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 98.3
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.3
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 98.27
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.26
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.24
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.24
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.22
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.21
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 98.2
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 98.18
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.15
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.13
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.11
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 98.09
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.06
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.06
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.06
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.03
d2co8a236 Nedd9 interacting protein with calponin homology, 98.01
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.99
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.98
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.96
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.95
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.94
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.93
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 97.92
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.9
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.87
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.86
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.86
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.85
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.82
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.75
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 97.72
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.71
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.69
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 97.68
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 97.59
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.58
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.54
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.52
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.51
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.5
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.43
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 97.4
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.35
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.33
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.32
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.24
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 97.24
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.22
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.2
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.2
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 97.2
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 97.17
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.12
d2cora235 Pinch (particularly interesting new Cys-His) prote 97.06
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.06
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.05
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.05
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.04
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.99
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.96
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 96.88
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.85
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 96.79
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 96.73
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 96.71
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 96.69
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 96.61
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.55
d2co8a236 Nedd9 interacting protein with calponin homology, 96.53
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 96.36
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.15
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 96.08
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.96
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 95.9
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.84
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 95.8
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 95.79
d2cora131 Pinch (particularly interesting new Cys-His) prote 95.77
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 95.72
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 95.71
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 95.59
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 95.58
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.41
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 95.33
d1g47a135 Pinch (particularly interesting new Cys-His) prote 95.04
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 94.96
d1g47a135 Pinch (particularly interesting new Cys-His) prote 94.93
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 94.54
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 94.1
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 94.08
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 93.91
d1x4la230 Four and a half LIM domains protein 2, FHL2 {Human 93.81
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 93.67
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 93.38
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 92.93
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 92.44
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 92.16
d1j2oa233 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 91.24
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 91.17
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 89.62
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 89.43
d2c2la280 STIP1 homology and U box-containing protein 1, STU 88.89
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 87.58
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 87.27
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 86.93
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 85.96
d2co8a133 Nedd9 interacting protein with calponin homology, 85.2
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 83.12
d1uw0a_117 DNA ligase III {Human (Homo sapiens) [TaxId: 9606] 82.42
d2gvia233 Uncharacterized protein Ta1109 {Thermoplasma acido 80.83
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Leupaxin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.25  E-value=4e-13  Score=65.97  Aligned_cols=34  Identities=26%  Similarity=0.709  Sum_probs=29.7

Q ss_pred             HHHhhcCCCcccccCcccccCcEEEeCCCccccCCc
Q psy10674         73 DYATMLDIPRCHACDELIFVNEYTLAENKTFHVKHF  108 (138)
Q Consensus        73 c~~~~~~~~~C~~C~~~I~~~~~~~~~~~~~H~~CF  108 (138)
                      +|.+++ +++|.+|+++|.+ .+|.|+|+.||++||
T Consensus         2 DY~~~f-apkC~~C~~~I~g-~~v~Al~~~wHpeCF   35 (35)
T d1x3ha1           2 DFLAMF-SPKCGGCNRPVLE-NYLSAMDTVWHPECF   35 (35)
T ss_dssp             CCCCCC-SCBCTTTCCBCCS-SCEEETTEEECTTTC
T ss_pred             cHHHHh-ChhhhhcCCcccc-hheeecCCccCcccC
Confidence            577888 5999999999965 577799999999998



>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uw0a_ g.39.1.12 (A:) DNA ligase III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gvia2 g.39.1.18 (A:169-201) Uncharacterized protein Ta1109 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure