Psyllid ID: psy10710
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 161 | ||||||
| 318087378 | 270 | putative serine proteinase inhibitor [La | 0.701 | 0.418 | 0.5 | 4e-29 | |
| 348564071 | 1331 | PREDICTED: hypothetical protein LOC10072 | 0.776 | 0.093 | 0.405 | 2e-25 | |
| 321473765 | 2763 | hypothetical protein DAPPUDRAFT_314628 [ | 0.639 | 0.037 | 0.508 | 1e-23 | |
| 443694040 | 229 | hypothetical protein CAPTEDRAFT_227921 [ | 0.708 | 0.497 | 0.478 | 1e-23 | |
| 242008177 | 2023 | conserved hypothetical protein [Pediculu | 0.677 | 0.053 | 0.439 | 9e-23 | |
| 47219204 | 4421 | unnamed protein product [Tetraodon nigro | 0.639 | 0.023 | 0.375 | 2e-22 | |
| 410897483 | 4098 | PREDICTED: collagen alpha-3(VI) chain-li | 0.639 | 0.025 | 0.405 | 4e-22 | |
| 195110509 | 2991 | GI22868 [Drosophila mojavensis] gi|19391 | 0.633 | 0.034 | 0.495 | 7e-22 | |
| 241999004 | 491 | serine proteinase inhibitor, putative [I | 0.677 | 0.221 | 0.44 | 9e-22 | |
| 340371165 | 3522 | PREDICTED: hypothetical protein LOC10063 | 0.639 | 0.029 | 0.368 | 1e-21 |
| >gi|318087378|gb|ADV40281.1| putative serine proteinase inhibitor [Latrodectus hesperus] | Back alignment and taxonomy information |
|---|
Score = 132 bits (332), Expect = 4e-29, Method: Compositional matrix adjust.
Identities = 63/126 (50%), Positives = 83/126 (65%), Gaps = 13/126 (10%)
Query: 49 SVLDVCLLPPEPGLCRGYFQKFYFNPSTGQCVQFIYGGCNGNGNRFDSEEDCI------- 101
SV CL PE G CRGYF K+Y++ +G C +FIYGGC GNGNR+++EE+C+
Sbjct: 90 SVEKTCLGEPETGFCRGYFPKYYYDVQSGTCKEFIYGGCGGNGNRYETEEECLEQCGDVK 149
Query: 102 ------HVCLLPPEPGLCRGYFQKFYFNPSTGQCVQFIYGGCNGNGNRFDSEEDCIRTCK 155
VC LP E GLCRGYF+++ F+ ++GQC QFIYGGC GN N F + +DC +TCK
Sbjct: 150 LKQSEAEVCDLPAETGLCRGYFKRYAFDKASGQCKQFIYGGCGGNKNNFRTVQDCEKTCK 209
Query: 156 GTYVVT 161
V+
Sbjct: 210 AVASVS 215
|
Source: Latrodectus hesperus Species: Latrodectus hesperus Genus: Latrodectus Family: Theridiidae Order: Araneae Class: Arachnida Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|348564071|ref|XP_003467829.1| PREDICTED: hypothetical protein LOC100724365 [Cavia porcellus] | Back alignment and taxonomy information |
|---|
| >gi|321473765|gb|EFX84732.1| hypothetical protein DAPPUDRAFT_314628 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|443694040|gb|ELT95275.1| hypothetical protein CAPTEDRAFT_227921 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|242008177|ref|XP_002424888.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508453|gb|EEB12150.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|47219204|emb|CAG11222.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
| >gi|410897483|ref|XP_003962228.1| PREDICTED: collagen alpha-3(VI) chain-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|195110509|ref|XP_001999822.1| GI22868 [Drosophila mojavensis] gi|193916416|gb|EDW15283.1| GI22868 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|241999004|ref|XP_002434145.1| serine proteinase inhibitor, putative [Ixodes scapularis] gi|215495904|gb|EEC05545.1| serine proteinase inhibitor, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|340371165|ref|XP_003384116.1| PREDICTED: hypothetical protein LOC100633626 [Amphimedon queenslandica] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 161 | ||||||
| RGD|61914 | 302 | Tfpi "tissue factor pathway in | 0.322 | 0.172 | 0.5 | 5.9e-27 | |
| MGI|MGI:1095418 | 306 | Tfpi "tissue factor pathway in | 0.366 | 0.192 | 0.451 | 8.8e-27 | |
| UNIPROTKB|C9JBB3 | 288 | TFPI "Tissue factor pathway in | 0.329 | 0.184 | 0.471 | 1e-26 | |
| UNIPROTKB|P10646 | 304 | TFPI "Tissue factor pathway in | 0.329 | 0.174 | 0.471 | 1.6e-26 | |
| UNIPROTKB|B5ST96 | 303 | LOC100155068 "Uncharacterized | 0.360 | 0.191 | 0.457 | 7.6e-11 | |
| UNIPROTKB|P86733 | 126 | P86733 "BPTI/Kunitz domain-con | 0.664 | 0.849 | 0.434 | 2.6e-24 | |
| UNIPROTKB|E1BUM2 | 308 | TFPI "Uncharacterized protein" | 0.354 | 0.185 | 0.421 | 1e-23 | |
| UNIPROTKB|C9JKV3 | 215 | TFPI "Tissue factor pathway in | 0.844 | 0.632 | 0.361 | 1.1e-23 | |
| FB|FBgn0003137 | 2898 | Ppn "Papilin" [Drosophila mela | 0.627 | 0.034 | 0.490 | 1.7e-23 | |
| UNIPROTKB|Q60559 | 349 | AMBP "Protein AMBP" [Mesocrice | 0.639 | 0.295 | 0.449 | 3.8e-23 |
| RGD|61914 Tfpi "tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 164 (62.8 bits), Expect = 5.9e-27, Sum P(2) = 5.9e-27
Identities = 26/52 (50%), Positives = 36/52 (69%)
Query: 104 CLLPPEPGLCRGYFQKFYFNPSTGQCVQFIYGGCNGNGNRFDSEEDCIRTCK 155
CL P + GLC+ ++FY+NP+ G+C QF Y GC GN N F +++DC R CK
Sbjct: 222 CLEPADSGLCKASEKRFYYNPAIGKCRQFNYTGCGGNNNNFTTKQDCNRACK 273
|
|
| MGI|MGI:1095418 Tfpi "tissue factor pathway inhibitor" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JBB3 TFPI "Tissue factor pathway inhibitor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P10646 TFPI "Tissue factor pathway inhibitor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B5ST96 LOC100155068 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P86733 P86733 "BPTI/Kunitz domain-containing protein" [Haliotis asinina (taxid:109174)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BUM2 TFPI "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JKV3 TFPI "Tissue factor pathway inhibitor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0003137 Ppn "Papilin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60559 AMBP "Protein AMBP" [Mesocricetus auratus (taxid:10036)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 161 | |||
| cd00109 | 54 | cd00109, KU, BPTI/Kunitz family of serine protease | 1e-21 | |
| cd00109 | 54 | cd00109, KU, BPTI/Kunitz family of serine protease | 2e-21 | |
| pfam00014 | 53 | pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic t | 2e-21 | |
| smart00131 | 53 | smart00131, KU, BPTI/Kunitz family of serine prote | 4e-21 | |
| smart00131 | 53 | smart00131, KU, BPTI/Kunitz family of serine prote | 8e-21 | |
| pfam00014 | 53 | pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic t | 1e-20 |
| >gnl|CDD|238057 cd00109, KU, BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
Score = 81.9 bits (203), Expect = 1e-21
Identities = 26/54 (48%), Positives = 36/54 (66%)
Query: 102 HVCLLPPEPGLCRGYFQKFYFNPSTGQCVQFIYGGCNGNGNRFDSEEDCIRTCK 155
VC LPP+ G C+ Y ++Y++ +T QC F YGGC GN N F ++E+C RTC
Sbjct: 1 DVCSLPPDTGPCKAYIPRYYYDATTKQCEPFTYGGCGGNANNFATKEECERTCG 54
|
BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure. Length = 54 |
| >gnl|CDD|238057 cd00109, KU, BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
| >gnl|CDD|200929 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic trypsin inhibitor domain | Back alignment and domain information |
|---|
| >gnl|CDD|197529 smart00131, KU, BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >gnl|CDD|197529 smart00131, KU, BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >gnl|CDD|200929 pfam00014, Kunitz_BPTI, Kunitz/Bovine pancreatic trypsin inhibitor domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| cd00109 | 54 | KU BPTI/Kunitz family of serine protease inhibitor | 99.62 | |
| smart00131 | 53 | KU BPTI/Kunitz family of serine protease inhibitor | 99.62 | |
| PF00014 | 53 | Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi | 99.59 | |
| PF00014 | 53 | Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhi | 99.59 | |
| cd00109 | 54 | KU BPTI/Kunitz family of serine protease inhibitor | 99.57 | |
| smart00131 | 53 | KU BPTI/Kunitz family of serine protease inhibitor | 99.57 | |
| KOG4295|consensus | 295 | 99.33 | ||
| KOG4295|consensus | 295 | 99.18 | ||
| KOG4597|consensus | 560 | 98.51 | ||
| KOG4597|consensus | 560 | 95.68 | ||
| KOG3540|consensus | 615 | 93.16 | ||
| KOG3540|consensus | 615 | 92.41 |
| >cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
Probab=99.62 E-value=7.9e-16 Score=95.59 Aligned_cols=54 Identities=46% Similarity=1.182 Sum_probs=51.4
Q ss_pred CCCcCCCCCcCCCCceeeEEEeCCCCCeeeeecCCcCCCCCCCCChhhhhhhcC
Q psy10710 52 DVCLLPPEPGLCRGYFQKFYFNPSTGQCVQFIYGGCNGNGNRFDSEEDCIHVCL 105 (161)
Q Consensus 52 ~~C~~~~~~g~C~~~~~rw~yn~~~~~C~~f~~~gC~gn~N~F~s~~eC~~~C~ 105 (161)
++|.+|++.|.|...+++||||+.+++|+.|.|+||+++.|+|.|+++|++.|.
T Consensus 1 ~~C~~~~~~g~C~~~~~~~~yd~~~~~C~~f~~~gc~~~~N~F~s~~~C~~~C~ 54 (54)
T cd00109 1 DVCSLPPDTGPCKAYIPRYYYDATTKQCEPFTYGGCGGNANNFATKEECERTCG 54 (54)
T ss_pred CcccCCCCCCCCCCCccEEEEeCCCCccceeECCCccCCccCcCCHHHHHhhcc
Confidence 479999999999999999999999999999999999999999999999999884
|
BPTI (bovine pancreatic trypsin inhibitor) is an extensively studied model structure. |
| >smart00131 KU BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus | Back alignment and domain information |
|---|
| >PF00014 Kunitz_BPTI: Kunitz/Bovine pancreatic trypsin inhibitor domain; InterPro: IPR002223 The majority of the sequences having this domain belong to the MEROPS inhibitor family I2, clan IB; the Kunitz/bovine pancreatic trypsin inhibitor family, they inhibit proteases of the S1 family [] and are restricted to the metazoa with a single exception: Amsacta moorei entomopoxvirus | Back alignment and domain information |
|---|
| >cd00109 KU BPTI/Kunitz family of serine protease inhibitors; Structure is a disulfide rich alpha+beta fold | Back alignment and domain information |
|---|
| >smart00131 KU BPTI/Kunitz family of serine protease inhibitors | Back alignment and domain information |
|---|
| >KOG4295|consensus | Back alignment and domain information |
|---|
| >KOG4295|consensus | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >KOG3540|consensus | Back alignment and domain information |
|---|
| >KOG3540|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 161 | ||||
| 2ody_E | 127 | Thrombin-bound Boophilin Displays A Functional And | 2e-20 | ||
| 1bik_A | 147 | X-Ray Structure Of Bikunin From The Human Inter-Alp | 6e-18 | ||
| 1kth_A | 58 | The Anisotropic Refinement Of Kunitz Type Domain C5 | 9e-11 | ||
| 1kth_A | 58 | The Anisotropic Refinement Of Kunitz Type Domain C5 | 7e-10 | ||
| 2jot_A | 55 | Nuclear Magnetic Resonance Studies On Huwentoxin-Xi | 2e-10 | ||
| 2jot_A | 55 | Nuclear Magnetic Resonance Studies On Huwentoxin-Xi | 4e-10 | ||
| 4dtg_K | 66 | Hemostatic Effect Of A Monoclonal Antibody Mab 2021 | 3e-10 | ||
| 4dtg_K | 66 | Hemostatic Effect Of A Monoclonal Antibody Mab 2021 | 4e-09 | ||
| 1tfx_C | 58 | Complex Of The Second Kunitz Domain Of Tissue Facto | 3e-10 | ||
| 1tfx_C | 58 | Complex Of The Second Kunitz Domain Of Tissue Facto | 4e-09 | ||
| 3byb_A | 59 | Crystal Structure Of Textilinin-1, A Kunitz-Type Se | 6e-10 | ||
| 3byb_A | 59 | Crystal Structure Of Textilinin-1, A Kunitz-Type Se | 8e-10 | ||
| 3d65_I | 57 | Crystal Structure Of Textilinin-1, A Kunitz-Type Se | 6e-10 | ||
| 3d65_I | 57 | Crystal Structure Of Textilinin-1, A Kunitz-Type Se | 9e-10 | ||
| 1qlq_A | 58 | Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant W | 1e-09 | ||
| 1adz_A | 71 | The Solution Structure Of The Second Kunitz Domain | 1e-09 | ||
| 1adz_A | 71 | The Solution Structure Of The Second Kunitz Domain | 5e-09 | ||
| 1uub_A | 56 | Solution Structure Of A Truncated Bovine Pancreatic | 1e-09 | ||
| 1aap_A | 58 | X-Ray Crystal Structure Of The Protease Inhibitor D | 2e-09 | ||
| 1aap_A | 58 | X-Ray Crystal Structure Of The Protease Inhibitor D | 2e-08 | ||
| 1brc_I | 56 | Relocating A Negative Charge In The Binding Pocket | 2e-09 | ||
| 1brc_I | 56 | Relocating A Negative Charge In The Binding Pocket | 3e-08 | ||
| 1bun_B | 61 | Structure Of Beta2-Bungarotoxin: Potassium Channel | 3e-09 | ||
| 1bun_B | 61 | Structure Of Beta2-Bungarotoxin: Potassium Channel | 7e-09 | ||
| 1co7_I | 99 | R117h Mutant Rat Anionic Trypsin Complexed With Bov | 3e-09 | ||
| 4tpi_I | 58 | The Refined 2.2-angstroms (0.22-nm) X-ray Crystal S | 3e-09 | ||
| 1irh_A | 61 | The Solution Structure Of The Third Kunitz Domain O | 4e-09 | ||
| 3p95_E | 58 | Human Mesotrypsin Complexed With Bovine Pancreatic | 5e-09 | ||
| 1zjd_B | 57 | Crystal Structure Of The Catalytic Domain Of Coagul | 5e-09 | ||
| 1zjd_B | 57 | Crystal Structure Of The Catalytic Domain Of Coagul | 2e-08 | ||
| 3p92_E | 58 | Human Mesotrypsin Complexed With Bovine Pancreatic | 6e-09 | ||
| 1ca0_D | 54 | Bovine Chymotrypsin Complexed To Appi Length = 54 | 6e-09 | ||
| 1ca0_D | 54 | Bovine Chymotrypsin Complexed To Appi Length = 54 | 3e-08 | ||
| 1uua_A | 56 | Solution Structure Of A Truncated Bovine Pancreatic | 6e-09 | ||
| 1tpa_I | 58 | The Geometry Of The Reactive Site And Of The Peptid | 7e-09 | ||
| 3tgi_I | 65 | Wild-Type Rat Anionic Trypsin Complexed With Bovine | 7e-09 | ||
| 1pit_A | 58 | Determination Of A High-Quality Nuclear Magnetic Re | 7e-09 | ||
| 1ld5_A | 58 | Structure Of Bpti Mutant A16v Length = 58 | 7e-09 | ||
| 2ddi_A | 70 | Nmr Structure Of The Second Kunitz Domain Of Human | 8e-09 | ||
| 2ddi_A | 70 | Nmr Structure Of The Second Kunitz Domain Of Human | 1e-08 | ||
| 1ejm_B | 58 | Crystal Structure Of The Bpti Ala16leu Mutant In Co | 8e-09 | ||
| 3l33_E | 52 | Human Mesotrypsin Complexed With Amyloid Precursor | 1e-08 | ||
| 3l33_E | 52 | Human Mesotrypsin Complexed With Amyloid Precursor | 4e-08 | ||
| 3btq_I | 58 | The Crystal Structures Of The Complexes Between Bov | 1e-08 | ||
| 3bth_I | 58 | The Crystal Structures Of The Complexes Between Bov | 1e-08 | ||
| 3l3t_E | 57 | Human Mesotrypsin Complexed With Amyloid Precursor | 1e-08 | ||
| 3l3t_E | 57 | Human Mesotrypsin Complexed With Amyloid Precursor | 5e-08 | ||
| 1yc0_I | 75 | Short Form Hgfa With First Kunitz Domain From Hai-1 | 1e-08 | ||
| 3bte_I | 58 | The Crystal Structures Of The Complexes Between Bov | 1e-08 | ||
| 1t8l_B | 59 | Crystal Structure Of The P1 Met Bpti Mutant- Bovine | 1e-08 | ||
| 1bti_A | 58 | Crevice-Forming Mutants In The Rigid Core Of Bovine | 1e-08 | ||
| 3btm_I | 58 | The Crystal Structures Of The Complexes Between Bov | 2e-08 | ||
| 3btt_I | 58 | The Crystal Structures Of The Complexes Between Bov | 2e-08 | ||
| 9pti_A | 58 | Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized | 2e-08 | ||
| 1ykt_B | 56 | TrypsinBPTI COMPLEX MUTANT Length = 56 | 2e-08 | ||
| 1jv8_A | 58 | Nmr Structure Of Bpti Mutant G37a Length = 58 | 2e-08 | ||
| 1bpt_A | 58 | Crevice-Forming Mutants Of Bpti: Crystal Structures | 2e-08 | ||
| 3btw_I | 58 | The Crystal Structures Of The Complexes Between Bov | 2e-08 | ||
| 3btd_I | 58 | The Crystal Structures Of The Complexes Between The | 2e-08 | ||
| 1p2j_I | 58 | Structural Consequences Of Accommodation Of Four No | 2e-08 | ||
| 1p2k_I | 58 | Structural Consequences Of Accommodation Of Four No | 2e-08 | ||
| 3btg_I | 58 | The Crystal Structures Of The Complexes Between Bov | 3e-08 | ||
| 1fak_I | 55 | Human Tissue Factor Complexed With Coagulation Fact | 3e-08 | ||
| 3btf_I | 58 | The Crystal Structures Of The Complexes Between Bov | 3e-08 | ||
| 1nag_A | 58 | Crevice-forming Mutants In The Rigid Core Of Bovine | 3e-08 | ||
| 1fan_A | 58 | Crevice-Forming Mutants In The Rigid Core Of Bovine | 4e-08 | ||
| 2fi4_I | 58 | Crystal Structure Of A Bpti Variant (Cys14->ser) In | 5e-08 | ||
| 2fi5_I | 58 | Crystal Structure Of A Bpti Variant (Cys38->ser) In | 5e-08 | ||
| 1zr0_B | 63 | Crystal Structure Of Kunitz Domain 1 Of Tissue Fact | 7e-08 | ||
| 1zr0_B | 63 | Crystal Structure Of Kunitz Domain 1 Of Tissue Fact | 1e-07 | ||
| 2ftm_B | 58 | Crystal Structure Of Trypsin Complexed With The Bpt | 8e-08 | ||
| 1jc6_A | 65 | Solution Structure Of Bungarus Faciatus Ix, A Kunit | 1e-07 | ||
| 1dtx_A | 59 | Crystal Structure Of Alpha-Dendrotoxin From The Gre | 1e-07 | ||
| 7pti_A | 58 | Structural Effects Induced By Removal Of A Disulfid | 2e-07 | ||
| 1aal_A | 58 | Structural Effects Induced By Mutagenesis Affected | 2e-07 | ||
| 1dem_A | 60 | Proteinase Inhibitor Homologues As Potassium Channe | 3e-07 | ||
| 2fi3_I | 58 | Crystal Structure Of A Bpti Variant (Cys14->ser, Cy | 3e-07 | ||
| 1dtk_A | 57 | The Nmr Solution Structure Of Dendrotoxin K From Th | 5e-07 | ||
| 1brb_I | 58 | Crystal Structures Of Rat Anionic Trypsin Complexed | 5e-07 | ||
| 2zjx_A | 58 | Bovine Pancreatic Trypsin Inhibitor (Bpti) Containi | 8e-06 | ||
| 2zvx_A | 58 | Structure Of A Bpti-[5,55] Variant Containing GlyVA | 9e-06 | ||
| 1bf0_A | 60 | Calcicludine (Cac) From Green Mamba Dendroaspis Ang | 1e-05 | ||
| 3fp7_J | 43 | Anionic Trypsin Variant S195a In Complex With Bovin | 1e-05 | ||
| 2kcr_A | 61 | Solution Structure Of Anntoxin Length = 61 | 1e-05 | ||
| 3ofw_A | 60 | Crystal Structure Of Recombinant Kunitz Type Serine | 1e-05 | ||
| 3ofw_A | 60 | Crystal Structure Of Recombinant Kunitz Type Serine | 6e-05 | ||
| 1ld6_A | 58 | Structure Of Bpti_8a Mutant Length = 58 | 2e-05 | ||
| 3m7q_B | 61 | Crystal Structure Of Recombinant Kunitz Type Serine | 3e-05 | ||
| 3m7q_B | 61 | Crystal Structure Of Recombinant Kunitz Type Serine | 5e-05 | ||
| 1shp_A | 55 | The Nmr Solution Structure Of A Kunitz-Type Protein | 4e-05 | ||
| 1shp_A | 55 | The Nmr Solution Structure Of A Kunitz-Type Protein | 5e-05 | ||
| 3t62_D | 54 | Crystal Structure Of Recombinant Kunitz Type Serine | 4e-05 | ||
| 3t62_D | 54 | Crystal Structure Of Recombinant Kunitz Type Serine | 8e-05 | ||
| 1ylc_B | 56 | TrypsinBPTI COMPLEX MUTANT Length = 56 | 5e-05 | ||
| 1y62_A | 60 | A 2.4 Crystal Structure Of Conkunitzin-S1, A Novel | 1e-04 | ||
| 1yld_B | 56 | TrypsinBPTI COMPLEX MUTANT Length = 56 | 1e-04 | ||
| 3uou_B | 55 | Crystal Structure Of The Kunitz-Type Protease Inhib | 1e-04 | ||
| 3uou_B | 55 | Crystal Structure Of The Kunitz-Type Protease Inhib | 2e-04 |
| >pdb|2ODY|E Chain E, Thrombin-bound Boophilin Displays A Functional And Accessible Reactive-site Loop Length = 127 | Back alignment and structure |
|
| >pdb|1BIK|A Chain A, X-Ray Structure Of Bikunin From The Human Inter-Alpha-Inhibitor Complex Length = 147 | Back alignment and structure |
| >pdb|1KTH|A Chain A, The Anisotropic Refinement Of Kunitz Type Domain C5 At 0.95 Angstrom Length = 58 | Back alignment and structure |
| >pdb|1KTH|A Chain A, The Anisotropic Refinement Of Kunitz Type Domain C5 At 0.95 Angstrom Length = 58 | Back alignment and structure |
| >pdb|2JOT|A Chain A, Nuclear Magnetic Resonance Studies On Huwentoxin-Xi From The Chinese Bird Spider Ornithoctonus Huwena Length = 55 | Back alignment and structure |
| >pdb|2JOT|A Chain A, Nuclear Magnetic Resonance Studies On Huwentoxin-Xi From The Chinese Bird Spider Ornithoctonus Huwena Length = 55 | Back alignment and structure |
| >pdb|4DTG|K Chain K, Hemostatic Effect Of A Monoclonal Antibody Mab 2021 Blocking The Interaction Between Fxa And Tfpi In A Rabbit Hemophilia Model Length = 66 | Back alignment and structure |
| >pdb|4DTG|K Chain K, Hemostatic Effect Of A Monoclonal Antibody Mab 2021 Blocking The Interaction Between Fxa And Tfpi In A Rabbit Hemophilia Model Length = 66 | Back alignment and structure |
| >pdb|1TFX|C Chain C, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 58 | Back alignment and structure |
| >pdb|1TFX|C Chain C, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 58 | Back alignment and structure |
| >pdb|3BYB|A Chain A, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom Length = 59 | Back alignment and structure |
| >pdb|3BYB|A Chain A, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom Length = 59 | Back alignment and structure |
| >pdb|3D65|I Chain I, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom, In Complex With Trypsin Length = 57 | Back alignment and structure |
| >pdb|3D65|I Chain I, Crystal Structure Of Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From The Australian Common Brown Snake Venom, In Complex With Trypsin Length = 57 | Back alignment and structure |
| >pdb|1QLQ|A Chain A, Bovine Pancreatic Trypsin Inhibitor (Bpti) Mutant With Altered Binding Loop Sequence Length = 58 | Back alignment and structure |
| >pdb|1ADZ|A Chain A, The Solution Structure Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor, Nmr, 30 Structures Length = 71 | Back alignment and structure |
| >pdb|1ADZ|A Chain A, The Solution Structure Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor, Nmr, 30 Structures Length = 71 | Back alignment and structure |
| >pdb|1UUB|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor Mutant, 3-58 Bpti (K15r, R17a, R42s) Length = 56 | Back alignment and structure |
| >pdb|1AAP|A Chain A, X-Ray Crystal Structure Of The Protease Inhibitor Domain Of Alzheimer's Amyloid Beta-Protein Precursor Length = 58 | Back alignment and structure |
| >pdb|1AAP|A Chain A, X-Ray Crystal Structure Of The Protease Inhibitor Domain Of Alzheimer's Amyloid Beta-Protein Precursor Length = 58 | Back alignment and structure |
| >pdb|1BRC|I Chain I, Relocating A Negative Charge In The Binding Pocket Of Trypsin Length = 56 | Back alignment and structure |
| >pdb|1BRC|I Chain I, Relocating A Negative Charge In The Binding Pocket Of Trypsin Length = 56 | Back alignment and structure |
| >pdb|1BUN|B Chain B, Structure Of Beta2-Bungarotoxin: Potassium Channel Binding By Kunitz Modules And Targeted Phospholipase Action Length = 61 | Back alignment and structure |
| >pdb|1BUN|B Chain B, Structure Of Beta2-Bungarotoxin: Potassium Channel Binding By Kunitz Modules And Targeted Phospholipase Action Length = 61 | Back alignment and structure |
| >pdb|1CO7|I Chain I, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 99 | Back alignment and structure |
| >pdb|4TPI|I Chain I, The Refined 2.2-angstroms (0.22-nm) X-ray Crystal Structure Of The Ternary Complex Formed By Bovine Trypsinogen, Valine-valine And The Arg15 Analogue Of Bovine Pancreatic Trypsin Inhibitor Length = 58 | Back alignment and structure |
| >pdb|1IRH|A Chain A, The Solution Structure Of The Third Kunitz Domain Of Tissue Factor Pathway Inhibitor Length = 61 | Back alignment and structure |
| >pdb|3P95|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17D) Length = 58 | Back alignment and structure |
| >pdb|1ZJD|B Chain B, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 57 | Back alignment and structure |
| >pdb|1ZJD|B Chain B, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 57 | Back alignment and structure |
| >pdb|3P92|E Chain E, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor Variant (Bpti-K15rR17G) Length = 58 | Back alignment and structure |
| >pdb|1CA0|D Chain D, Bovine Chymotrypsin Complexed To Appi Length = 54 | Back alignment and structure |
| >pdb|1CA0|D Chain D, Bovine Chymotrypsin Complexed To Appi Length = 54 | Back alignment and structure |
| >pdb|1UUA|A Chain A, Solution Structure Of A Truncated Bovine Pancreatic Trypsin Inhibitor, 3-58 Bpti Length = 56 | Back alignment and structure |
| >pdb|1TPA|I Chain I, The Geometry Of The Reactive Site And Of The Peptide Groups In Trypsin, Trypsinogen And Its Complexes With Inhibitors Length = 58 | Back alignment and structure |
| >pdb|3TGI|I Chain I, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 65 | Back alignment and structure |
| >pdb|1PIT|A Chain A, Determination Of A High-Quality Nuclear Magnetic Resonance Solution Structure Of The Bovine Pancreatic Trypsin Inhibitor And Comparison With Three Crystal Structures Length = 58 | Back alignment and structure |
| >pdb|1LD5|A Chain A, Structure Of Bpti Mutant A16v Length = 58 | Back alignment and structure |
| >pdb|2DDI|A Chain A, Nmr Structure Of The Second Kunitz Domain Of Human Wfikkn1 Length = 70 | Back alignment and structure |
| >pdb|2DDI|A Chain A, Nmr Structure Of The Second Kunitz Domain Of Human Wfikkn1 Length = 70 | Back alignment and structure |
| >pdb|1EJM|B Chain B, Crystal Structure Of The Bpti Ala16leu Mutant In Complex With Bovine Trypsin Length = 58 | Back alignment and structure |
| >pdb|3L33|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor(Appi) Length = 52 | Back alignment and structure |
| >pdb|3L33|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor(Appi) Length = 52 | Back alignment and structure |
| >pdb|3BTQ|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTH|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3L3T|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor Variant (Appir15k) Length = 57 | Back alignment and structure |
| >pdb|3L3T|E Chain E, Human Mesotrypsin Complexed With Amyloid Precursor Protein Inhibitor Variant (Appir15k) Length = 57 | Back alignment and structure |
| >pdb|1YC0|I Chain I, Short Form Hgfa With First Kunitz Domain From Hai-1 Length = 75 | Back alignment and structure |
| >pdb|3BTE|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta-Trypsin And Ten P1 Variants Of Bpti. Length = 58 | Back alignment and structure |
| >pdb|1T8L|B Chain B, Crystal Structure Of The P1 Met Bpti Mutant- Bovine Chymotrypsin Complex Length = 59 | Back alignment and structure |
| >pdb|1BTI|A Chain A, Crevice-Forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
| >pdb|3BTM|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTT|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|9PTI|A Chain A, Basic Pancreatic Trypsin Inhibitor (met 52 Oxidized) Length = 58 | Back alignment and structure |
| >pdb|1YKT|B Chain B, TrypsinBPTI COMPLEX MUTANT Length = 56 | Back alignment and structure |
| >pdb|1JV8|A Chain A, Nmr Structure Of Bpti Mutant G37a Length = 58 | Back alignment and structure |
| >pdb|1BPT|A Chain A, Crevice-Forming Mutants Of Bpti: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
| >pdb|3BTW|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|3BTD|I Chain I, The Crystal Structures Of The Complexes Between The Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|1P2J|I Chain I, Structural Consequences Of Accommodation Of Four Non- Cognate Amino-Acid Residues In The S1 Pocket Of Bovine Trypsin And Chymotrypsin Length = 58 | Back alignment and structure |
| >pdb|1P2K|I Chain I, Structural Consequences Of Accommodation Of Four Non- Cognate Amino-Acid Residues In The S1 Pocket Of Bovine Trypsin And Chymotrypsin Length = 58 | Back alignment and structure |
| >pdb|3BTG|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti Length = 58 | Back alignment and structure |
| >pdb|1FAK|I Chain I, Human Tissue Factor Complexed With Coagulation Factor Viia Inhibited With A Bpti-Mutant Length = 55 | Back alignment and structure |
| >pdb|3BTF|I Chain I, The Crystal Structures Of The Complexes Between Bovine Beta- Trypsin And Ten P1 Variants Of Bpti. Length = 58 | Back alignment and structure |
| >pdb|1NAG|A Chain A, Crevice-forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
| >pdb|1FAN|A Chain A, Crevice-Forming Mutants In The Rigid Core Of Bovine Pancreatic Trypsin Inhibitor: Crystal Structures Of F22a, Y23a, N43g, And F45a Length = 58 | Back alignment and structure |
| >pdb|2FI4|I Chain I, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 58 | Back alignment and structure |
| >pdb|2FI5|I Chain I, Crystal Structure Of A Bpti Variant (Cys38->ser) In Complex With Trypsin Length = 58 | Back alignment and structure |
| >pdb|1ZR0|B Chain B, Crystal Structure Of Kunitz Domain 1 Of Tissue Factor Pathway Inhibitor-2 With Bovine Trypsin Length = 63 | Back alignment and structure |
| >pdb|1ZR0|B Chain B, Crystal Structure Of Kunitz Domain 1 Of Tissue Factor Pathway Inhibitor-2 With Bovine Trypsin Length = 63 | Back alignment and structure |
| >pdb|2FTM|B Chain B, Crystal Structure Of Trypsin Complexed With The Bpti Variant (Tyr35- >gly) Length = 58 | Back alignment and structure |
| >pdb|1JC6|A Chain A, Solution Structure Of Bungarus Faciatus Ix, A Kunitz-Type Chymotrypsin Inhibitor Length = 65 | Back alignment and structure |
| >pdb|1DTX|A Chain A, Crystal Structure Of Alpha-Dendrotoxin From The Green Mamba Venom And Its Comparison With The Structure Of Bovine Pancreatic Trypsin Inhibitor Length = 59 | Back alignment and structure |
| >pdb|7PTI|A Chain A, Structural Effects Induced By Removal Of A Disulfide Bridge. The X-Ray Structure Of The C30a(Slash)c51a Mutant Of Basic Pancreatic Trypsin Inhibitor At 1.6 Angstroms Length = 58 | Back alignment and structure |
| >pdb|1AAL|A Chain A, Structural Effects Induced By Mutagenesis Affected By Crystal Packing Factors: The Structure Of A 30-51 Disulfide Mutant Of Basic Pancreatic Trypsin Inhibitor Length = 58 | Back alignment and structure |
| >pdb|1DEM|A Chain A, Proteinase Inhibitor Homologues As Potassium Channel Blockers Length = 60 | Back alignment and structure |
| >pdb|2FI3|I Chain I, Crystal Structure Of A Bpti Variant (Cys14->ser, Cys38->ser) In Complex With Trypsin Length = 58 | Back alignment and structure |
| >pdb|1DTK|A Chain A, The Nmr Solution Structure Of Dendrotoxin K From The Venom Of Dendroaspis Polylepis Polylepis Length = 57 | Back alignment and structure |
| >pdb|1BRB|I Chain I, Crystal Structures Of Rat Anionic Trypsin Complexed With The Protein Inhibitors Appi And Bpti Length = 58 | Back alignment and structure |
| >pdb|2ZJX|A Chain A, Bovine Pancreatic Trypsin Inhibitor (Bpti) Containing Only The [5,55] Disulfide Bond Length = 58 | Back alignment and structure |
| >pdb|2ZVX|A Chain A, Structure Of A Bpti-[5,55] Variant Containing GlyVAL AT THE 1438TH POSITIONS Length = 58 | Back alignment and structure |
| >pdb|1BF0|A Chain A, Calcicludine (Cac) From Green Mamba Dendroaspis Angusticeps, Nmr, 15 Structures Length = 60 | Back alignment and structure |
| >pdb|3FP7|J Chain J, Anionic Trypsin Variant S195a In Complex With Bovine Pancreatic Trypsin Inhibitor (Bpti) Cleaved At The Scissile Bond (Lys15-Ala16) Determined To The 1.46 A Resolution Limit Length = 43 | Back alignment and structure |
| >pdb|2KCR|A Chain A, Solution Structure Of Anntoxin Length = 61 | Back alignment and structure |
| >pdb|3OFW|A Chain A, Crystal Structure Of Recombinant Kunitz Type Serine Protease Inhibitor-1 From The Carribean Sea Anemone Stichodactyla Helianthus Length = 60 | Back alignment and structure |
| >pdb|3OFW|A Chain A, Crystal Structure Of Recombinant Kunitz Type Serine Protease Inhibitor-1 From The Carribean Sea Anemone Stichodactyla Helianthus Length = 60 | Back alignment and structure |
| >pdb|1LD6|A Chain A, Structure Of Bpti_8a Mutant Length = 58 | Back alignment and structure |
| >pdb|3M7Q|B Chain B, Crystal Structure Of Recombinant Kunitz Type Serine Protease Inhibitor-1 From The Caribbean Sea Anemone Stichodactyla Helianthus In Complex With Bovine Pancreatic Trypsin Length = 61 | Back alignment and structure |
| >pdb|3M7Q|B Chain B, Crystal Structure Of Recombinant Kunitz Type Serine Protease Inhibitor-1 From The Caribbean Sea Anemone Stichodactyla Helianthus In Complex With Bovine Pancreatic Trypsin Length = 61 | Back alignment and structure |
| >pdb|1SHP|A Chain A, The Nmr Solution Structure Of A Kunitz-Type Proteinase Inhibitor From The Sea Anemone Stichodactyla Helianthus Length = 55 | Back alignment and structure |
| >pdb|1SHP|A Chain A, The Nmr Solution Structure Of A Kunitz-Type Proteinase Inhibitor From The Sea Anemone Stichodactyla Helianthus Length = 55 | Back alignment and structure |
| >pdb|3T62|D Chain D, Crystal Structure Of Recombinant Kunitz Type Serine Protease Inhibitor-1 From The Caribbean Sea Anemone Stichodactyla Helianthus In Complex With Bovine Chymotrypsin Length = 54 | Back alignment and structure |
| >pdb|3T62|D Chain D, Crystal Structure Of Recombinant Kunitz Type Serine Protease Inhibitor-1 From The Caribbean Sea Anemone Stichodactyla Helianthus In Complex With Bovine Chymotrypsin Length = 54 | Back alignment and structure |
| >pdb|1YLC|B Chain B, TrypsinBPTI COMPLEX MUTANT Length = 56 | Back alignment and structure |
| >pdb|1Y62|A Chain A, A 2.4 Crystal Structure Of Conkunitzin-S1, A Novel Kunitz- Fold Cone Snail Neurotoxin. Length = 60 | Back alignment and structure |
| >pdb|1YLD|B Chain B, TrypsinBPTI COMPLEX MUTANT Length = 56 | Back alignment and structure |
| >pdb|3UOU|B Chain B, Crystal Structure Of The Kunitz-Type Protease Inhibitor Shpi-1 Lys13leu Mutant In Complex With Pancreatic Elastase Length = 55 | Back alignment and structure |
| >pdb|3UOU|B Chain B, Crystal Structure Of The Kunitz-Type Protease Inhibitor Shpi-1 Lys13leu Mutant In Complex With Pancreatic Elastase Length = 55 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 161 | |||
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 4e-45 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 3e-42 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 1e-20 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 5e-15 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 9e-26 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 7e-24 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 1e-25 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 3e-25 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 3e-25 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 8e-24 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 6e-25 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 3e-24 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 7e-25 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 2e-24 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 7e-25 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 3e-24 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 8e-25 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 6e-24 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 9e-25 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 2e-24 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 1e-24 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 8e-24 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 1e-24 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 6e-24 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 1e-24 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 3e-24 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 2e-24 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 4e-24 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 2e-24 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 2e-24 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 2e-24 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 5e-24 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 3e-24 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 4e-24 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 4e-24 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 5e-24 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 5e-24 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 5e-24 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 5e-24 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 9e-24 | |
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} Length = 6 | 5e-24 | |
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} Length = 6 | 6e-24 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 5e-24 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 1e-23 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 1e-23 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 3e-23 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 4e-21 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 6e-21 |
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} Length = 127 | Back alignment and structure |
|---|
Score = 143 bits (362), Expect = 4e-45
Identities = 44/123 (35%), Positives = 64/123 (52%), Gaps = 18/123 (14%)
Query: 52 DVCLLPPEPGLCRGYFQKFYFNPSTGQCVQFIYGGCNGNGNRFDSEEDC----------- 100
C LP + G+C+ +FYFN TG+C F YGGC GN N F++ E+C
Sbjct: 4 GFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEECQKACGAPERVN 63
Query: 101 -------IHVCLLPPEPGLCRGYFQKFYFNPSTGQCVQFIYGGCNGNGNRFDSEEDCIRT 153
C + G C G +++++N +G+C F+YGGC GN N ++SEE+C
Sbjct: 64 DFESADFKTGCEPAADSGSCAGQLERWFYNVQSGECETFVYGGCGGNDNNYESEEECELV 123
Query: 154 CKG 156
CK
Sbjct: 124 CKN 126
|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 | Back alignment and structure |
|---|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 | Back alignment and structure |
|---|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 Length = 147 | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Length = 70 | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A Length = 70 | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Length = 58 | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A Length = 58 | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Length = 65 | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 Length = 65 | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Length = 59 | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A Length = 59 | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Length = 58 | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A Length = 58 | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} PDB: 3ofw_A 1shp_A Length = 61 | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} PDB: 3ofw_A 1shp_A Length = 61 | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Length = 60 | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A Length = 60 | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Length = 58 | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... Length = 58 | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Length = 59 | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I Length = 59 | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Length = 57 | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 Length = 57 | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Length = 60 | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 Length = 60 | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 71 | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 71 | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Length = 66 | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C Length = 66 | Back alignment and structure |
|---|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Length = 63 | Back alignment and structure |
|---|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 Length = 63 | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Length = 58 | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E Length = 58 | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Length = 65 | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I Length = 65 | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} Length = 61 | Back alignment and structure |
|---|
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} Length = 61 | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 Length = 61 | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Length = 99 | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 Length = 99 | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Length = 55 | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} Length = 55 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 100.0 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 100.0 | |
| 1toc_R | 120 | Ornithodorin; vitamin K, zymogen, gamma-carboxyglu | 99.89 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.79 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 99.79 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 99.78 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.78 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 99.78 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 99.78 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 99.78 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 99.78 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 99.78 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 99.78 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 99.78 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 99.78 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 99.77 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 99.77 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 99.77 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 99.77 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 99.77 | |
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} | 99.76 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 99.76 | |
| 3aub_A | 58 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.76 | |
| 2ddi_A | 70 | WAP, follistatin/kazal, immunoglobulin, kunitz and | 99.75 | |
| 1dtk_A | 57 | Dendrotoxin K; presynaptic neurotoxin; NMR {Dendro | 99.75 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 99.75 | |
| 1kth_A | 58 | Collagen alpha 3(VI) chain; anisotropic refinement | 99.75 | |
| 1y62_A | 60 | Conkunitzin-S1; alpha helix, beta sheet, 310 helix | 99.75 | |
| 4dtg_K | 66 | Tissue factor pathway inhibitor; antibody, blood c | 99.74 | |
| 1g6x_A | 58 | Pancreatic trypsin inhibitor; serine protease inhi | 99.74 | |
| 3aug_A | 65 | BPTI, bovine pancreatic trypsin inhibitor; serine | 99.74 | |
| 1dtx_A | 59 | Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A { | 99.74 | |
| 3byb_A | 59 | Textilinin, textilinin-1; BPTI-like, beta hairpin, | 99.74 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 99.74 | |
| 1bf0_A | 60 | Calcicludine; calcium channel blocker; NMR {Dendro | 99.73 | |
| 1bun_B | 61 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 99.73 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 99.73 | |
| 1yc0_I | 75 | Kunitz-type protease inhibitor 1; hydrolase/inhibi | 99.73 | |
| 3m7q_B | 61 | Kunitz-type proteinase inhibitor SHPI-1; trypsin-i | 99.73 | |
| 1aap_A | 58 | Alzheimer'S disease amyloid A4 protein; proteinase | 99.73 | |
| 1zr0_B | 63 | TFPI-2, tissue factor pathway inhibitor 2, PP5; se | 99.73 | |
| 1jc6_A | 65 | Venom basic protease inhibitors IX and VIIIB; snak | 99.73 | |
| 1irh_A | 61 | Tissue factor pathway inhibitor; non-protease inhi | 99.72 | |
| 2kcr_A | 61 | Anntoxin; protein; NMR {Hyla annectans} | 99.71 | |
| 1adz_A | 71 | TFPI, EPI, LACI, tissue factor pathway inhibitor; | 99.71 | |
| 2jot_A | 55 | Huwentoxin-11; proteinase inhibitor; NMR {Ornithoc | 99.71 | |
| 1co7_I | 99 | BPTI, bovine pancreatic trypsin inhibitor; complex | 99.68 | |
| 2uuy_B | 52 | Tryptase inhibitor; calcium, zymogen, protease, hy | 99.63 | |
| 1toc_R | 120 | Ornithodorin; vitamin K, zymogen, gamma-carboxyglu | 99.61 | |
| 2ody_E | 127 | Boophilin; kunitz-type thrombin inhibitor, blood c | 99.6 | |
| 1bik_A | 147 | Bikunin; glycoprotein, trypstatin, urinary trypsin | 99.56 | |
| 2uuy_B | 52 | Tryptase inhibitor; calcium, zymogen, protease, hy | 99.55 | |
| 2w8x_A | 72 | ION-channel modulator raklp; salivary gland, kunit | 91.62 | |
| 2w8x_A | 72 | ION-channel modulator raklp; salivary gland, kunit | 90.9 | |
| 1d0d_A | 60 | TAP, anticoagulant protein; factor XA inhibitor, k | 84.52 |
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} | Back alignment and structure |
|---|
Probab=100.00 E-value=6.2e-34 Score=205.61 Aligned_cols=107 Identities=41% Similarity=1.063 Sum_probs=101.3
Q ss_pred CCCCCcCCCCCcCCCCceeeEEEeCCCCCeeeeecCCcCCCCCCCCChhhhhhh------------------cCCCCCCC
Q psy10710 50 VLDVCLLPPEPGLCRGYFQKFYFNPSTGQCVQFIYGGCNGNGNRFDSEEDCIHV------------------CLLPPEPG 111 (161)
Q Consensus 50 ~~~~C~~~~~~g~C~~~~~rw~yn~~~~~C~~f~~~gC~gn~N~F~s~~eC~~~------------------C~~p~~~g 111 (161)
.+++|.+|++.|.|++.++|||||+.+++|+.|.|+||+||.|+|.|+++|++. |.+|++.|
T Consensus 2 ~~~~C~~p~~~G~C~~~~~r~~yn~~t~~C~~F~y~GC~gN~N~F~t~~~C~~~C~~~~~~~~~~~~~~~~~C~~p~~~G 81 (127)
T 2ody_E 2 RNGFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEECQKACGAPERVNDFESADFKTGCEPAADSG 81 (127)
T ss_dssp CBGGGGSCCCCCSSCCCEEEEEEETTTTEEEEEEECSSCCCSSCBSSHHHHHHHHSSCCCCCCCCCCCHHHHTSSCCCCC
T ss_pred CCCcccCCCCCccCcCceeeEEEECCCCeeeEeecCCcCCCccccCcHHHHHHhccccccccccccCCcCCcCCCcCCCC
Confidence 457899999999999999999999999999999999999999999999999974 55677899
Q ss_pred CcccceeeeEEeCCCCceeeEEecCcCCCCCCCCChHHHHhhcCC
Q psy10710 112 LCRGYFQKFYFNPSTGQCVQFIYGGCNGNGNRFDSEEDCIRTCKG 156 (161)
Q Consensus 112 ~C~~~~~ryyyn~~~~~C~~f~~~GC~gn~N~F~t~~~C~~~C~~ 156 (161)
.|.+..+|||||+++++|++|.|+||+||.|+|.|+++|+++|.+
T Consensus 82 ~C~~~~~r~~yd~~~~~C~~F~Y~GC~GN~N~F~t~~eC~~~C~~ 126 (127)
T 2ody_E 82 SCAGQLERWFYNVQSGECETFVYGGCGGNDNNYESEEECELVCKN 126 (127)
T ss_dssp SSCCCEEEEEEETTTTEEEEEEECSSCCCSCCBSSHHHHHHHHSC
T ss_pred cccCcceeEEECCCCCceeEEEECCcCCCCcCcCCHHHHHHHccC
Confidence 999999999999999999999999999999999999999999985
|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 | Back alignment and structure |
|---|
| >1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >3aub_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 1.00A {Bos taurus} PDB: 3aui_A 3auh_A 3ci7_A | Back alignment and structure |
|---|
| >2ddi_A WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1; kunitz domain, protein binding; NMR {Homo sapiens} PDB: 2ddj_A | Back alignment and structure |
|---|
| >1dtk_A Dendrotoxin K; presynaptic neurotoxin; NMR {Dendroaspis polylepis polylepis} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1kth_A Collagen alpha 3(VI) chain; anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein; 0.95A {Homo sapiens} SCOP: g.8.1.1 PDB: 1knt_A 1kun_A 2knt_A | Back alignment and structure |
|---|
| >1y62_A Conkunitzin-S1; alpha helix, beta sheet, 310 helix, kunitz fold, toxin; 2.45A {Synthetic} PDB: 1yl2_A 2ca7_A 2j6d_A | Back alignment and structure |
|---|
| >4dtg_K Tissue factor pathway inhibitor; antibody, blood coagulation, blood clotting inhib immune system complex; HET: MES PGE; 1.80A {Homo sapiens} PDB: 1tfx_C | Back alignment and structure |
|---|
| >1g6x_A Pancreatic trypsin inhibitor; serine protease inhibitor, hydrolase inhibitor; 0.86A {Bos taurus} SCOP: g.8.1.1 PDB: 1k6u_A 1qlq_A 4tpi_I 1ld5_A 3btq_I 3bth_I 1t8m_B 5pti_A 1b0c_A 1bhc_A* 1bth_P 1bz5_A 1bzx_I 1cbw_D 1d0d_B 1eaw_B 1fy8_I 1mtn_D 1oa5_5 1oa6_5 ... | Back alignment and structure |
|---|
| >3aug_A BPTI, bovine pancreatic trypsin inhibitor; serine protease inhibitor, inhibits serine protease, trypsin hydrolase inhibitor; 1.40A {Bos taurus} PDB: 3aue_A 3auc_A 3aud_A 1f7z_I 1f5r_I 3tgi_I 3tgj_I 3tgk_I | Back alignment and structure |
|---|
| >1dtx_A Alpha-dendrotoxin; presynaptic neurotoxin; 2.20A {Dendroaspis angusticeps} SCOP: g.8.1.1 PDB: 1dem_A 1den_A | Back alignment and structure |
|---|
| >3byb_A Textilinin, textilinin-1; BPTI-like, beta hairpin, kunitz-type protease inhibitor, trypsin, plasmin, hydrolase inhibitor; 1.63A {Pseudonaja textilis textilis} PDB: 3d65_I | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} | Back alignment and structure |
|---|
| >1bf0_A Calcicludine; calcium channel blocker; NMR {Dendroaspis angusticeps} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1bun_B BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1yc0_I Kunitz-type protease inhibitor 1; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3m7q_B Kunitz-type proteinase inhibitor SHPI-1; trypsin-inhibitor complex, kunitz-type serine-protease inhib digestion, disulfide bond; 1.70A {Stichodactyla helianthus} SCOP: g.8.1.1 PDB: 3ofw_A 1shp_A 3t62_D 3uou_B | Back alignment and structure |
|---|
| >1aap_A Alzheimer'S disease amyloid A4 protein; proteinase inhibitor (trypsin); 1.50A {Homo sapiens} SCOP: g.8.1.1 PDB: 1taw_B 1brc_I 1zjd_B 3l3t_E 1ca0_D 3l33_E | Back alignment and structure |
|---|
| >1zr0_B TFPI-2, tissue factor pathway inhibitor 2, PP5; serine protease, complex of serine protease/inhibitor, kunitz type inhibitor; 1.80A {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1jc6_A Venom basic protease inhibitors IX and VIIIB; snake venom, kunitz inhibitor, neurotoxin, solution structure, BF IX, chymotrypsin inhibitor; NMR {Bungarus fasciatus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >1irh_A Tissue factor pathway inhibitor; non-protease inhibitor, kunitz domain, protein binding; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >2kcr_A Anntoxin; protein; NMR {Hyla annectans} | Back alignment and structure |
|---|
| >1adz_A TFPI, EPI, LACI, tissue factor pathway inhibitor; hydrolase, coagulation; NMR {Homo sapiens} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >2jot_A Huwentoxin-11; proteinase inhibitor; NMR {Ornithoctonus huwena} | Back alignment and structure |
|---|
| >1co7_I BPTI, bovine pancreatic trypsin inhibitor; complex (serine protease/inhibitor), hydrolase/hydrolase inhibitor complex; 1.90A {Bos taurus} SCOP: g.8.1.1 | Back alignment and structure |
|---|
| >2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A | Back alignment and structure |
|---|
| >1toc_R Ornithodorin; vitamin K, zymogen, gamma-carboxyglutamic acid, acute phase, liver, hydrolase, serine protease kunitz-like inhibitor, kringle; 3.10A {Ornithodoros moubata} SCOP: g.8.1.2 g.8.1.2 | Back alignment and structure |
|---|
| >2ody_E Boophilin; kunitz-type thrombin inhibitor, blood clotting-blood clottin inhibitor complex; HET: NAG; 2.35A {Rhipicephalus microplus} | Back alignment and structure |
|---|
| >1bik_A Bikunin; glycoprotein, trypstatin, urinary trypsin inhibitor acid-rich protein, serine protease inhibitor (kunitz type), glycosylated protein; HET: NAG; 2.50A {Homo sapiens} SCOP: g.8.1.1 g.8.1.1 | Back alignment and structure |
|---|
| >2uuy_B Tryptase inhibitor; calcium, zymogen, protease, hydrolase, digestion, metal- binding, serine protease; 1.15A {Rhipicephalus appendiculatus} SCOP: g.8.1.3 PDB: 2lfk_A 2lfl_A 2uux_A | Back alignment and structure |
|---|
| >2w8x_A ION-channel modulator raklp; salivary gland, kunitz domains, maxik channel activation, sulphur SAD, membrane protein; 1.60A {Rhipicephalus appendiculatus} | Back alignment and structure |
|---|
| >2w8x_A ION-channel modulator raklp; salivary gland, kunitz domains, maxik channel activation, sulphur SAD, membrane protein; 1.60A {Rhipicephalus appendiculatus} | Back alignment and structure |
|---|
| >1d0d_A TAP, anticoagulant protein; factor XA inhibitor, kunitz inhibitor, blood clotting inhibitor; 1.62A {Ornithodoros moubata} SCOP: g.8.1.2 PDB: 1kig_I 1tap_A 1tcp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 161 | ||||
| d1jc6a_ | 65 | g.8.1.1 (A:) Venom basic protease inhibitor IX (VI | 7e-22 | |
| d1jc6a_ | 65 | g.8.1.1 (A:) Venom basic protease inhibitor IX (VI | 6e-21 | |
| d1dtxa_ | 59 | g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendr | 1e-21 | |
| d1dtxa_ | 59 | g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendr | 4e-21 | |
| d1shpa_ | 55 | g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stich | 2e-21 | |
| d1shpa_ | 55 | g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stich | 4e-20 | |
| d1g6xa_ | 58 | g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {C | 3e-21 | |
| d1g6xa_ | 58 | g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {C | 2e-20 | |
| d1ktha_ | 58 | g.8.1.1 (A:) Collagen type VI (domain C5 from alph | 3e-21 | |
| d1ktha_ | 58 | g.8.1.1 (A:) Collagen type VI (domain C5 from alph | 1e-20 | |
| d1zr0b1 | 63 | g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor | 4e-21 | |
| d1zr0b1 | 63 | g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor | 6e-21 | |
| d1tfxc_ | 58 | g.8.1.1 (C:) Tissue factor pathway inhibitor {Huma | 4e-21 | |
| d1tfxc_ | 58 | g.8.1.1 (C:) Tissue factor pathway inhibitor {Huma | 1e-20 | |
| d1aapa_ | 56 | g.8.1.1 (A:) Alzheimer's amyloid B-protein precurs | 5e-21 | |
| d1aapa_ | 56 | g.8.1.1 (A:) Alzheimer's amyloid B-protein precurs | 9e-21 | |
| d1dtka_ | 57 | g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroasp | 6e-21 | |
| d1dtka_ | 57 | g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroasp | 6e-20 | |
| d1bika1 | 54 | g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibit | 7e-21 | |
| d1bika1 | 54 | g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibit | 1e-19 | |
| d1bika2 | 56 | g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibi | 8e-21 | |
| d1bika2 | 56 | g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibi | 3e-20 | |
| d1bf0a_ | 60 | g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dend | 9e-21 | |
| d1bf0a_ | 60 | g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dend | 3e-20 | |
| d1irha_ | 61 | g.8.1.1 (A:) Tissue factor pathway inhibitor {Huma | 1e-20 | |
| d1irha_ | 61 | g.8.1.1 (A:) Tissue factor pathway inhibitor {Huma | 4e-20 | |
| d1bunb_ | 61 | g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain | 1e-20 | |
| d1bunb_ | 61 | g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain | 3e-20 |
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Length = 65 | Back information, alignment and structure |
|---|
class: Small proteins fold: BPTI-like superfamily: BPTI-like family: Small Kunitz-type inhibitors & BPTI-like toxins domain: Venom basic protease inhibitor IX (VIIIb) species: Banded krait (Bungarus fasciatus) [TaxId: 8613]
Score = 81.1 bits (200), Expect = 7e-22
Identities = 24/56 (42%), Positives = 30/56 (53%)
Query: 103 VCLLPPEPGLCRGYFQKFYFNPSTGQCVQFIYGGCNGNGNRFDSEEDCIRTCKGTY 158
C L PE G C FY+N +C +F YGGC GN N F + ++C RTC Y
Sbjct: 6 FCNLLPETGRCNALIPAFYYNSHLHKCQKFNYGGCGGNANNFKTIDECQRTCAAKY 61
|
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} Length = 65 | Back information, alignment and structure |
|---|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 59 | Back information, alignment and structure |
|---|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 59 | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Length = 55 | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} Length = 55 | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Length = 58 | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Length = 57 | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} Length = 57 | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 54 | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 54 | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 60 | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} Length = 60 | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Length = 61 | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} Length = 61 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| d1aapa_ | 56 | Alzheimer's amyloid B-protein precursor, APPI {Hum | 99.81 | |
| d1dtxa_ | 59 | alpha-Dendrotoxin {Green mamba (Dendroaspis angust | 99.8 | |
| d1dtka_ | 57 | Dendrotoxin K {Black mamba (Dendroaspis polylepis | 99.79 | |
| d1bika2 | 56 | Bikunin from inter-alpha-inhibitor complex {Human | 99.78 | |
| d1dtka_ | 57 | Dendrotoxin K {Black mamba (Dendroaspis polylepis | 99.78 | |
| d1shpa_ | 55 | Trypsin inhibitor {Sea anemone (Stichodactyla heli | 99.78 | |
| d1bika2 | 56 | Bikunin from inter-alpha-inhibitor complex {Human | 99.78 | |
| d1bika1 | 54 | Bikunin from inter-alpha-inhibitor complex {Human | 99.78 | |
| d1ktha_ | 58 | Collagen type VI (domain C5 from alpha 3 chain) {H | 99.78 | |
| d1ktha_ | 58 | Collagen type VI (domain C5 from alpha 3 chain) {H | 99.78 | |
| d1bika1 | 54 | Bikunin from inter-alpha-inhibitor complex {Human | 99.78 | |
| d1jc6a_ | 65 | Venom basic protease inhibitor IX (VIIIb) {Banded | 99.77 | |
| d1aapa_ | 56 | Alzheimer's amyloid B-protein precursor, APPI {Hum | 99.77 | |
| d1g6xa_ | 58 | Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru | 99.77 | |
| d1dtxa_ | 59 | alpha-Dendrotoxin {Green mamba (Dendroaspis angust | 99.77 | |
| d1bf0a_ | 60 | Calcicludine (cac) {Green mamba (Dendroaspis angus | 99.77 | |
| d1shpa_ | 55 | Trypsin inhibitor {Sea anemone (Stichodactyla heli | 99.77 | |
| d1tfxc_ | 58 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.77 | |
| d1bunb_ | 61 | beta2-bungarotoxin, neurotoxin chain {Many-banded | 99.77 | |
| d1zr0b1 | 63 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.76 | |
| d1irha_ | 61 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.76 | |
| d1zr0b1 | 63 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.76 | |
| d1g6xa_ | 58 | Pancreatic trypsin inhibitor, BPTI {Cow (Bos tauru | 99.74 | |
| d1bunb_ | 61 | beta2-bungarotoxin, neurotoxin chain {Many-banded | 99.74 | |
| d1bf0a_ | 60 | Calcicludine (cac) {Green mamba (Dendroaspis angus | 99.73 | |
| d1tfxc_ | 58 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.73 | |
| d1jc6a_ | 65 | Venom basic protease inhibitor IX (VIIIb) {Banded | 99.72 | |
| d1irha_ | 61 | Tissue factor pathway inhibitor {Human (Homo sapie | 99.72 | |
| d1tocr2 | 63 | Ornithodorin {Soft tick (Ornithodoros moubata) [Ta | 97.21 | |
| d1tocr2 | 63 | Ornithodorin {Soft tick (Ornithodoros moubata) [Ta | 97.11 | |
| d1d0da_ | 60 | Anticoagulant protein, factor Xa inhibitor {Soft t | 84.73 |
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: BPTI-like superfamily: BPTI-like family: Small Kunitz-type inhibitors & BPTI-like toxins domain: Alzheimer's amyloid B-protein precursor, APPI species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81 E-value=1.4e-20 Score=115.58 Aligned_cols=56 Identities=46% Similarity=1.057 Sum_probs=53.5
Q ss_pred CCCCCcCCCCCcCCCCceeeEEEeCCCCCeeeeecCCcCCCCCCCCChhhhhhhcC
Q psy10710 50 VLDVCLLPPEPGLCRGYFQKFYFNPSTGQCVQFIYGGCNGNGNRFDSEEDCIHVCL 105 (161)
Q Consensus 50 ~~~~C~~~~~~g~C~~~~~rw~yn~~~~~C~~f~~~gC~gn~N~F~s~~eC~~~C~ 105 (161)
++++|.+|++.|+|++.++|||||+.+++|+.|.|+||+||.|+|.|+++|++.|.
T Consensus 1 v~d~C~~p~~~G~C~~~~~rwyyd~~~~~C~~F~y~GCgGN~NnF~t~~~C~~~CG 56 (56)
T d1aapa_ 1 VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG 56 (56)
T ss_dssp CGGGGGBCCCCCSSSCCEEEEEEETTTTEEEEEEECSSSCCSCCBSSHHHHHHHHC
T ss_pred CCcccCCCCCCcCCCCceeEEEEECCCCcEeeeEcCCccCCccCcCCHHHHHHhhC
Confidence 46899999999999999999999999999999999999999999999999999883
|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtka_ g.8.1.1 (A:) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis) [TaxId: 8620]} | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} | Back information, alignment and structure |
|---|
| >d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ktha_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bika1 g.8.1.1 (A:25-78) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} | Back information, alignment and structure |
|---|
| >d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]} | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} | Back information, alignment and structure |
|---|
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zr0b1 g.8.1.1 (B:1A-59) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (Bungarus multicinctus) [TaxId: 8616]} | Back information, alignment and structure |
|---|
| >d1bf0a_ g.8.1.1 (A:) Calcicludine (cac) {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]} | Back information, alignment and structure |
|---|
| >d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jc6a_ g.8.1.1 (A:) Venom basic protease inhibitor IX (VIIIb) {Banded krait (Bungarus fasciatus) [TaxId: 8613]} | Back information, alignment and structure |
|---|
| >d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tocr2 g.8.1.2 (R:57-119) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]} | Back information, alignment and structure |
|---|
| >d1tocr2 g.8.1.2 (R:57-119) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]} | Back information, alignment and structure |
|---|
| >d1d0da_ g.8.1.2 (A:) Anticoagulant protein, factor Xa inhibitor {Soft tick (Ornithodoros moubata) [TaxId: 6938]} | Back information, alignment and structure |
|---|