Psyllid ID: psy10748

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MSGGFKMAPKVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTIMLKGDNITLIQNLNPDEVKV
ccccccccccccEEEEccHHHHHHHHccccEEEEEEEEcccEEEEEEEEEEccEEEEEEEcEEEEEEcccccEEEEEEEEEccEEEEEEccccccccc
cccccccccccEEEcccHHHHHHHHHHcccEEEEEEEEcccEEEEEEEEccHHHHHEEEHccEEEcccccccccccEEEEccccEEEEEEcccccccc
msggfkmapkVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTImlkgdnitliqnlnpdevkv
msggfkmapkvqKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTIMlkgdnitliqnlnpdevkv
MSGGFKMAPKVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTIMLKGDNITLIQNLNPDEVKV
**********VQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTIMLKGDNITLIQ*********
******************INLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTIMLKGDNITLI**********
*********KVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTIMLKGDNITLIQNLNPDEVKV
********PKVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTIMLKGDNITLIQNLNP*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGGFKMAPKVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTIMLKGDNITLIQNLNPDEVKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query98 2.2.26 [Sep-21-2011]
Q9VLV594 Probable small nuclear ri yes N/A 0.918 0.957 0.755 1e-35
A1XQR992 Small nuclear ribonucleop yes N/A 0.867 0.923 0.741 3e-32
P6230592 Small nuclear ribonucleop yes N/A 0.867 0.923 0.729 1e-31
P6230492 Small nuclear ribonucleop yes N/A 0.867 0.923 0.729 1e-31
P6230392 Small nuclear ribonucleop yes N/A 0.867 0.923 0.729 1e-31
A4FUI292 Small nuclear ribonucleop yes N/A 0.867 0.923 0.729 1e-31
Q7ZUG092 Small nuclear ribonucleop yes N/A 0.846 0.902 0.734 7e-31
A8XDT090 Probable small nuclear ri N/A N/A 0.816 0.888 0.687 2e-28
Q9XTU690 Probable small nuclear ri yes N/A 0.816 0.888 0.675 2e-27
Q9USZ384 Small nuclear ribonucleop yes N/A 0.836 0.976 0.554 3e-20
>sp|Q9VLV5|RUXE_DROME Probable small nuclear ribonucleoprotein E OS=Drosophila melanogaster GN=SmE PE=3 SV=1 Back     alignment and function desciption
 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 68/90 (75%), Positives = 81/90 (90%)

Query: 4  GFKMAPKVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAE 63
           FK  PKVQKVMVQPINLIFR+LQNRSRVQ+WLYEN++LRIEGHI+GFDEYMN+VL+ AE
Sbjct: 2  SFKGNPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAE 61

Query: 64 EYNIKSKTRKALGTIMLKGDNITLIQNLNP 93
          E  +K++ R+ LG IMLKGDNITLIQN++P
Sbjct: 62 EVYVKTRQRRNLGRIMLKGDNITLIQNVSP 91
Associated with snRNP U1, U2, U4/U6 and U5.
Drosophila melanogaster (taxid: 7227)
>sp|A1XQR9|RUXE_PIG Small nuclear ribonucleoprotein E OS=Sus scrofa GN=SNRPE PE=3 SV=1 Back     alignment and function description
>sp|P62305|RUXE_MOUSE Small nuclear ribonucleoprotein E OS=Mus musculus GN=Snrpe PE=2 SV=1 Back     alignment and function description
>sp|P62304|RUXE_HUMAN Small nuclear ribonucleoprotein E OS=Homo sapiens GN=SNRPE PE=1 SV=1 Back     alignment and function description
>sp|P62303|RUXE_CHICK Small nuclear ribonucleoprotein E OS=Gallus gallus GN=SNRPE PE=3 SV=1 Back     alignment and function description
>sp|A4FUI2|RUXE_BOVIN Small nuclear ribonucleoprotein E OS=Bos taurus GN=SNRPE PE=3 SV=1 Back     alignment and function description
>sp|Q7ZUG0|RUXE_DANRE Small nuclear ribonucleoprotein E OS=Danio rerio GN=snrpe PE=3 SV=1 Back     alignment and function description
>sp|A8XDT0|RUXE_CAEBR Probable small nuclear ribonucleoprotein E OS=Caenorhabditis briggsae GN=snr-6 PE=3 SV=1 Back     alignment and function description
>sp|Q9XTU6|RUXE_CAEEL Probable small nuclear ribonucleoprotein E OS=Caenorhabditis elegans GN=snr-6 PE=3 SV=1 Back     alignment and function description
>sp|Q9USZ3|RUXE_SCHPO Small nuclear ribonucleoprotein E OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sme1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
357631258 463 hypothetical protein KGM_10301 [Danaus p 0.928 0.196 0.791 3e-38
15655438994 PREDICTED: probable small nuclear ribonu 0.918 0.957 0.8 1e-36
38961285795 small ribonucleoprotein particle protein 0.928 0.957 0.791 5e-36
34072032394 PREDICTED: probable small nuclear ribonu 0.918 0.957 0.788 2e-35
34290593297 small nuclear ribonucleoprotein E [Rhodn 0.918 0.927 0.777 3e-35
307213117 295 Probable small nuclear ribonucleoprotein 0.908 0.301 0.797 3e-35
39017660894 GA15004 [Drosophila pseudoobscura pseudo 0.938 0.978 0.75 4e-35
29123550492 PREDICTED: small nuclear ribonucleoprote 0.897 0.956 0.772 7e-35
380023740129 PREDICTED: probable small nuclear ribonu 0.918 0.697 0.777 7e-35
32877804694 PREDICTED: probable small nuclear ribonu 0.918 0.957 0.777 8e-35
>gi|357631258|gb|EHJ78848.1| hypothetical protein KGM_10301 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 72/91 (79%), Positives = 83/91 (91%)

Query: 4  GFKMAPKVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAE 63
           +K  PKVQKVMVQPINLIFR+LQNRSRVQIWLYENVNLRIEGHI+GFDEYMNIVL+ AE
Sbjct: 2  AYKGPPKVQKVMVQPINLIFRYLQNRSRVQIWLYENVNLRIEGHIVGFDEYMNIVLDEAE 61

Query: 64 EYNIKSKTRKALGTIMLKGDNITLIQNLNPD 94
          E ++K+K RK +G IM+KGDNITLIQN+NP+
Sbjct: 62 EVHMKTKNRKQIGRIMMKGDNITLIQNVNPN 92

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156554389|ref|XP_001600882.1| PREDICTED: probable small nuclear ribonucleoprotein E-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|389612857|dbj|BAM19829.1| small ribonucleoprotein particle protein SmE [Papilio xuthus] Back     alignment and taxonomy information
>gi|340720323|ref|XP_003398590.1| PREDICTED: probable small nuclear ribonucleoprotein E-like [Bombus terrestris] gi|350408777|ref|XP_003488510.1| PREDICTED: probable small nuclear ribonucleoprotein E-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|342905932|gb|AEL79249.1| small nuclear ribonucleoprotein E [Rhodnius prolixus] gi|342905938|gb|AEL79252.1| small nuclear ribonucleoprotein E [Rhodnius prolixus] Back     alignment and taxonomy information
>gi|307213117|gb|EFN88639.1| Probable small nuclear ribonucleoprotein E [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|390176608|ref|XP_003736146.1| GA15004 [Drosophila pseudoobscura pseudoobscura] gi|388858695|gb|EIM52219.1| GA15004 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|291235504|ref|XP_002737683.1| PREDICTED: small nuclear ribonucleoprotein polypeptide E-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|380023740|ref|XP_003695670.1| PREDICTED: probable small nuclear ribonucleoprotein E-like [Apis florea] Back     alignment and taxonomy information
>gi|328778046|ref|XP_003249437.1| PREDICTED: probable small nuclear ribonucleoprotein E-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
FB|FBgn026179094 SmE "Small ribonucleoprotein p 0.908 0.946 0.764 1.5e-33
UNIPROTKB|A1XQR992 SNRPE "Small nuclear ribonucle 0.867 0.923 0.741 2.3e-30
UNIPROTKB|P6230392 SNRPE "Small nuclear ribonucle 0.846 0.902 0.746 4.9e-30
UNIPROTKB|A4FUI292 SNRPE "Small nuclear ribonucle 0.846 0.902 0.746 4.9e-30
UNIPROTKB|P6230492 SNRPE "Small nuclear ribonucle 0.846 0.902 0.746 4.9e-30
UNIPROTKB|I3LDW992 SNRPE "Small nuclear ribonucle 0.846 0.902 0.746 4.9e-30
MGI|MGI:9834692 Snrpe "small nuclear ribonucle 0.846 0.902 0.746 4.9e-30
RGD|232167592 Snrpe "small nuclear ribonucle 0.846 0.902 0.746 4.9e-30
ZFIN|ZDB-GENE-040426-111292 snrpe "small nuclear ribonucle 0.846 0.902 0.734 1e-29
RGD|231888392 LOC100362099 "small nuclear ri 0.846 0.902 0.734 1.3e-29
FB|FBgn0261790 SmE "Small ribonucleoprotein particle protein SmE" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 365 (133.5 bits), Expect = 1.5e-33, P = 1.5e-33
 Identities = 68/89 (76%), Positives = 81/89 (91%)

Query:     5 FKMAPKVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEE 64
             FK  PKVQKVMVQPINLIFR+LQNRSRVQ+WLYEN++LRIEGHI+GFDEYMN+VL+ AEE
Sbjct:     3 FKGNPKVQKVMVQPINLIFRYLQNRSRVQVWLYENISLRIEGHIVGFDEYMNLVLDDAEE 62

Query:    65 YNIKSKTRKALGTIMLKGDNITLIQNLNP 93
               +K++ R+ LG IMLKGDNITLIQN++P
Sbjct:    63 VYVKTRQRRNLGRIMLKGDNITLIQNVSP 91
GO:0005634 "nucleus" evidence=IDA
GO:0030532 "small nuclear ribonucleoprotein complex" evidence=ISS;IDA
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0000245 "spliceosomal complex assembly" evidence=ISS
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
UNIPROTKB|A1XQR9 SNRPE "Small nuclear ribonucleoprotein E" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P62303 SNRPE "Small nuclear ribonucleoprotein E" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A4FUI2 SNRPE "Small nuclear ribonucleoprotein E" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P62304 SNRPE "Small nuclear ribonucleoprotein E" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LDW9 SNRPE "Small nuclear ribonucleoprotein E" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:98346 Snrpe "small nuclear ribonucleoprotein E" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2321675 Snrpe "small nuclear ribonucleoprotein polypeptide E" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1112 snrpe "small nuclear ribonucleoprotein polypeptide E" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|2318883 LOC100362099 "small nuclear ribonucleoprotein polypeptide E-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A4FUI2RUXE_BOVINNo assigned EC number0.72940.86730.9239yesN/A
Q9XTU6RUXE_CAEELNo assigned EC number0.6750.81630.8888yesN/A
P62305RUXE_MOUSENo assigned EC number0.72940.86730.9239yesN/A
P62304RUXE_HUMANNo assigned EC number0.72940.86730.9239yesN/A
Q12330RUXE_YEASTNo assigned EC number0.48930.87750.9148yesN/A
Q9VLV5RUXE_DROMENo assigned EC number0.75550.91830.9574yesN/A
P62303RUXE_CHICKNo assigned EC number0.72940.86730.9239yesN/A
A8XDT0RUXE_CAEBRNo assigned EC number0.68750.81630.8888N/AN/A
Q7ZUG0RUXE_DANRENo assigned EC number0.73490.84690.9021yesN/A
Q9USZ3RUXE_SCHPONo assigned EC number0.55420.83670.9761yesN/A
A1XQR9RUXE_PIGNo assigned EC number0.74110.86730.9239yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
cd0171879 cd01718, Sm_E, Sm protein E 5e-50
PTZ0013889 PTZ00138, PTZ00138, small nuclear ribonucleoprotei 3e-40
smart0065167 smart00651, Sm, snRNP Sm proteins 2e-15
pfam0142366 pfam01423, LSM, LSM domain 3e-14
cd0060063 cd00600, Sm_like, Sm and related proteins 3e-10
COG195879 COG1958, LSM1, Small nuclear ribonucleoprotein (sn 2e-09
cd0173276 cd01732, LSm5, Like-Sm protein 5 6e-09
cd0173169 cd01731, archaeal_Sm1, archaeal Sm protein 1 2e-08
cd1167869 cd11678, archaeal_LSm, archaeal Like-Sm protein 1e-07
cd0171780 cd01717, Sm_B, Sm protein B 8e-06
cd0172668 cd01726, LSm6, Like-Sm protein 6 2e-05
PRK0073772 PRK00737, PRK00737, small nuclear ribonucleoprotei 4e-05
cd0171970 cd01719, Sm_G, Sm protein G 5e-05
cd0172989 cd01729, LSm7, Like-Sm protein 7 5e-05
cd0172269 cd01722, Sm_F, Sm protein F 7e-05
cd0173963 cd01739, LSm11_M, Like-Sm protein 11, middle domai 1e-04
cd0172791 cd01727, LSm8, Like-Sm protein 8 2e-04
>gnl|CDD|212465 cd01718, Sm_E, Sm protein E Back     alignment and domain information 
 Score =  151 bits (385), Expect = 5e-50
 Identities = 60/79 (75%), Positives = 71/79 (89%)

Query: 12 QKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKT 71
          QKVMVQPINLIFR+LQN+SRVQIWLYE  ++RIEG I+GFDEYMN+VL+ AEE ++K+ T
Sbjct: 1  QKVMVQPINLIFRYLQNKSRVQIWLYEQTDMRIEGKIIGFDEYMNLVLDDAEEVHLKTNT 60

Query: 72 RKALGTIMLKGDNITLIQN 90
          RK LG I+LKGDNITLIQN
Sbjct: 61 RKPLGRILLKGDNITLIQN 79

The eukaryotic Sm proteins (B/B', D1, D2, D3, E, F and G) assemble into a hetero-heptameric ring around the Sm site of the 2,2,7-trimethyl guanosine (m3G) capped U1, U2, U4 and U5 snRNAs (Sm snRNAs) forming the core of the snRNP particle. The snRNP particle, in turn, assembles with other components onto the pre-mRNA to form the spliceosome which is responsible for the excision of introns and the ligation of exons. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit E binds subunits F and G to form a trimer which then assembles onto snRNA along with the D1/D2 and D3/B heterodimers forming a seven-membered ring structure. Length = 79
>gnl|CDD|185472 PTZ00138, PTZ00138, small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins Back     alignment and domain information
>gnl|CDD|201787 pfam01423, LSM, LSM domain Back     alignment and domain information
>gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins Back     alignment and domain information
>gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>gnl|CDD|212479 cd01732, LSm5, Like-Sm protein 5 Back     alignment and domain information
>gnl|CDD|212478 cd01731, archaeal_Sm1, archaeal Sm protein 1 Back     alignment and domain information
>gnl|CDD|212489 cd11678, archaeal_LSm, archaeal Like-Sm protein Back     alignment and domain information
>gnl|CDD|212464 cd01717, Sm_B, Sm protein B Back     alignment and domain information
>gnl|CDD|212473 cd01726, LSm6, Like-Sm protein 6 Back     alignment and domain information
>gnl|CDD|179104 PRK00737, PRK00737, small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>gnl|CDD|212466 cd01719, Sm_G, Sm protein G Back     alignment and domain information
>gnl|CDD|212476 cd01729, LSm7, Like-Sm protein 7 Back     alignment and domain information
>gnl|CDD|212469 cd01722, Sm_F, Sm protein F Back     alignment and domain information
>gnl|CDD|212485 cd01739, LSm11_M, Like-Sm protein 11, middle domain Back     alignment and domain information
>gnl|CDD|212474 cd01727, LSm8, Like-Sm protein 8 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 98
cd0171879 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins 99.94
PTZ0013889 small nuclear ribonucleoprotein; Provisional 99.93
cd0173276 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins 99.9
PRK0073772 small nuclear ribonucleoprotein; Provisional 99.9
KOG1774|consensus88 99.89
cd0173168 archaeal_Sm1 The archaeal sm1 proteins: The Sm pro 99.89
cd0172667 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins 99.89
cd0173082 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins 99.88
cd0171972 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins 99.88
cd0172087 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins 99.88
cd0172268 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins 99.87
cd0172981 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins 99.86
cd0172376 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins 99.86
cd0172170 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins 99.86
COG195879 LSM1 Small nuclear ribonucleoprotein (snRNP) homol 99.84
cd0172874 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins 99.84
cd0172774 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins 99.83
smart0065167 Sm snRNP Sm proteins. small nuclear ribonucleoprot 99.83
PF0142367 LSM: LSM domain ; InterPro: IPR001163 This family 99.83
cd0171779 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins 99.82
cd0172490 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins 99.81
cd0172581 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins 99.77
KOG1780|consensus77 99.77
cd0173378 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins 99.77
cd0060063 Sm_like The eukaryotic Sm and Sm-like (LSm) protei 99.76
cd0616875 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins 99.76
KOG3460|consensus91 99.72
KOG1775|consensus84 99.71
KOG3482|consensus79 99.7
KOG1781|consensus108 99.63
KOG1783|consensus77 99.57
KOG3293|consensus134 99.51
KOG1784|consensus96 99.42
KOG1782|consensus129 99.2
KOG3172|consensus119 99.19
KOG3448|consensus96 99.18
KOG3168|consensus177 99.17
KOG3428|consensus109 98.98
cd0173966 LSm11_C The eukaryotic Sm and Sm-like (LSm) protei 98.98
KOG3459|consensus114 98.72
cd0171661 Hfq Hfq, an abundant, ubiquitous RNA-binding prote 97.48
TIGR0238361 Hfq RNA chaperone Hfq. This model represents the R 97.4
PRK0039579 hfq RNA-binding protein Hfq; Provisional 96.66
COG192377 Hfq Uncharacterized host factor I protein [General 96.51
PF1270196 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC 96.25
PF1443877 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. 96.21
PRK14091165 RNA-binding protein Hfq; Provisional 96.12
PRK14091165 RNA-binding protein Hfq; Provisional 96.04
cd0173674 LSm14_N LSm14 (also known as RAP55) belongs to a f 94.3
PF0223748 BPL_C: Biotin protein ligase C terminal domain; In 93.19
cd0173561 LSm12_N LSm12 belongs to a family of Sm-like prote 89.03
PRK14638150 hypothetical protein; Provisional 87.95
PRK14633150 hypothetical protein; Provisional 87.93
PRK14640152 hypothetical protein; Provisional 85.33
PRK14639140 hypothetical protein; Provisional 85.02
PRK02001152 hypothetical protein; Validated 84.64
cd0173483 YlxS_C YxlS is a Bacillus subtilis gene of unknown 84.59
PRK14643164 hypothetical protein; Provisional 83.98
PRK14636176 hypothetical protein; Provisional 82.54
PRK14634155 hypothetical protein; Provisional 81.45
PF1109580 Gemin7: Gem-associated protein 7 (Gemin7); InterPr 81.24
PRK00092154 ribosome maturation protein RimP; Reviewed 80.91
COG0779153 Uncharacterized protein conserved in bacteria [Fun 80.8
PF1456342 DUF4444: Domain of unknown function (DUF4444); PDB 80.69
>cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information 
Probab=99.94  E-value=1.5e-26  Score=148.14  Aligned_cols=79  Identities=77%  Similarity=1.222  Sum_probs=72.9

Q ss_pred             eeeeeCcHHHHHHHhcCcceEEEEEEecCCeEEEEEEEEEcccCCeEEeceEEEEecCceeeeeCeEEEeCCcEEEEEe
Q psy10748         12 QKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTIMLKGDNITLIQN   90 (98)
Q Consensus        12 ~~~~~~Pl~~L~~~i~k~vrV~V~v~l~~g~~i~G~L~gfD~~mNlvL~d~~e~~~~~~~~~~lg~vliRG~~I~~I~~   90 (98)
                      ++.|++|+..+.+|++++.+|+||++.++|++++|+|.|||+|||++|+||+|+...+++.+.+|.++|||+||++|++
T Consensus         1 ~~~~~~P~~~l~~~l~~~~~V~V~l~~~~g~~~~G~L~gfD~~mNlvL~d~~E~~~~~~~~~~lG~iliRGnnV~~I~p   79 (79)
T cd01718           1 QKVMVQPINLIFRFLQSKQRVQIWLYEQTDLRIEGVIIGFDEYMNLVLDDAEEVHLKTKTRKPLGRILLKGDNITLIQN   79 (79)
T ss_pred             CccccCCHHHHHHHHccCcEEEEEEEeCCCcEEEEEEEEEccceeEEEcCEEEEecCCceEeEcCcEEEeCCEEEEEcC
Confidence            5789999999999999999999998888999999999999999999999999997444567889999999999999974

Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Sm subunit E binds subunits F and G to form a trimer which then assembles onto snRNA along with the D1/D2 and D3/B heterodimers forming a seven-membered ring structure. Sm-like proteins exist in archaea as well as prokaryotes that form heptameric and hexameric ring structures similar to those found in eukaryotes.
>PTZ00138 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PRK00737 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>KOG1774|consensus Back     alignment and domain information
>cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences Back     alignment and domain information
>cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>smart00651 Sm snRNP Sm proteins Back     alignment and domain information
>PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins Back     alignment and domain information
>cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1780|consensus Back     alignment and domain information
>cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG3460|consensus Back     alignment and domain information
>KOG1775|consensus Back     alignment and domain information
>KOG3482|consensus Back     alignment and domain information
>KOG1781|consensus Back     alignment and domain information
>KOG1783|consensus Back     alignment and domain information
>KOG3293|consensus Back     alignment and domain information
>KOG1784|consensus Back     alignment and domain information
>KOG1782|consensus Back     alignment and domain information
>KOG3172|consensus Back     alignment and domain information
>KOG3448|consensus Back     alignment and domain information
>KOG3168|consensus Back     alignment and domain information
>KOG3428|consensus Back     alignment and domain information
>cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG3459|consensus Back     alignment and domain information
>cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others Back     alignment and domain information
>TIGR02383 Hfq RNA chaperone Hfq Back     alignment and domain information
>PRK00395 hfq RNA-binding protein Hfq; Provisional Back     alignment and domain information
>COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] Back     alignment and domain information
>PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A Back     alignment and domain information
>PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown Back     alignment and domain information
>cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PRK14638 hypothetical protein; Provisional Back     alignment and domain information
>PRK14633 hypothetical protein; Provisional Back     alignment and domain information
>PRK14640 hypothetical protein; Provisional Back     alignment and domain information
>PRK14639 hypothetical protein; Provisional Back     alignment and domain information
>PRK02001 hypothetical protein; Validated Back     alignment and domain information
>cd01734 YlxS_C YxlS is a Bacillus subtilis gene of unknown function with two domains that each have an alpha/beta fold Back     alignment and domain information
>PRK14643 hypothetical protein; Provisional Back     alignment and domain information
>PRK14636 hypothetical protein; Provisional Back     alignment and domain information
>PRK14634 hypothetical protein; Provisional Back     alignment and domain information
>PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins Back     alignment and domain information
>PRK00092 ribosome maturation protein RimP; Reviewed Back     alignment and domain information
>COG0779 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14563 DUF4444: Domain of unknown function (DUF4444); PDB: 3BFM_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
3cw1_E92 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 8e-33
1ljo_A77 Crystal Structure Of An Sm-Like Protein (Af-Sm2) Fr 1e-04
1th7_A81 Crystal Structure Of An Archaeal Sm Protein From Su 2e-04
2fwk_A121 Crystal Structure Of Cryptosporidium Parvum U6 Snrn 3e-04
1loj_A87 Crystal Structure Of A Methanobacterial Sm-Like Arc 7e-04
1jbm_A86 Heptameric Crystal Structure Of Mth649, An Sm-Like 8e-04
1i81_A83 Crystal Structure Of A Heptameric Lsm Protein From 8e-04
1jri_A85 The Crystal Structure Of An Sm-Like Archaeal Protei 8e-04
>pdb|3CW1|E Chain E, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 92 Back     alignment and structure 
Iteration: 1

 Score =  135 bits (339), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 62/85 (72%), Positives = 76/85 (89%)
Query: 8  APKVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNI 67
            KVQKVMVQPINLIFR+LQNRSR+Q+WLYE VN+RIEG I+GFDEYMN+VL+ AEE + 
Sbjct: 7  GQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHS 66
Query: 68 KSKTRKALGTIMLKGDNITLIQNLN 92
          K+K+RK LG IMLKGDNITL+Q+++
Sbjct: 67 KTKSRKQLGRIMLKGDNITLLQSVS 91
>pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm2) From Archaeoglobus Fulgidus At 1.95a Resolution Length = 77 Back     alignment and structure
>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From Sulfolobus Solfataricus Length = 81 Back     alignment and structure
>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna- Associated Sm-Like Protein Lsm5 Length = 121 Back     alignment and structure
>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump) Length = 87 Back     alignment and structure
>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like Archaeal Protein From Methanobacterium Thermautotrophicum Length = 86 Back     alignment and structure
>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From Methanobacterium Thermoautotrophicum Length = 83 Back     alignment and structure
>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein With Two Heptamers In The Asymmetric Unit. Length = 85 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 2e-38
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 6e-26
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 9e-20
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 6e-16
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 5e-14
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 1e-13
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 5e-12
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 2e-10
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 5e-10
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 7e-10
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 1e-09
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 7e-09
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 8e-09
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 1e-08
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 1e-07
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 3e-07
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 4e-07
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 7e-07
3pgw_B 231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-07
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 7e-07
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 4e-05
2y9a_D126 Small nuclear ribonucleoprotein SM D3; splicing-RN 2e-04
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Length = 92 Back     alignment and structure
 Score =  122 bits (308), Expect = 2e-38
 Identities = 62/85 (72%), Positives = 76/85 (89%)

Query: 8  APKVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNI 67
            KVQKVMVQPINLIFR+LQNRSR+Q+WLYE VN+RIEG I+GFDEYMN+VL+ AEE + 
Sbjct: 7  GQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHS 66

Query: 68 KSKTRKALGTIMLKGDNITLIQNLN 92
          K+K+RK LG IMLKGDNITL+Q+++
Sbjct: 67 KTKSRKQLGRIMLKGDNITLLQSVS 91
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Length = 94 Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Length = 121 Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Length = 93 Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Length = 118 Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 Back     alignment and structure
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 Back     alignment and structure
>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 Back     alignment and structure
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Length = 105 Back     alignment and structure
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Length = 119 Back     alignment and structure
>2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Length = 126 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 99.96
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 99.93
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 99.92
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 99.92
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 99.91
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 99.91
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 99.9
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 99.9
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 99.9
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 99.9
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 99.9
1d3b_A75 Protein (small nuclear ribonucleoprotein SM D3); s 99.9
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 99.9
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 99.89
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 99.89
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 99.88
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 99.88
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 99.88
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 99.87
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 99.87
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 99.86
2y9a_D126 Small nuclear ribonucleoprotein SM D3; splicing-RN 99.85
3pgw_B 231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 99.82
1m5q_A130 SMAP3, small nuclear ribonucleoprotein homolog, SM 99.76
1y96_A86 Gemin6, SIP2, GEM-associated protein 6; SM fold, p 98.38
1u1s_A82 HFQ protein; SM-like bacterial protein, riken stru 97.56
2y90_A104 Protein HFQ; RNA-binding protein, SM-like, RNA cha 97.44
3sb2_A79 Protein HFQ; SM-like, RNA chaperone, chaperone; 2. 97.42
3ahu_A78 Protein HFQ; SM-like motif, protein-RNA complex, t 97.41
2ylb_A74 Protein HFQ; RNA-binding protein, LSM protein, RNA 97.4
1kq1_A77 HFQ, HOST factor for Q beta; hexamer, RNA binding 97.37
2qtx_A71 Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi 97.27
3hfn_A72 ASL2047 protein; HFQ, SM, RNA-binding protein, sRN 95.7
1ycy_A71 Conserved hypothetical protein; structural genomic 95.43
2vxe_A88 CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA 95.27
3hfo_A70 SSR3341 protein; HFQ, SM, RNA-binding protein, sRN 94.98
2fb7_A95 SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 93.47
2vc8_A84 Enhancer of mRNA-decapping protein 3; P-BODY compo 86.85
4a53_A125 EDC3; RNA binding protein; NMR {Schizosaccharomyce 84.0
1y96_B85 Gemin7, SIP3, GEM-associated protein 7; SM fold, p 80.55
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Back     alignment and structure
Probab=99.96  E-value=1.2e-29  Score=165.32  Aligned_cols=83  Identities=75%  Similarity=1.201  Sum_probs=73.8

Q ss_pred             cceeeeeCcHHHHHHHhcCcceEEEEEEecCCeEEEEEEEEEcccCCeEEeceEEEEecCceeeeeCeEEEeCCcEEEEE
Q psy10748         10 KVQKVMVQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTIMLKGDNITLIQ   89 (98)
Q Consensus        10 ~~~~~~~~Pl~~L~~~i~k~vrV~V~v~l~~g~~i~G~L~gfD~~mNlvL~d~~e~~~~~~~~~~lg~vliRG~~I~~I~   89 (98)
                      ++|+.|.+|+++|.+|++++++|++|+++++|++|+|+|.|||+|||++|+||+|+..++++.+++|.++|||+||++|+
T Consensus         9 ~~~~~m~~Pl~lL~~~l~~~v~V~l~~~~~~gr~~~G~L~gfD~~mNlvL~d~~E~~~~~~~~~~lg~v~iRG~nV~~i~   88 (92)
T 3s6n_E            9 KVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQ   88 (92)
T ss_dssp             -----CCCHHHHHHHHHHHTCEEEEEESSSCSSEEEEEEEEECTTCCEEEEEEEEECSSSCCEEEEEEEEECGGGEEEEE
T ss_pred             ccceeccCCHHHHHHHhCCCEEEEEEEEecCCEEEEEEEEEEcCcCcEEEeeeEEEecCCCceeEcCeEEEeCCEEEEEE
Confidence            88999999999999999999999999999999999999999999999999999999866667889999999999999999


Q ss_pred             ecC
Q psy10748         90 NLN   92 (98)
Q Consensus        90 ~~~   92 (98)
                      +++
T Consensus        89 ~~~   91 (92)
T 3s6n_E           89 SVS   91 (92)
T ss_dssp             EC-
T ss_pred             eCC
Confidence            876
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Back     alignment and structure
>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Back     alignment and structure
>1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Back     alignment and structure
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Back     alignment and structure
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Back     alignment and structure
>2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Back     alignment and structure
>1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 Back     alignment and structure
>1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A Back     alignment and structure
>2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A Back     alignment and structure
>3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 Back     alignment and structure
>3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A Back     alignment and structure
>2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* Back     alignment and structure
>1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A Back     alignment and structure
>2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} Back     alignment and structure
>1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 Back     alignment and structure
>2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} Back     alignment and structure
>2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A Back     alignment and structure
>2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} Back     alignment and structure
>4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A Back     alignment and structure
>1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 98
d1b34b_93 b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s 8e-15
d1ljoa_75 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 3e-14
d2fwka192 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr 7e-12
d1h641_71 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 2e-11
d1i4k1_72 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 8e-11
d1mgqa_74 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 2e-10
d1d3bb_81 b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa 2e-09
d1n9ra_68 b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S 3e-09
d1i8fa_71 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 5e-09
d1th7a176 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote 1e-08
d1d3ba_72 b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s 6e-07
d1b34a_80 b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo s 2e-05
d1m5q1_127 b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch 3e-04
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure

class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: D2 core SNRNP protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 61.8 bits (150), Expect = 8e-15
 Identities = 17/85 (20%), Positives = 40/85 (47%), Gaps = 15/85 (17%)

Query: 17 QPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEY----------- 65
           P++++ + ++N ++V I    N  L   G +  FD + N+VLE+ +E            
Sbjct: 2  GPLSVLTQSVKNNTQVLINCRNNKKLL--GRVKAFDRHCNMVLENVKEMWTEVPKSGKGK 59

Query: 66 --NIKSKTRKALGTIMLKGDNITLI 88
            +      + +  + L+GD++ ++
Sbjct: 60 KKSKPVNKDRYISKMFLRGDSVIVV 84
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 Back     information, alignment and structure
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 Back     information, alignment and structure
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
d1h641_71 Archaeal homoheptameric Sm protein {Archaeon Pyroc 99.91
d1ljoa_75 Archaeal homoheptameric Sm protein {Archaeon Archa 99.9
d1i4k1_72 Archaeal homoheptameric Sm protein {Archaeon Archa 99.9
d1mgqa_74 Archaeal homoheptameric Sm protein {Archaeon Metha 99.89
d1b34b_93 D2 core SNRNP protein {Human (Homo sapiens) [TaxId 99.89
d2fwka192 U6 snRNA-associated sm-like protein LSM5 {Cryptosp 99.88
d1i8fa_71 Archaeal homoheptameric Sm protein {Archaeon Pyrob 99.88
d1th7a176 Archaeal homoheptameric Sm protein {Sulfolobus sol 99.88
d1d3ba_72 D3 core SNRNP protein {Human (Homo sapiens) [TaxId 99.87
d1n9ra_68 Small nuclear ribonucleoprotein F, Smf {Baker's ye 99.86
d1d3bb_81 B core SNRNP protein {Human (Homo sapiens) [TaxId: 99.82
d1b34a_80 D1 core SNRNP protein {Human (Homo sapiens) [TaxId 99.8
d1m5q1_127 Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul 99.66
d1u1sa166 Pleiotropic translational regulator Hfq {Pseudomon 97.37
d1kq1a_60 Pleiotropic translational regulator Hfq {Staphyloc 96.72
d2vxfa180 LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) 96.12
d1biaa247 Biotin repressor/biotin holoenzyme synthetase, C-t 95.28
d1ycya166 Hypothetical protein PF1955 {Pyrococcus furiosus [ 94.97
d1ib8a174 Hypothetical protein SP14.3 (SP0552) {Streptococcu 91.03
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: Archaeal homoheptameric Sm protein
species: Archaeon Pyrococcus abyssi [TaxId: 29292]

Probab=99.91  E-value=3.5e-24  Score=131.26  Aligned_cols=71  Identities=27%  Similarity=0.513  Sum_probs=64.4

Q ss_pred             eCcHHHHHHHhcCcceEEEEEEecCCeEEEEEEEEEcccCCeEEeceEEEEecCceeeeeCeEEEeCCcEEEEEec
Q psy10748         16 VQPINLIFRFLQNRSRVQIWLYENVNLRIEGHILGFDEYMNIVLESAEEYNIKSKTRKALGTIMLKGDNITLIQNL   91 (98)
Q Consensus        16 ~~Pl~~L~~~i~k~vrV~V~v~l~~g~~i~G~L~gfD~~mNlvL~d~~e~~~~~~~~~~lg~vliRG~~I~~I~~~   91 (98)
                      ++|+.+|++++++++    .|++++|++|+|+|.+||+|||++|+||+|.. ++++.++++.++|||++|.+|+|.
T Consensus         1 ~~Pl~~L~~~~~~~V----~V~lk~g~~~~G~L~~~D~~mNlvL~~~~e~~-~~~~~~~l~~~~IRG~~I~~Isp~   71 (71)
T d1h641_           1 ERPLDVIHRSLDKDV----LVILKKGFEFRGRLIGYDIHLNVVLADAEMIQ-DGEVVKRYGKIVIRGDNVLAISPT   71 (71)
T ss_dssp             CCHHHHHHTTTTSEE----EEEETTSEEEEEEEEEECTTCCEEEEEEEEEE-TTEEEEEEEEEEECGGGEEEEEEC
T ss_pred             CCchHHHHHhCCCEE----EEEEcCCCEEEEEEEEECCCCCeEEeeEEEEe-cCCcEeEcCcEEEECCeEEEEeCC
Confidence            479999999999994    44789999999999999999999999999987 566788999999999999999873
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Back     information, alignment and structure
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure