Psyllid ID: psy10967

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MTYIPRYLYLFFYLNTNLSCKYLPKSVGIFLGNDSEYSDERNLQDLKEKVLQLQRESEEKNKIIENLRNEINAIKQNRHVSYATKATQTEDYLDVYNNNADGQDENAKHLVRYVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIGPKLLEELENSTTPVDQMLSEKSGKFCL
cccHHHHHHHHHHHHHHHcccccccccEEEEccccccccHHHHHHHHHHHHHHHHcccccccHHHccHHHHHHHHHHHHccccccccEEccHHHHHHHHHccccEEccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHccccEEccHHHHHHHHcccccccccccHHHHcccc
ccccHHHHHHHHHHccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEHcccccccHHHHHHHcccccccHHHHHHHHHHHHHcccccccHHHcHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHccccccEEEEcHHHHHHHHHccccccccccHHHHHccc
MTYIPRYLYLFFYLNTnlsckylpksvgiflgndseysderNLQDLKEKVLQLQRESEEKNKIIENLRNEINAIKqnrhvsyatkatqtedyldvynnnadgqdenAKHLVRYVANtgtktyaptedpgvvSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIGPKLLEElensttpvdqmlseksgkfcl
MTYIPRYLYLFFYLNTNLSCKYLPKSVGIFLGNDSEYSDERNLQDLKEKVLQLQRESEEKNKIIENLRNEINAIKQNRHVSYATKATQTEDYLDVYNNNADGQDENAKHLVRYVANtgtktyaptedpgvvsVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIGPKLLEELENsttpvdqmlseksgkfcl
MTYIPRylylffylNTNLSCKYLPKSVGIFLGNDSEYSDERNLQDLKEKVLQLQRESEEKNKIIENLRNEINAIKQNRHVSYATKATQTEDYLDVYNNNADGQDENAKHLVRYVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIGPKLLEELENSTTPVDQMLSEKSGKFCL
**YIPRYLYLFFYLNTNLSCKYLPKSVGIFLGN********************************NLRNEINAIKQNRHVSYATKATQTEDYLDVYNNNAD***ENAKHLVRYVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIGPKLL***********************
*TYIPRYLYLFFYLNTNLSCKYLPKSVGIFLGNDSEYSDERNLQDLKEKVLQLQRESEEKNKIIENLRNEINAIKQNRHVSYATKATQTEDYLDVYNNNADGQDENAKHLVRYVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIGPKLLEELENSTTPVDQMLSEKSGKFCL
MTYIPRYLYLFFYLNTNLSCKYLPKSVGIFLGNDSEYSDERNLQDLKEKVLQLQRESEEKNKIIENLRNEINAIKQNRHVSYATKATQTEDYLDVYNNNADGQDENAKHLVRYVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIGPKLLEELENSTTPVDQML*********
MTYIPRYLYLFFYLNTNLSCKYLPKSVGIFLGNDSEYSDERNLQDLKEKVLQLQRESEEKNKIIENLRNEINAIKQNRHVSYATKATQTEDYLDVYNNNADGQDENAKHLVRYVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIGPKLLEELENSTTPVDQMLS********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYIPRYLYLFFYLNTNLSCKYLPKSVGIFLGNDSEYSDERNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRHVSYATKATQTEDYLDVYNNNADGQDENAKHLVRYVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIGPKLLEELENSTTPVDQMLSEKSGKFCL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q8VI73337 Transaldolase OS=Cricetul yes N/A 0.422 0.249 0.690 4e-27
Q9EQS0337 Transaldolase OS=Rattus n yes N/A 0.422 0.249 0.678 7e-27
Q9W1G0331 Probable transaldolase OS yes N/A 0.427 0.256 0.682 9e-27
Q93092337 Transaldolase OS=Mus musc yes N/A 0.422 0.249 0.678 1e-26
P37837337 Transaldolase OS=Homo sap yes N/A 0.422 0.249 0.666 5e-26
B0TJA0318 Transaldolase OS=Shewanel yes N/A 0.386 0.242 0.705 6e-26
A3QBW2318 Transaldolase OS=Shewanel yes N/A 0.386 0.242 0.717 1e-25
B4RX40319 Transaldolase OS=Alteromo yes N/A 0.346 0.216 0.782 1e-25
Q2TBL6337 Transaldolase OS=Bos taur yes N/A 0.422 0.249 0.654 1e-25
A8H1G4318 Transaldolase OS=Shewanel yes N/A 0.386 0.242 0.692 2e-25
>sp|Q8VI73|TALDO_CRIGR Transaldolase OS=Cricetulus griseus GN=TALDO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  120 bits (302), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (78%)

Query: 113 YVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIG 172
           +VANT  K+Y P EDPGV SVTKIYNYYKKFGYKT+VMGASFRNTGEI ALAGCD +TI 
Sbjct: 197 HVANTDKKSYEPQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGCDFLTIS 256

Query: 173 PKLLEELENSTTPVDQMLSEKSGK 196
           PKLL EL    T +  +LS K+ +
Sbjct: 257 PKLLGELLKDNTKLAPVLSIKAAQ 280
Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.
Cricetulus griseus (taxid: 10029)
EC: 2EC: .EC: 2EC: .EC: 1EC: .EC: 2
>sp|Q9EQS0|TALDO_RAT Transaldolase OS=Rattus norvegicus GN=Taldo1 PE=1 SV=2 Back     alignment and function description
>sp|Q9W1G0|TALDO_DROME Probable transaldolase OS=Drosophila melanogaster GN=Tal PE=2 SV=2 Back     alignment and function description
>sp|Q93092|TALDO_MOUSE Transaldolase OS=Mus musculus GN=Taldo1 PE=1 SV=2 Back     alignment and function description
>sp|P37837|TALDO_HUMAN Transaldolase OS=Homo sapiens GN=TALDO1 PE=1 SV=2 Back     alignment and function description
>sp|B0TJA0|TAL_SHEHH Transaldolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tal PE=3 SV=1 Back     alignment and function description
>sp|A3QBW2|TAL_SHELP Transaldolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tal PE=3 SV=1 Back     alignment and function description
>sp|B4RX40|TAL_ALTMD Transaldolase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tal PE=3 SV=1 Back     alignment and function description
>sp|Q2TBL6|TALDO_BOVIN Transaldolase OS=Bos taurus GN=TALDO1 PE=2 SV=1 Back     alignment and function description
>sp|A8H1G4|TAL_SHEPA Transaldolase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tal PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
312377679 392 hypothetical protein AND_10958 [Anophele 0.422 0.214 0.75 4e-29
157123140 333 transaldolase [Aedes aegypti] gi|1088745 0.432 0.258 0.709 1e-28
94469060 321 transaldolase [Aedes aegypti] 0.432 0.267 0.709 2e-28
321468103 320 hypothetical protein DAPPUDRAFT_304993 [ 0.432 0.268 0.697 2e-28
118793159 333 AGAP011800-PA [Anopheles gambiae str. PE 0.422 0.252 0.726 3e-28
170049403 336 transaldolase [Culex quinquefasciatus] g 0.422 0.25 0.726 3e-28
255710357234 transaldolase [Ochlerotatus triseriatus] 0.422 0.358 0.702 3e-27
348526660 338 PREDICTED: transaldolase-like [Oreochrom 0.432 0.254 0.686 5e-27
332023979 326 Transaldolase [Acromyrmex echinatior] 0.432 0.263 0.697 7e-27
383861974 332 PREDICTED: transaldolase-like isoform 1 0.422 0.253 0.702 8e-27
>gi|312377679|gb|EFR24452.1| hypothetical protein AND_10958 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 69/84 (82%)

Query: 113 YVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIG 172
           YVANT  KT+ P  DPGVVSVTKIYNYYKKFGYKTVVMGASFRN GEI+ALAGCDL+TI 
Sbjct: 255 YVANTDQKTFEPVADPGVVSVTKIYNYYKKFGYKTVVMGASFRNVGEIMALAGCDLLTIS 314

Query: 173 PKLLEELENSTTPVDQMLSEKSGK 196
           PKLL +LE ST PV + L E+  K
Sbjct: 315 PKLLGDLEQSTEPVKRYLDEELAK 338

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157123140|ref|XP_001660027.1| transaldolase [Aedes aegypti] gi|108874520|gb|EAT38745.1| AAEL009389-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|94469060|gb|ABF18379.1| transaldolase [Aedes aegypti] Back     alignment and taxonomy information
>gi|321468103|gb|EFX79090.1| hypothetical protein DAPPUDRAFT_304993 [Daphnia pulex] Back     alignment and taxonomy information
>gi|118793159|ref|XP_320715.3| AGAP011800-PA [Anopheles gambiae str. PEST] gi|116117245|gb|EAA00399.3| AGAP011800-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170049403|ref|XP_001855895.1| transaldolase [Culex quinquefasciatus] gi|167871255|gb|EDS34638.1| transaldolase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|255710357|gb|ACU30998.1| transaldolase [Ochlerotatus triseriatus] Back     alignment and taxonomy information
>gi|348526660|ref|XP_003450837.1| PREDICTED: transaldolase-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|332023979|gb|EGI64197.1| Transaldolase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383861974|ref|XP_003706459.1| PREDICTED: transaldolase-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
UNIPROTKB|F1RYY6337 TALDO1 "Transaldolase" [Sus sc 0.422 0.249 0.690 2.5e-26
FB|FBgn0023477331 Tal "Tal" [Drosophila melanoga 0.422 0.253 0.690 4e-26
UNIPROTKB|H9KZA1193 TALDO1 "Uncharacterized protei 0.432 0.445 0.662 8.4e-26
UNIPROTKB|H9L1C2218 TALDO1 "Transaldolase" [Gallus 0.432 0.394 0.662 8.4e-26
RGD|620674337 Taldo1 "transaldolase 1" [Ratt 0.422 0.249 0.678 1.1e-25
MGI|MGI:1274789337 Taldo1 "transaldolase 1" [Mus 0.422 0.249 0.678 1.4e-25
UNIPROTKB|G5E5C8337 TALDO1 "Transaldolase" [Bos ta 0.422 0.249 0.666 2.2e-25
UNIPROTKB|H9GW87337 TALDO1 "Transaldolase" [Canis 0.422 0.249 0.666 4.6e-25
UNIPROTKB|P37837337 TALDO1 "Transaldolase" [Homo s 0.422 0.249 0.666 4.6e-25
UNIPROTKB|F2Z393318 TALDO1 "Transaldolase" [Homo s 0.407 0.254 0.691 7.6e-25
UNIPROTKB|F1RYY6 TALDO1 "Transaldolase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 297 (109.6 bits), Expect = 2.5e-26, P = 2.5e-26
 Identities = 58/84 (69%), Positives = 67/84 (79%)

Query:   113 YVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIG 172
             +VANT  K+Y P EDPGV SVTKIYNYYKKFGYKT+VMGASFRNTGEI ALAGCD +TI 
Sbjct:   197 HVANTDQKSYEPLEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGCDFLTIS 256

Query:   173 PKLLEELENSTTPVDQMLSEKSGK 196
             P+LL EL   T+ +  MLS K+ +
Sbjct:   257 PQLLGELLKDTSKLVPMLSAKAAQ 280
GO:0006098 "pentose-phosphate shunt" evidence=IEA
GO:0004801 "sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
FB|FBgn0023477 Tal "Tal" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZA1 TALDO1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9L1C2 TALDO1 "Transaldolase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|620674 Taldo1 "transaldolase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1274789 Taldo1 "transaldolase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G5E5C8 TALDO1 "Transaldolase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H9GW87 TALDO1 "Transaldolase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P37837 TALDO1 "Transaldolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z393 TALDO1 "Transaldolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9EQS0TALDO_RAT2, ., 2, ., 1, ., 20.67850.42210.2492yesN/A
B8F5Q3TAL_HAEPS2, ., 2, ., 1, ., 20.65430.40700.2563yesN/A
P37837TALDO_HUMAN2, ., 2, ., 1, ., 20.66660.42210.2492yesN/A
Q65PZ8TAL_MANSM2, ., 2, ., 1, ., 20.62960.40700.2555yesN/A
C5BLR8TAL_TERTT2, ., 2, ., 1, ., 20.67050.42210.2709yesN/A
A6VLW0TAL_ACTSZ2, ., 2, ., 1, ., 20.61720.40700.2555yesN/A
C1F2H6TAL_ACIC52, ., 2, ., 1, ., 20.63090.41700.2492yesN/A
Q9W1G0TALDO_DROME2, ., 2, ., 1, ., 20.68230.42710.2567yesN/A
Q93092TALDO_MOUSE2, ., 2, ., 1, ., 20.67850.42210.2492yesN/A
Q8VI73TALDO_CRIGR2, ., 2, ., 1, ., 20.69040.42210.2492yesN/A
Q602L8TAL_METCA2, ., 2, ., 1, ., 20.61900.42210.2553yesN/A
Q15PR4TAL_PSEA62, ., 2, ., 1, ., 20.6750.40200.2523yesN/A
Q2TBL6TALDO_BOVIN2, ., 2, ., 1, ., 20.65470.42210.2492yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.2.1.2LOW CONFIDENCE prediction!
3rd Layer2.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
PRK05269318 PRK05269, PRK05269, transaldolase B; Provisional 1e-49
cd00957313 cd00957, Transaldolase_TalAB, Transaldolases inclu 4e-43
TIGR00874317 TIGR00874, talAB, transaldolase 1e-41
PRK12309 391 PRK12309, PRK12309, transaldolase/EF-hand domain-c 4e-40
PTZ00411333 PTZ00411, PTZ00411, transaldolase-like protein; Pr 1e-36
PRK12346316 PRK12346, PRK12346, transaldolase A; Provisional 2e-34
pfam00923244 pfam00923, Transaldolase, Transaldolase 1e-23
cd00439252 cd00439, Transaldolase, Transaldolase 1e-21
COG0176239 COG0176, MipB, Transaldolase [Carbohydrate transpo 1e-20
cd00956211 cd00956, Transaldolase_FSA, Transaldolase-like fru 1e-05
>gnl|CDD|235381 PRK05269, PRK05269, transaldolase B; Provisional Back     alignment and domain information 
 Score =  163 bits (414), Expect = 1e-49
 Identities = 58/81 (71%), Positives = 63/81 (77%)

Query: 113 YVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIG 172
           Y  NTG K YAP EDPGVVSVTKIYNYYKK GYKTVVMGASFRNTG+IL LAGCD +TI 
Sbjct: 186 YKKNTGKKEYAPAEDPGVVSVTKIYNYYKKHGYKTVVMGASFRNTGQILELAGCDRLTIS 245

Query: 173 PKLLEELENSTTPVDQMLSEK 193
           P LLEEL  S   +++ LS  
Sbjct: 246 PALLEELAASEGELERKLSPP 266

Length = 318
>gnl|CDD|188644 cd00957, Transaldolase_TalAB, Transaldolases including both TalA and TalB Back     alignment and domain information
>gnl|CDD|162081 TIGR00874, talAB, transaldolase Back     alignment and domain information
>gnl|CDD|183426 PRK12309, PRK12309, transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|240406 PTZ00411, PTZ00411, transaldolase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|183458 PRK12346, PRK12346, transaldolase A; Provisional Back     alignment and domain information
>gnl|CDD|216195 pfam00923, Transaldolase, Transaldolase Back     alignment and domain information
>gnl|CDD|188631 cd00439, Transaldolase, Transaldolase Back     alignment and domain information
>gnl|CDD|223254 COG0176, MipB, Transaldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|188643 cd00956, Transaldolase_FSA, Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
cd00957313 Transaldolase_TalAB Transaldolases including both 100.0
TIGR00874317 talAB transaldolase. This family includes the majo 100.0
PTZ00411333 transaldolase-like protein; Provisional 100.0
PRK12346316 transaldolase A; Provisional 100.0
PRK12309 391 transaldolase/EF-hand domain-containing protein; P 100.0
PRK05269318 transaldolase B; Provisional 100.0
TIGR00875213 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/ 99.98
PRK01362214 putative translaldolase; Provisional 99.97
PRK12656222 fructose-6-phosphate aldolase; Reviewed 99.97
PRK12655220 fructose-6-phosphate aldolase; Reviewed 99.97
PRK12653220 fructose-6-phosphate aldolase; Reviewed 99.97
KOG2772|consensus337 99.96
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 99.96
cd00439252 Transaldolase Transaldolase. Enzymes found in the 99.96
PRK12376236 putative translaldolase; Provisional 99.95
PF00923287 Transaldolase: Transaldolase; InterPro: IPR001585 99.95
TIGR02134236 transald_staph transaldolase. This small family of 99.94
COG0176239 MipB Transaldolase [Carbohydrate transport and met 99.94
PRK03903274 transaldolase; Provisional 99.84
PRK03343368 transaldolase; Validated 99.76
cd00955338 Transaldolase_like Transaldolase-like proteins fro 99.74
PRK09533 948 bifunctional transaldolase/phosoglucose isomerase; 99.2
TIGR00876350 tal_mycobact transaldolase, mycobacterial type. Th 97.87
PF01645368 Glu_synthase: Conserved region in glutamate syntha 95.49
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 95.44
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 95.38
COG1891235 Uncharacterized protein conserved in archaea [Func 95.28
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 95.02
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 94.44
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 94.13
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 94.06
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 93.96
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 93.32
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 93.27
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 92.67
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 92.6
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 92.58
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 92.14
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 92.04
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 91.88
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 91.64
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 91.41
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 91.19
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 90.82
PLN02535364 glycolate oxidase 90.69
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 90.41
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 90.26
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 88.95
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 88.15
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 88.09
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 87.84
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 87.28
PLN02274505 inosine-5'-monophosphate dehydrogenase 87.17
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 86.93
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 86.72
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 86.39
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 86.12
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 85.46
PRK06096284 molybdenum transport protein ModD; Provisional 85.43
PRK00507221 deoxyribose-phosphate aldolase; Provisional 85.43
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 85.33
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 85.03
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 84.47
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 84.1
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 83.8
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 83.36
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 82.3
PRK00208250 thiG thiazole synthase; Reviewed 82.1
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 81.88
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 81.83
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 80.7
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 80.52
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 80.45
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 80.26
>cd00957 Transaldolase_TalAB Transaldolases including both TalA and TalB Back     alignment and domain information 
Probab=100.00  E-value=3.5e-37  Score=276.19  Aligned_cols=128  Identities=47%  Similarity=0.645  Sum_probs=122.9

Q ss_pred             HHHHHHHHhhhhcCcccccch----hhhHHHHHcCCcccccchhhhhhhcccccCCCCCCCCCCChHHHHHHHHHHHHhc
Q psy10967         68 RNEINAIKQNRHVSYATKATQ----TEDYLDVYNNNADGQDENAKHLVRYVANTGTKTYAPTEDPGVVSVTKIYNYYKKF  143 (199)
Q Consensus        68 ~~~l~aik~l~~~~~~~~aTa----~Qa~LA~~agA~YISPFVGRIdDwykk~~G~~~~~~~~ddGV~vVk~I~~~yk~~  143 (199)
                      .+||+|+++|+++||+|++|+    .|+++|+.|||+|||||||||+|||+++.|.+.+.+..|||+.+|++|+++|+++
T Consensus       135 ~eGi~A~~~L~~~GI~vn~TlvFS~~Qa~~aa~AGa~~ISPfVgRi~d~~~~~~~~~~~~~~~d~Gv~~v~~i~~~~~~~  214 (313)
T cd00957         135 WEGIQAAKQLEKEGIHCNLTLLFSFAQAVACAEAGVTLISPFVGRILDWYKKHSGDKAYTAEEDPGVASVKKIYNYYKKF  214 (313)
T ss_pred             HHHHHHHHHHHHCCCceeeeeecCHHHHHHHHHcCCCEEEeecchHHHhhhhccccccCCccCCcHHHHHHHHHHHHHHc
Confidence            579999999999999999999    9999999999999999999999999998887778888899999999999999999


Q ss_pred             CCceEEEEcccCCHhhHHHHhCCCEEeeCHHHHHHHhcCCCcccccCCcccc
Q psy10967        144 GYKTVVMGASFRNTGEILALAGCDLMTIGPKLLEELENSTTPVDQMLSEKSG  195 (199)
Q Consensus       144 gykTkILAASFRNv~QV~aLAGaDaVTIpP~VLeqL~~~p~~ve~~L~~~~a  195 (199)
                      ||+|+||||||||++||.+++|||.+||||+++++|.+++.+++++|++..+
T Consensus       215 ~~~T~vmaASfRn~~~v~~laG~d~~Ti~p~ll~~L~~~~~~~~~~l~~~~~  266 (313)
T cd00957         215 GYKTKVMGASFRNIGQILALAGCDYLTISPALLEELKNSTAKVERKLDPAAS  266 (313)
T ss_pred             CCCcEEEecccCCHHHHHHHhCCCeEEcCHHHHHHHHhCCCccccccCcccc
Confidence            9999999999999999999999999999999999999999999999998755

The enzyme catalyses the reversible transfer of a dyhydroxyacetone moiety, derived from fructose-6-phosphate to erythrose-4-phosphate yielding sedoheptulose-7-phosphate and glyceraldehyde-3-phosphate. The catalytic mechanism is similar to other class I aldolases. The enzyme is found in the non-oxidative branch of the pentose phosphate pathway and forms a dimer in solution.
>TIGR00874 talAB transaldolase Back     alignment and domain information
>PTZ00411 transaldolase-like protein; Provisional Back     alignment and domain information
>PRK12346 transaldolase A; Provisional Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PRK05269 transaldolase B; Provisional Back     alignment and domain information
>TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family Back     alignment and domain information
>PRK01362 putative translaldolase; Provisional Back     alignment and domain information
>PRK12656 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PRK12655 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PRK12653 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>KOG2772|consensus Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>cd00439 Transaldolase Transaldolase Back     alignment and domain information
>PRK12376 putative translaldolase; Provisional Back     alignment and domain information
>PF00923 Transaldolase: Transaldolase; InterPro: IPR001585 Transaldolase (2 Back     alignment and domain information
>TIGR02134 transald_staph transaldolase Back     alignment and domain information
>COG0176 MipB Transaldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03903 transaldolase; Provisional Back     alignment and domain information
>PRK03343 transaldolase; Validated Back     alignment and domain information
>cd00955 Transaldolase_like Transaldolase-like proteins from plants and bacteria Back     alignment and domain information
>PRK09533 bifunctional transaldolase/phosoglucose isomerase; Validated Back     alignment and domain information
>TIGR00876 tal_mycobact transaldolase, mycobacterial type Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG1891 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
1f05_A337 Crystal Structure Of Human Transaldolase Length = 3 3e-27
2e1d_A331 Crystal Structure Of Mouse Transaldolase Length = 3 7e-27
2cwn_A332 Crystal Structure Of Mouse Transaldolase Length = 3 7e-27
1i2q_A316 Crystal Structure Of Escherichia Coli Transaldolase 3e-25
1i2p_A316 Crystal Structure Of Escherichia Coli Transaldolase 3e-25
1i2o_A316 Crystal Structure Of Escherichia Coli Transaldolase 3e-25
1i2n_A316 Crystal Structure Of Escherichia Coli Transaldolase 3e-25
1onr_A316 Structure Of Transaldolase B Length = 316 3e-25
1i2r_A316 Crystal Structure Of Escherichia Coli Transaldolase 3e-25
1ucw_A317 Complex Of Transaldolase With The Reduced Schiff-Ba 3e-25
3cwn_A337 Escherichia Coli Transaldolase B Mutant F178y Lengt 4e-25
3kof_A337 Crystal Structure Of The Double Mutant F178yR181E O 4e-25
3m16_A329 Structure Of A Transaldolase From Oleispira Antarct 6e-25
3hjz_A334 The Structure Of An Aldolase From Prochlorococcus M 6e-19
3cq0_A339 Crystal Structure Of Tal2_yeast Length = 339 7e-17
3tk7_A345 2.0 Angstrom Resolution Crystal Structure Of Transa 5e-16
3te9_A345 1.8 Angstrom Resolution Crystal Structure Of K135m 6e-16
3igx_A324 1.85 Angstrom Resolution Crystal Structure Of Trans 3e-15
>pdb|1F05|A Chain A, Crystal Structure Of Human Transaldolase Length = 337 Back     alignment and structure 
Iteration: 1

 Score =  118 bits (295), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 56/84 (66%), Positives = 64/84 (76%)
Query: 113 YVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIG 172
           +VANT  K+Y P EDPGV SVTKIYNYYKKF YKT+VMGASFRNTGEI ALAGCD +TI 
Sbjct: 197 HVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTIS 256
Query: 173 PKLLEELENSTTPVDQMLSEKSGK 196
           PKLL EL      +  +LS K+ +
Sbjct: 257 PKLLGELLQDNAKLVPVLSAKAAQ 280
>pdb|2E1D|A Chain A, Crystal Structure Of Mouse Transaldolase Length = 331 Back     alignment and structure
>pdb|2CWN|A Chain A, Crystal Structure Of Mouse Transaldolase Length = 332 Back     alignment and structure
>pdb|1I2Q|A Chain A, Crystal Structure Of Escherichia Coli Transaldolase B Mutant T156a Length = 316 Back     alignment and structure
>pdb|1I2P|A Chain A, Crystal Structure Of Escherichia Coli Transaldolase B Mutant D17a Length = 316 Back     alignment and structure
>pdb|1I2O|A Chain A, Crystal Structure Of Escherichia Coli Transaldolase B Mutant E96a Length = 316 Back     alignment and structure
>pdb|1I2N|A Chain A, Crystal Structure Of Escherichia Coli Transaldolase B Mutant N35a Length = 316 Back     alignment and structure
>pdb|1ONR|A Chain A, Structure Of Transaldolase B Length = 316 Back     alignment and structure
>pdb|1I2R|A Chain A, Crystal Structure Of Escherichia Coli Transaldolase B Mutant S176a Length = 316 Back     alignment and structure
>pdb|1UCW|A Chain A, Complex Of Transaldolase With The Reduced Schiff-Base Intermediate Length = 317 Back     alignment and structure
>pdb|3CWN|A Chain A, Escherichia Coli Transaldolase B Mutant F178y Length = 337 Back     alignment and structure
>pdb|3KOF|A Chain A, Crystal Structure Of The Double Mutant F178yR181E OF E.COLI Transaldolase B Length = 337 Back     alignment and structure
>pdb|3M16|A Chain A, Structure Of A Transaldolase From Oleispira Antarctica Length = 329 Back     alignment and structure
>pdb|3HJZ|A Chain A, The Structure Of An Aldolase From Prochlorococcus Marinus Length = 334 Back     alignment and structure
>pdb|3CQ0|A Chain A, Crystal Structure Of Tal2_yeast Length = 339 Back     alignment and structure
>pdb|3TK7|A Chain A, 2.0 Angstrom Resolution Crystal Structure Of Transaldolase B (Tala) From Francisella Tularensis In Covalent Complex With Fructose 6- Phosphate Length = 345 Back     alignment and structure
>pdb|3TE9|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of K135m Mutant Of Transaldolase B (Tala) From Francisella Tularensis In Complex With Fructose 6-Phosphate Length = 345 Back     alignment and structure
>pdb|3IGX|A Chain A, 1.85 Angstrom Resolution Crystal Structure Of Transaldolase B (Tala) From Francisella Tularensis. Length = 324 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
3cq0_A339 Putative transaldolase YGR043C; alpha/beta barrel, 3e-29
3cwn_A337 Transaldolase B; directed evolution, cytoplasm, pe 3e-28
2e1d_A331 Transaldolase; pentose phosphate pathway, structur 4e-28
3m16_A329 Transaldolase; dimer, molecular replac swiss-model 3e-27
3hjz_A334 Transaldolase B; parachlorococcus, marine, cyanoba 3e-27
3tkf_A345 Transaldolase; structural genomics, center for str 8e-27
3r5e_A360 Transaldolase; pentose phosphate pathway, TIM barr 1e-14
3clm_A352 Transaldolase; YP_208650.1, structural genomics, j 2e-11
1wx0_A223 Transaldolase; structural genomics, riken structur 2e-09
1vpx_A230 Protein (transaldolase (EC 2.2.1.2)); TM0295, stru 2e-09
3s1x_A223 Probable transaldolase; alpha-beta barrel, conform 3e-09
3r8r_A212 Transaldolase; pentose phosphate pathway, schiff b 3e-09
1l6w_A220 Fructose-6-phosphate aldolase 1; alpha-beta barrel 5e-09
>3cq0_A Putative transaldolase YGR043C; alpha/beta barrel, pentose shunt, transferase; HET: PG4; 1.90A {Saccharomyces cerevisiae} Length = 339 Back     alignment and structure
 Score =  109 bits (274), Expect = 3e-29
 Identities = 42/88 (47%), Positives = 55/88 (62%)

Query: 109 HLVRYVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDL 168
            ++ +      K Y    DPGV+SV KIY+YYK+ GY T VM ASFRN  E+ ALAG D 
Sbjct: 194 RIMDFYKALSGKDYTAETDPGVLSVKKIYSYYKRHGYATEVMAASFRNLDELKALAGIDN 253

Query: 169 MTIGPKLLEELENSTTPVDQMLSEKSGK 196
           MT+   LLE+L  ST P++  L+ +S K
Sbjct: 254 MTLPLNLLEQLYESTDPIENKLNSESAK 281
>3cwn_A Transaldolase B; directed evolution, cytoplasm, pentose shunt, transferase; 1.40A {Escherichia coli} PDB: 3kof_A 1ucw_A* 1onr_A 1i2r_A 1i2q_A 1i2o_A 1i2p_A 1i2n_A Length = 337 Back     alignment and structure
>2e1d_A Transaldolase; pentose phosphate pathway, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Mus musculus} SCOP: c.1.10.1 PDB: 2cwn_A 1f05_A Length = 331 Back     alignment and structure
>3m16_A Transaldolase; dimer, molecular replac swiss-model, structural genomics, PSI-2, protein structure initiative; 2.79A {Oleispira antarctica} Length = 329 Back     alignment and structure
>3hjz_A Transaldolase B; parachlorococcus, marine, cyanobacteria; HET: MSE; 1.90A {Prochlorococcus marinus str} Length = 334 Back     alignment and structure
>3tkf_A Transaldolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel/TIM barrel; HET: I22 EPE; 1.50A {Francisella tularensis subsp} PDB: 3te9_A* 3upb_A* 3tk7_A* 3tno_A* 4e0c_A 3igx_A Length = 345 Back     alignment and structure
>3r5e_A Transaldolase; pentose phosphate pathway, TIM barrel fold, transferase; 2.10A {Corynebacterium glutamicum} Length = 360 Back     alignment and structure
>3clm_A Transaldolase; YP_208650.1, structural genomics, joint cente structural genomics, JCSG, protein structure initiative, PS transferase; HET: MSE; 1.14A {Neisseria gonorrhoeae} Length = 352 Back     alignment and structure
>1wx0_A Transaldolase; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferas; 2.27A {Thermus thermophilus HB8} SCOP: c.1.10.1 Length = 223 Back     alignment and structure
>1vpx_A Protein (transaldolase (EC 2.2.1.2)); TM0295, structural genomics, JOI for structural genomics, JCSG; HET: GOL; 2.40A {Thermotoga maritima} SCOP: c.1.10.1 Length = 230 Back     alignment and structure
>3s1x_A Probable transaldolase; alpha-beta barrel, conformational selection, domain swapping transferase; HET: I22; 1.65A {Thermoplasma acidophilum} PDB: 3s1u_A* 3s1v_A* 3s0c_A* 3s1w_A* Length = 223 Back     alignment and structure
>3r8r_A Transaldolase; pentose phosphate pathway, schiff bases; 1.90A {Bacillus subtilis} Length = 212 Back     alignment and structure
>1l6w_A Fructose-6-phosphate aldolase 1; alpha-beta barrel, domain swapping, lyase; 1.93A {Escherichia coli} SCOP: c.1.10.1 Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
3hjz_A334 Transaldolase B; parachlorococcus, marine, cyanoba 100.0
3m16_A329 Transaldolase; dimer, molecular replac swiss-model 100.0
3tkf_A345 Transaldolase; structural genomics, center for str 100.0
3r8r_A212 Transaldolase; pentose phosphate pathway, schiff b 100.0
2e1d_A331 Transaldolase; pentose phosphate pathway, structur 100.0
3cwn_A337 Transaldolase B; directed evolution, cytoplasm, pe 100.0
3s1x_A223 Probable transaldolase; alpha-beta barrel, conform 100.0
3cq0_A339 Putative transaldolase YGR043C; alpha/beta barrel, 100.0
1wx0_A223 Transaldolase; structural genomics, riken structur 99.97
1l6w_A220 Fructose-6-phosphate aldolase 1; alpha-beta barrel 99.97
1vpx_A230 Protein (transaldolase (EC 2.2.1.2)); TM0295, stru 99.97
3clm_A352 Transaldolase; YP_208650.1, structural genomics, j 99.88
3r5e_A360 Transaldolase; pentose phosphate pathway, TIM barr 99.45
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 95.17
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 95.12
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 94.31
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 92.91
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 92.84
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 92.83
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 92.8
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 92.58
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 92.35
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 92.24
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 92.0
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 90.67
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 90.57
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 90.51
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 90.32
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 90.16
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 89.93
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 89.92
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 89.9
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 89.59
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 89.56
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 89.39
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 89.2
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 88.82
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 88.75
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 88.64
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 88.38
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 88.23
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 88.09
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 87.8
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 87.64
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 87.61
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 87.25
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 87.03
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 86.83
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 86.77
3oa3_A288 Aldolase; structural genomics, seattle structural 86.47
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 86.23
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 85.96
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 84.84
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 84.58
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 83.68
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 82.5
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 82.44
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 81.38
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 80.69
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 80.5
>3hjz_A Transaldolase B; parachlorococcus, marine, cyanobacteria; HET: MSE; 1.90A {Prochlorococcus marinus str} Back     alignment and structure
Probab=100.00  E-value=1.5e-37  Score=279.38  Aligned_cols=130  Identities=37%  Similarity=0.465  Sum_probs=124.3

Q ss_pred             HHHHHHHHhhhhcCcccccch----hhhHHHHHcCCcccccchhhhhhhcccccCCCCCCCCCCChHHHHHHHHHHHHhc
Q psy10967         68 RNEINAIKQNRHVSYATKATQ----TEDYLDVYNNNADGQDENAKHLVRYVANTGTKTYAPTEDPGVVSVTKIYNYYKKF  143 (199)
Q Consensus        68 ~~~l~aik~l~~~~~~~~aTa----~Qa~LA~~agA~YISPFVGRIdDwykk~~G~~~~~~~~ddGV~vVk~I~~~yk~~  143 (199)
                      .+||+|+|+|+++||+|++|+    .|+++|++|||+|||||||||+|||+++.|.+.+.+.+|||+.+|++|+++|++|
T Consensus       141 ~eGl~A~~~L~~~GI~~N~TliFS~~Qa~~aa~AGa~~ISPFVgRi~D~~~~~~g~~~~~~~~d~Gv~~v~~i~~~y~~~  220 (334)
T 3hjz_A          141 WEGIKAAEILEKEGIKCNLTLLFNFCQAVTCANANITLISPFVGRILDWHKAKTGKTSFIGAEDPGVISVTQIYKYFKEK  220 (334)
T ss_dssp             HHHHHHHHHHHHTTCCEEEESCCSHHHHHHHHHTTCSEECCBHHHHHHHHHHHHCCCCCCGGGCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCcEEEEEeCCHHHHHHHHHcCCcEEEeeccHHHHHhhhccCCcccccccCcHHHHHHHHHHHHHHc
Confidence            489999999999999999999    9999999999999999999999999998887778888899999999999999999


Q ss_pred             CCceEEEEcccCCHhhHHHHhCCCEEeeCHHHHHHHhcCCCcccccCCcccccC
Q psy10967        144 GYKTVVMGASFRNTGEILALAGCDLMTIGPKLLEELENSTTPVDQMLSEKSGKF  197 (199)
Q Consensus       144 gykTkILAASFRNv~QV~aLAGaDaVTIpP~VLeqL~~~p~~ve~~L~~~~a~~  197 (199)
                      ||+|+||+|||||+.||.+++|||++||||+++++|.+++++++++|+|..+..
T Consensus       221 g~~T~vl~ASfRn~~~v~~laG~d~~Tipp~ll~~L~~~~~~~~~~L~~~~~~~  274 (334)
T 3hjz_A          221 GFKTEVMGASFRNLDEIKELAGCDLLTIAPKFLEELKREKGVLIRKLDASTKIN  274 (334)
T ss_dssp             TCCCEEEEBCCSSHHHHHHTTTCSEEEECHHHHHHHHHCCSCCCCCCCCCCCCS
T ss_pred             CCCCEEEEecCCCHHHHHHHhCCCEEEcCHHHHHHHHhcCCCcccccCcccccc
Confidence            999999999999999999999999999999999999999999999999987653
>3m16_A Transaldolase; dimer, molecular replac swiss-model, structural genomics, PSI-2, protein structure initiative; 2.79A {Oleispira antarctica} SCOP: c.1.10.1 Back     alignment and structure
>3tkf_A Transaldolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel/TIM barrel; HET: I22 EPE; 1.50A {Francisella tularensis subsp} PDB: 3te9_A* 3upb_A* 3tk7_A* 3tno_A* 4e0c_A 3igx_A Back     alignment and structure
>3r8r_A Transaldolase; pentose phosphate pathway, schiff bases; 1.90A {Bacillus subtilis} Back     alignment and structure
>2e1d_A Transaldolase; pentose phosphate pathway, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Mus musculus} SCOP: c.1.10.1 PDB: 2cwn_A 1f05_A Back     alignment and structure
>3cwn_A Transaldolase B; directed evolution, cytoplasm, pentose shunt, transferase; 1.40A {Escherichia coli} PDB: 3kof_A 1ucw_A* 1onr_A 1i2r_A 1i2q_A 1i2o_A 1i2p_A 1i2n_A Back     alignment and structure
>3s1x_A Probable transaldolase; alpha-beta barrel, conformational selection, domain swapping transferase; HET: I22; 1.65A {Thermoplasma acidophilum} PDB: 3s1u_A* 3s1v_A* 3s0c_A* 3s1w_A* Back     alignment and structure
>3cq0_A Putative transaldolase YGR043C; alpha/beta barrel, pentose shunt, transferase; HET: PG4; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1wx0_A Transaldolase; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferas; 2.27A {Thermus thermophilus HB8} SCOP: c.1.10.1 Back     alignment and structure
>1l6w_A Fructose-6-phosphate aldolase 1; alpha-beta barrel, domain swapping, lyase; 1.93A {Escherichia coli} SCOP: c.1.10.1 Back     alignment and structure
>1vpx_A Protein (transaldolase (EC 2.2.1.2)); TM0295, structural genomics, JOI for structural genomics, JCSG; HET: GOL; 2.40A {Thermotoga maritima} SCOP: c.1.10.1 Back     alignment and structure
>3clm_A Transaldolase; YP_208650.1, structural genomics, joint cente structural genomics, JCSG, protein structure initiative, PS transferase; HET: MSE; 1.14A {Neisseria gonorrhoeae} Back     alignment and structure
>3r5e_A Transaldolase; pentose phosphate pathway, TIM barrel fold, transferase; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
d2e1da1319 c.1.10.1 (A:13-331) Transaldolase {Mouse (Mus musc 1e-19
d1onra_316 c.1.10.1 (A:) Transaldolase {Escherichia coli [Tax 3e-19
d1l6wa_220 c.1.10.1 (A:) Decameric fructose-6-phosphate aldol 2e-10
d1wx0a1211 c.1.10.1 (A:1-211) Decameric fructose-6-phosphate 3e-09
d1vpxa_218 c.1.10.1 (A:) Decameric fructose-6-phosphate aldol 5e-09
>d2e1da1 c.1.10.1 (A:13-331) Transaldolase {Mouse (Mus musculus) [TaxId: 10090]} Length = 319 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Transaldolase
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 82.5 bits (203), Expect = 1e-19
 Identities = 56/84 (66%), Positives = 64/84 (76%)

Query: 113 YVANTGTKTYAPTEDPGVVSVTKIYNYYKKFGYKTVVMGASFRNTGEILALAGCDLMTIG 172
           +VANT  K+Y P  DPGV SVTKIYNYYKKFGYKT+VMGASFRNTGEI ALAGCD +TI 
Sbjct: 185 HVANTDKKSYEPQGDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGCDFLTIS 244

Query: 173 PKLLEELENSTTPVDQMLSEKSGK 196
           PKLL EL    + +   LS K+ +
Sbjct: 245 PKLLGELLKDNSKLAPALSVKAAQ 268
>d1onra_ c.1.10.1 (A:) Transaldolase {Escherichia coli [TaxId: 562]} Length = 316 Back     information, alignment and structure
>d1l6wa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]} Length = 220 Back     information, alignment and structure
>d1wx0a1 c.1.10.1 (A:1-211) Decameric fructose-6-phosphate aldolase/transaldolase {Thermus thermophilus [TaxId: 274]} Length = 211 Back     information, alignment and structure
>d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} Length = 218 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d1onra_316 Transaldolase {Escherichia coli [TaxId: 562]} 100.0
d2e1da1319 Transaldolase {Mouse (Mus musculus) [TaxId: 10090] 99.97
d1wx0a1211 Decameric fructose-6-phosphate aldolase/transaldol 99.97
d1vpxa_218 Decameric fructose-6-phosphate aldolase/transaldol 99.96
d1l6wa_220 Decameric fructose-6-phosphate aldolase/transaldol 99.96
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 88.29
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 86.34
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 85.65
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 85.63
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 81.05
>d1onra_ c.1.10.1 (A:) Transaldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Transaldolase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=4.9e-35  Score=258.28  Aligned_cols=128  Identities=45%  Similarity=0.599  Sum_probs=121.2

Q ss_pred             HHHHHHHHhhhhcCcccccch----hhhHHHHHcCCcccccchhhhhhhcccccCCCCCCCCCCChHHHHHHHHHHHHhc
Q psy10967         68 RNEINAIKQNRHVSYATKATQ----TEDYLDVYNNNADGQDENAKHLVRYVANTGTKTYAPTEDPGVVSVTKIYNYYKKF  143 (199)
Q Consensus        68 ~~~l~aik~l~~~~~~~~aTa----~Qa~LA~~agA~YISPFVGRIdDwykk~~G~~~~~~~~ddGV~vVk~I~~~yk~~  143 (199)
                      .+||+|+|+|.++||+|++|.    .|+++|++|||+||||||||++||++++.+...+.+..+||+.++++|+++|+.+
T Consensus       136 ~eGi~A~~~L~~~GI~vN~TlvFS~~Qa~~aa~Aga~~iSpfVgRi~d~~~~~~~~~~~~~~~~~Gv~~v~~i~~~~k~~  215 (316)
T d1onra_         136 WQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVFLISPFVGRILDWYKANTDKKEYAPAEDPGVVSVSEIYQYYKEH  215 (316)
T ss_dssp             HHHHHHHHHHHHTTCCEEEEEECSHHHHHHHHHTTCSEEEEBSHHHHHHHHHSSSCCCCCGGGCHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHcCCcccceeeecHHHHHHHHHcCCeEEeeeecchhhhhhcccccccccccCCchHHHHHHHHHHHHHc
Confidence            359999999999999999999    9999999999999999999999999888776666677899999999999999999


Q ss_pred             CCceEEEEcccCCHhhHHHHhCCCEEeeCHHHHHHHhcCCCcccccCCcccc
Q psy10967        144 GYKTVVMGASFRNTGEILALAGCDLMTIGPKLLEELENSTTPVDQMLSEKSG  195 (199)
Q Consensus       144 gykTkILAASFRNv~QV~aLAGaDaVTIpP~VLeqL~~~p~~ve~~L~~~~a  195 (199)
                      |++|+||+|||||++||.+++|||.+|+||+++++|.+++.+++++|++..+
T Consensus       216 g~~t~v~~AS~r~~~~v~~laG~D~~Ti~p~~l~~l~~~~~~~~~~l~~~~~  267 (316)
T d1onra_         216 GYETVVMGASFRNIGEILELAGCDRLTIAPALLKELAESEGAIERKLSYTGE  267 (316)
T ss_dssp             TCCCEEEEBCCSSHHHHHHTTTSSEEEECHHHHHHHHHCBSCCCCCCCCCSC
T ss_pred             CCCceeehhhccchhhHHHHhcCCceecCHHHHHHHhhccCcccccCCcccc
Confidence            9999999999999999999999999999999999999999999999998664
>d2e1da1 c.1.10.1 (A:13-331) Transaldolase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx0a1 c.1.10.1 (A:1-211) Decameric fructose-6-phosphate aldolase/transaldolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l6wa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure