Psyllid ID: psy1099


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-----
MLAWKWGPALAAGCPVLLKPAEQTPLTALYVAALTQQAGFPDGVISVLPGYGPMSAPYWRKSCLSPLAYRSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAVMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVWINCYQAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAYYYCFVCAGSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTESPLRSYT
cccccHHHHHHHcccEEEcccccccHHHHHHHHHHHHHccccccEEEcccccccHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHcccccccEEEEcHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEcccccccccEEEccEEEcccccccEEEEEcccccEEEEccccccHHHHHHHccccccEEEEcccccHHHHHHHHHHHHcHHHHHHHHcccccccccccEEcccccHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHcccccEEEEcccccccEEcccccHHHHHHccccccccEEEEEcccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEcccccccccEEEccccccccccccEEEEccccccEEEccccccHHHHHHHHcccccccccccccccHHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHHHHcccEEEEccccccc
HHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHccccccEEEccEcccHHHHHHccccccEEEEccEEEEEHHHHHHHHHHHHHHcccccEcccccccccEcccccHHHHHHHHHHHHHHHHcccEEcccccEEcccccEEccEEEEccccccHHHHccccccEEEEEEEccHHHHHHHHHccccccEEEEEccEHHHHHHHHHHccccEEEEccccccHHHHHHHHHcccEEcccccEEcccccEEccEEEEccccccHHHHccccccEEEEEEEccHHHHHHHHHccccccEEEEEccEHHHHHHHHHHccccEEEEcccccccccccEcccHHHEEccEcHHHHHHccEEEEEEEEEcccccHHHHHHHHHHHccccEEEEEcccccEEEEcccccHHHHHcccEcccccEEEEEHHHHHHHHHHHHHHHHcccEcccccccccEcccccHHHHHHHHHHHHHHHHcccEEEEcccEcccccccEccEEEEccccccHHHHccccccEEEEEEEccHHHHHHHHHccccccEEEEEccEHHHHHHHHHHccccEEEEccccEcccHHHEEccEccHHHHHHHEEEEEEEEEcccccc
mlawkwgpalaagcpvllkpaeqtplTALYVAALtqqagfpdgvisvlpgygpmsapywrksclsplayrsrtyvQEDIYDTFVKKAVEKAAArkvgdpfdksvqqgpqvDAVMFTKVLNYIKSGVeqggkleaggkrkgdkgyfieptvfsnvtddfKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVDAEMFTKVLNYIKSGVeqggkleaggkrkgdkgyfieptvfsnvtddfKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVWINCYQAvvpqapfggfkesgiGRELGKAALDEYTelktvtesplrsytsHSIMAAAAASNLKRVSLelggksplvicadadvDMAYYYCFVCagsrtyvqeDIYDTFVKKAVEKAAArkvgdpfdksvqqgpqvDAEMFTKVLNYIKSGVeqggkleaggkrkgdkgyfieptvfsnvtddfKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAInagsavvpqapfggfkesgiGRELGKAALDEYTelktvtesplrsyt
MLAWKWGPALAAGCPVLLKPAEQTPLTALYVAALTQQAGFPDGVISVLPGYGPMSAPYWRKSCLSPLAYRSRTYVQEDIYDTFVKKAVEKAAarkvgdpfdksvqqgpqVDAVMFTKVLNYIKSgveqggkleaggkrkgdkgyfieptvfsnvtdDFKIAREeifgpvqtiikFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVDAEMFTKVLNYIKSGveqggkleaggkrkgdkgyfieptvfsnvtdDFKIAREeifgpvqtiikFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVWINCYQAVVPQAPFGGFKESGIGRELGKAALDEYTELKtvtesplrsyTSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAYYYCFVCAGSRTYVQEDIYDTFVKKAVEKAAarkvgdpfdksvqqgpqvDAEMFTKVLNYIKSgveqggkleaggkrkgdkgyfieptvfsnvtdDFKIAREeifgpvqtiikFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSAVVPQAPFGGFKESGIGRELGKAALdeytelktvtesplrsyt
MLAWKWGPALAAGCPVLLKPAEQTPLTALYVAALTQQAGFPDGVISVLPGYGPMSAPYWRKSCLSPLAYRSRTYVQEDIYDTFvkkavekaaarkvGDPFDKSVQQGPQVDAVMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVWINCYQAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAYYYCFVCAGSRTYVQEDIYDTFvkkavekaaarkvGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTESPLRSYT
**AWKWGPALAAGCPVLLKPAEQTPLTALYVAALTQQAGFPDGVISVLPGYGPMSAPYWRKSCLSPLAYRSRTYVQEDIYDTFVKKAVEKAAARKVG**********PQVDAVMFTKVLNYIKSGVEQGG*********GDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVDAEMFTKVLNYIKSGVEQGGKL*******GDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVWINCYQAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTE**LRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAYYYCFVCAGSRTYVQEDIYDTFVKKAVEKAAA*****************DAEMFTKVLNYIKSGVE************GDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSAVVPQAPFGGFKESGIGRELGKAAL******************
MLAWKWGPALAAGCPVLLKPAEQTPLTALYVAALTQQAGFPDGVISVLPGYGPMSAPYWRKSCLSPLAYRSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAVMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVWINCYQAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAYYYCFVCAGSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTESPLRS**
MLAWKWGPALAAGCPVLLKPAEQTPLTALYVAALTQQAGFPDGVISVLPGYGPMSAPYWRKSCLSPLAYRSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAVMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVWINCYQAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAYYYCFVCAGSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSAVVPQAPFGGFKESGIGRELGKAALDEYTELK***********
MLAWKWGPALAAGCPVLLKPAEQTPLTALYVAALTQQAGFPDGVISVLPGYGPMSAPYWRKSCLSPLAYRSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAVMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVWINCYQAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAYYYCFVCAGSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTESPL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAWKWGPALAAGCPVLLKPAEQTPLTALYVAALTQQAGFPDGVISVLPGYGPMSAPYWRKSCLSPLAYRSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAVMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSVWINCYQAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAYYYCFVCAGSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVTESPLRSYT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query605 2.2.26 [Sep-21-2011]
Q66HF8519 Aldehyde dehydrogenase X, yes N/A 0.371 0.433 0.549 4e-70
P27463509 Retinal dehydrogenase 1 O no N/A 0.368 0.438 0.579 2e-69
Q8S528534 Aldehyde dehydrogenase fa yes N/A 0.371 0.421 0.537 9e-69
P30837517 Aldehyde dehydrogenase X, yes N/A 0.371 0.435 0.537 2e-68
Q5R6B5517 Aldehyde dehydrogenase X, yes N/A 0.371 0.435 0.541 2e-68
P11884519 Aldehyde dehydrogenase, m no N/A 0.371 0.433 0.533 1e-67
P47738519 Aldehyde dehydrogenase, m yes N/A 0.371 0.433 0.533 1e-67
P81178500 Aldehyde dehydrogenase, m N/A N/A 0.371 0.45 0.533 2e-67
O93344518 Retinal dehydrogenase 2 O no N/A 0.368 0.430 0.545 2e-67
P30841496 Omega-crystallin OS=Enter N/A N/A 0.366 0.447 0.537 2e-67
>sp|Q66HF8|AL1B1_RAT Aldehyde dehydrogenase X, mitochondrial OS=Rattus norvegicus GN=Aldh1b1 PE=1 SV=1 Back     alignment and function desciption
 Score =  266 bits (680), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 169/242 (69%), Gaps = 17/242 (7%)

Query: 373 HSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAYYYCF----------VCAGSRTYV 422
           H I  AA  SNLKRV+LELGGKSP ++ ADAD+D A   C            CAGSRT+V
Sbjct: 270 HLIQKAAGDSNLKRVTLELGGKSPSIVLADADMDHAVDQCHEALFFNMGQCCCAGSRTFV 329

Query: 423 QEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAG 482
           +E IY  F+++ VEKA  RKVG+PF+   QQGPQVD E F K+L YI+ G ++G KL  G
Sbjct: 330 EESIYHEFLERTVEKAKKRKVGNPFELDTQQGPQVDKEQFEKILGYIRLGQKEGAKLLCG 389

Query: 483 GKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASG 542
           G+R G++G+FI+PTVF NV DD +IAREEIFGPVQ + KFK ++EVI+RAN+T+YGLA+ 
Sbjct: 390 GERFGERGFFIKPTVFGNVQDDMRIAREEIFGPVQPLFKFKKIEEVIQRANNTRYGLAAA 449

Query: 543 IVTTNIDTANTFAHAINAGSA-------VVPQAPFGGFKESGIGRELGKAALDEYTELKT 595
           + T ++D A  F+ A+ AG+        V    PFGGFKESG GRELG+  L  YTE+KT
Sbjct: 450 VFTRDLDKALYFSQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKT 509

Query: 596 VT 597
           VT
Sbjct: 510 VT 511




ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.
Rattus norvegicus (taxid: 10116)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 3
>sp|P27463|AL1A1_CHICK Retinal dehydrogenase 1 OS=Gallus gallus GN=ALDH1A1 PE=2 SV=1 Back     alignment and function description
>sp|Q8S528|AL2B7_ARATH Aldehyde dehydrogenase family 2 member B7, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B7 PE=2 SV=2 Back     alignment and function description
>sp|P30837|AL1B1_HUMAN Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens GN=ALDH1B1 PE=1 SV=3 Back     alignment and function description
>sp|Q5R6B5|AL1B1_PONAB Aldehyde dehydrogenase X, mitochondrial OS=Pongo abelii GN=ALDH1B1 PE=2 SV=1 Back     alignment and function description
>sp|P11884|ALDH2_RAT Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh2 PE=1 SV=1 Back     alignment and function description
>sp|P47738|ALDH2_MOUSE Aldehyde dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh2 PE=1 SV=1 Back     alignment and function description
>sp|P81178|ALDH2_MESAU Aldehyde dehydrogenase, mitochondrial OS=Mesocricetus auratus GN=ALDH2 PE=1 SV=1 Back     alignment and function description
>sp|O93344|AL1A2_CHICK Retinal dehydrogenase 2 OS=Gallus gallus GN=ALDH1A2 PE=2 SV=2 Back     alignment and function description
>sp|P30841|CROM_ENTDO Omega-crystallin OS=Enteroctopus dofleini PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query605
322799549482 hypothetical protein SINV_15120 [Solenop 0.406 0.510 0.590 3e-78
328778476489 PREDICTED: retinal dehydrogenase 1-like 0.406 0.503 0.579 5e-77
110611282492 1-pyrroline-5-carboxylate dehydrogenase 0.368 0.453 0.608 2e-76
307178537488 Retinal dehydrogenase 1 [Camponotus flor 0.406 0.504 0.571 4e-76
380014398489 PREDICTED: retinal dehydrogenase 1-like 0.406 0.503 0.568 6e-76
350425487494 PREDICTED: aldehyde dehydrogenase X, mit 0.371 0.455 0.619 2e-75
380014400451 PREDICTED: retinal dehydrogenase 1-like 0.371 0.498 0.599 2e-75
242010164491 restnal dehydrogenase, putative [Pedicul 0.523 0.645 0.445 3e-75
91091542489 PREDICTED: similar to aldehyde dehydroge 0.368 0.456 0.612 7e-75
195445664486 GK12053 [Drosophila willistoni] gi|19416 0.368 0.458 0.625 8e-75
>gi|322799549|gb|EFZ20857.1| hypothetical protein SINV_15120 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  299 bits (765), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 156/264 (59%), Positives = 189/264 (71%), Gaps = 18/264 (6%)

Query: 351 AALDEYTELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICADADV----D 406
           AA+ E+ E++ V  +   +   HSIM AA  SNLKRVSLELGGKSPLV+  DADV    +
Sbjct: 213 AAIAEHPEIQKVAFTG-STEVGHSIMVAAGKSNLKRVSLELGGKSPLVVFDDADVKEAAE 271

Query: 407 MAYYYCF------VCAGSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAE 460
           +A+   F       CAGSRT+V   IYD FVK A + A  RKVGDPFD ++ QGPQ+D E
Sbjct: 272 IAHNAIFSNHGQNCCAGSRTFVHSKIYDDFVKHAKQLALNRKVGDPFDSNMNQGPQIDQE 331

Query: 461 MFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTII 520
           M  KV+N I SG +QG  +E GG RKGD GYF+EPTVFSNVTDD +IA+EEIFGPVQTI+
Sbjct: 332 MLDKVMNLINSGKQQGAVVETGGTRKGDIGYFVEPTVFSNVTDDMRIAKEEIFGPVQTIL 391

Query: 521 KFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGS-------AVVPQAPFGGF 573
           KF T++EVIERAN T YGLASGI+T +I+ A  FA A+ AGS       A+ PQ PFGGF
Sbjct: 392 KFDTMNEVIERANRTNYGLASGIITKDINKAMEFAQAVEAGSVWVNCYDAITPQTPFGGF 451

Query: 574 KESGIGRELGKAALDEYTELKTVT 597
           K+SGIGRELG+  L EY E+KTV+
Sbjct: 452 KQSGIGRELGEEGLKEYLEIKTVS 475




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328778476|ref|XP_392104.4| PREDICTED: retinal dehydrogenase 1-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|110611282|gb|ABG77990.1| 1-pyrroline-5-carboxylate dehydrogenase 1 [Glossina morsitans morsitans] gi|289740517|gb|ADD19006.1| aldehyde dehydrogenase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|307178537|gb|EFN67226.1| Retinal dehydrogenase 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380014398|ref|XP_003691219.1| PREDICTED: retinal dehydrogenase 1-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|350425487|ref|XP_003494137.1| PREDICTED: aldehyde dehydrogenase X, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380014400|ref|XP_003691220.1| PREDICTED: retinal dehydrogenase 1-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|242010164|ref|XP_002425846.1| restnal dehydrogenase, putative [Pediculus humanus corporis] gi|212509779|gb|EEB13108.1| restnal dehydrogenase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91091542|ref|XP_970835.1| PREDICTED: similar to aldehyde dehydrogenase [Tribolium castaneum] gi|270000922|gb|EEZ97369.1| hypothetical protein TcasGA2_TC011192 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195445664|ref|XP_002070429.1| GK12053 [Drosophila willistoni] gi|194166514|gb|EDW81415.1| GK12053 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query605
FB|FBgn0051075485 CG31075 [Drosophila melanogast 0.419 0.523 0.512 2.1e-86
ZFIN|ZDB-GENE-040426-1262516 aldh2.1 "aldehyde dehydrogenas 0.418 0.490 0.511 1.4e-78
UNIPROTKB|F1NJC7507 ALDH1A1 "Retinal dehydrogenase 0.418 0.499 0.522 2.8e-78
UNIPROTKB|F1NJP8445 ALDH1A1 "Retinal dehydrogenase 0.418 0.568 0.522 2.8e-78
UNIPROTKB|P27463509 ALDH1A1 "Retinal dehydrogenase 0.418 0.497 0.522 2.8e-78
UNIPROTKB|E1BT93519 ALDH2 "Uncharacterized protein 0.418 0.487 0.492 7.5e-78
RGD|69219519 Aldh2 "aldehyde dehydrogenase 0.418 0.487 0.477 2e-77
ZFIN|ZDB-GENE-030326-5516 aldh2.2 "aldehyde dehydrogenas 0.416 0.488 0.483 3.2e-77
MGI|MGI:99600519 Aldh2 "aldehyde dehydrogenase 0.416 0.485 0.483 4.1e-77
UNIPROTKB|E2RMX7496 ALDH1A1 "Uncharacterized prote 0.418 0.510 0.488 4.1e-77
FB|FBgn0051075 CG31075 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 663 (238.4 bits), Expect = 2.1e-86, Sum P(2) = 2.1e-86
 Identities = 140/273 (51%), Positives = 185/273 (67%)

Query:   342 SGIGRELGKAALDEYTELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICA 401
             +G G   G AA+  + ++  V  +         +M AAA SNLKRVSLELGGKSP+V+  
Sbjct:   211 NGFGPTAG-AAISAHPDIAKVAFTGSVEI-GRIVMQAAATSNLKRVSLELGGKSPVVVFD 268

Query:   402 DADVDMA----YYYCF------VCAGSRTYVQEDIYDTFXXXXXXXXXXXXXGDPFDKSV 451
             DAD+D A    +   F       CAGSRTYV E IYD F             G+PF+++V
Sbjct:   269 DADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARKVGNPFEQNV 328

Query:   452 QQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREE 511
             QQGPQ+D +M TKVL YI+SG ++G KL+AGGKR G+ G+F+EPTVFS+V DD +IA+EE
Sbjct:   329 QQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVKDDMRIAQEE 388

Query:   512 IFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGS-------AV 564
             IFGPVQ+I KF +L+E+I+RAN+ +YGLA+G++T +I+ A  FA+ ++AGS       AV
Sbjct:   389 IFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGSVWINCYDAV 448

Query:   565 VPQAPFGGFKESGIGRELGKAALDEYTELKTVT 597
             +P  PFGG+K SGIGRELGK  LD Y E KT+T
Sbjct:   449 LPSTPFGGYKHSGIGRELGKDGLDNYLETKTIT 481


GO:0005739 "mitochondrion" evidence=ISS
GO:0004029 "aldehyde dehydrogenase (NAD) activity" evidence=ISS
GO:0006090 "pyruvate metabolic process" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
ZFIN|ZDB-GENE-040426-1262 aldh2.1 "aldehyde dehydrogenase 2.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJC7 ALDH1A1 "Retinal dehydrogenase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJP8 ALDH1A1 "Retinal dehydrogenase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P27463 ALDH1A1 "Retinal dehydrogenase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BT93 ALDH2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|69219 Aldh2 "aldehyde dehydrogenase 2 family (mitochondrial)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030326-5 aldh2.2 "aldehyde dehydrogenase 2.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:99600 Aldh2 "aldehyde dehydrogenase 2, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMX7 ALDH1A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8S528AL2B7_ARATH1, ., 2, ., 1, ., 30.53710.37190.4213yesN/A
P47738ALDH2_MOUSE1, ., 2, ., 1, ., 30.53300.37190.4335yesN/A
P30837AL1B1_HUMAN1, ., 2, ., 1, ., 30.53710.37190.4352yesN/A
Q66HF8AL1B1_RAT1, ., 2, ., 1, ., 30.54950.37190.4335yesN/A
Q5R6B5AL1B1_PONAB1, ., 2, ., 1, ., 30.54130.37190.4352yesN/A
P20000ALDH2_BOVIN1, ., 2, ., 1, ., 30.54130.37190.4326yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.10.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query605
cd07141481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 1e-121
cd07091476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 1e-116
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 1e-103
PLN02466538 PLN02466, PLN02466, aldehyde dehydrogenase family 1e-97
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 4e-96
PLN02766501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 6e-92
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 1e-91
cd07143481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 3e-88
cd07103451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 3e-83
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 2e-82
cd07112462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 2e-82
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 2e-81
cd07141481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 6e-81
PRK13252488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 1e-80
cd07114457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 3e-80
cd07090457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 6e-79
cd07141481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 2e-78
cd07143481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 3e-78
cd07112462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 9e-78
cd07138466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 1e-77
cd07119482 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-de 2e-77
cd07091476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 4e-77
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 5e-76
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 6e-75
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 1e-74
cd07104431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 7e-74
cd07097473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 3e-73
cd07091476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 2e-72
cd07119482 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-de 6e-71
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 2e-70
TIGR01804467 TIGR01804, BADH, glycine betaine aldehyde dehydrog 2e-70
cd07140486 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate 1e-69
cd07110456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 1e-68
cd07088468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 5e-68
TIGR01804467 TIGR01804, BADH, glycine betaine aldehyde dehydrog 7e-68
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 9e-68
cd07559480 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophu 2e-67
cd07150451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 4e-67
PLN02466538 PLN02466, PLN02466, aldehyde dehydrogenase family 1e-66
cd07117475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 1e-66
cd07139471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 1e-66
cd07106446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 1e-66
cd07089459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 3e-66
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 9e-66
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 5e-65
PLN02466538 PLN02466, PLN02466, aldehyde dehydrogenase family 3e-64
cd07107456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 3e-64
cd07092450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 6e-64
cd07100429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 8e-64
cd07559480 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophu 1e-63
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 4e-63
cd07140486 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate 5e-62
cd07109454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 8e-62
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 9e-61
cd07149453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 1e-60
PLN02766501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 2e-60
cd07086478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 2e-60
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 7e-60
PLN02467503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 1e-59
TIGR02299488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 1e-59
cd07145456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 7e-59
TIGR01780448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 2e-58
cd07097473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 3e-58
cd07131478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 3e-58
PLN02766501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 1e-57
cd07117475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 3e-57
cd07099453 cd07099, ALDH_DDALDH, Methylomonas sp 5e-57
PLN02278498 PLN02278, PLN02278, succinic semialdehyde dehydrog 7e-57
cd07151465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 7e-57
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 3e-56
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 1e-55
PRK10090409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 3e-54
cd07114457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 4e-54
PRK09407524 PRK09407, gabD2, succinic semialdehyde dehydrogena 5e-54
cd07105432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 9e-54
PRK13252488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 2e-53
cd07090457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 7e-53
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 1e-52
cd07152443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 1e-52
PRK13473475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 1e-52
cd07103451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 2e-52
cd07101454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 6e-52
cd07147452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 9e-52
TIGR03216481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 1e-51
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 2e-51
cd07138466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 4e-51
cd07103451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 5e-51
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 2e-50
cd07113477 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dep 9e-50
cd07120455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 2e-49
cd07113477 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dep 3e-49
cd07094453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 3e-49
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 3e-49
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 6e-49
cd07114457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 1e-48
cd07131478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 2e-48
TIGR04284480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 3e-48
cd07098465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 4e-48
cd07146451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 5e-48
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 6e-48
cd07086478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 8e-48
cd07111480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 1e-47
cd07110456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 3e-47
cd07116479 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD 3e-47
cd07102452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 3e-47
PRK13252488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 8e-47
cd07106446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 1e-46
cd07116479 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD 1e-46
cd07090457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 3e-46
cd07138466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 5e-46
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 5e-46
cd07085478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 2e-45
cd07139471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 1e-44
cd07089459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 1e-44
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 3e-44
cd07088468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 4e-44
TIGR01237511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 7e-44
cd07104431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 1e-43
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 2e-43
cd07104431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 4e-43
cd07092450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 2e-42
cd07109454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 2e-42
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 1e-41
cd07110456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 1e-41
PRK11241482 PRK11241, gabD, succinate-semialdehyde dehydrogena 1e-41
PRK09406457 PRK09406, gabD1, succinic semialdehyde dehydrogena 2e-41
PRK10090409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 4e-41
cd07107456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 7e-41
cd07107456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 1e-40
PLN02467503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 1e-40
PRK09847494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 6e-40
cd07100429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 2e-39
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 2e-39
cd07082473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 2e-39
cd07089459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 6e-39
cd07092450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 9e-39
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 4e-38
cd07150451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 5e-38
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 6e-38
cd07088468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 2e-37
cd07106446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 2e-37
cd07150451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 3e-37
cd07100429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 3e-37
cd07149453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 5e-37
cd07086478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 5e-37
cd07139471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 6e-37
cd07149453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 8e-37
cd07145456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 8e-37
cd07130474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 9e-37
TIGR03250472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 8e-36
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 9e-36
cd07099453 cd07099, ALDH_DDALDH, Methylomonas sp 1e-35
PRK13968462 PRK13968, PRK13968, putative succinate semialdehyd 2e-35
cd07145456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 3e-35
TIGR01237511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 3e-35
cd07099453 cd07099, ALDH_DDALDH, Methylomonas sp 4e-35
cd07151465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 1e-34
cd07109454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 2e-34
TIGR02299488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 2e-34
TIGR01780448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 2e-34
PLN02278498 PLN02278, PLN02278, succinic semialdehyde dehydrog 2e-34
TIGR02299488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 4e-34
cd07148455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 4e-34
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 4e-34
TIGR01780448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 5e-34
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 7e-34
cd07151465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 1e-33
TIGR03216481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 4e-33
PLN02467503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 6e-33
TIGR04284480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 6e-33
cd07083500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 6e-33
cd07105432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 8e-33
cd07085478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 8e-33
PRK09407524 PRK09407, gabD2, succinic semialdehyde dehydrogena 9e-33
cd07147452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 1e-32
PRK13473475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 2e-32
cd07120455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 2e-32
cd07152443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 3e-32
TIGR03374472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 3e-32
PRK13473475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 5e-32
PRK09407524 PRK09407, gabD2, succinic semialdehyde dehydrogena 6e-32
cd07085478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 8e-32
cd07083500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 1e-31
cd07147452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 2e-31
cd07111480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 2e-31
PLN02278498 PLN02278, PLN02278, succinic semialdehyde dehydrog 4e-31
cd07102452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 4e-31
cd07098465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 5e-31
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 6e-31
cd07098465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 1e-30
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 2e-30
cd07101454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 2e-30
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 2e-30
cd07101454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 4e-30
PRK11241482 PRK11241, gabD, succinate-semialdehyde dehydrogena 6e-30
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 1e-29
cd07094453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 3e-29
TIGR03216481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 4e-29
cd07082473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 4e-29
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 5e-29
cd07094453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 7e-29
cd07146451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 7e-29
cd07152443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 1e-28
cd07111480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 5e-27
cd07105432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 2e-26
PRK09406457 PRK09406, gabD1, succinic semialdehyde dehydrogena 2e-26
cd07125518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 4e-26
cd07082473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 8e-26
TIGR01722477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 8e-26
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 9e-26
PRK09406457 PRK09406, gabD1, succinic semialdehyde dehydrogena 1e-25
PLN02315508 PLN02315, PLN02315, aldehyde dehydrogenase family 1e-25
cd07102452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 2e-25
PRK09847494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 3e-25
cd07148455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 3e-25
cd07130474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 4e-25
cd07146451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 5e-25
PRK11241482 PRK11241, gabD, succinate-semialdehyde dehydrogena 7e-25
TIGR04284480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 2e-24
cd07141481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 3e-24
cd07120455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 3e-24
PLN00412496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 8e-24
PTZ00381493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 1e-23
TIGR03250472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 2e-23
cd07091476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 3e-23
cd07095431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 3e-23
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 6e-23
PRK13968462 PRK13968, PRK13968, putative succinate semialdehyd 2e-22
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 2e-22
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 4e-22
cd07123522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 5e-22
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 3e-21
TIGR01722477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 3e-21
cd07148455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 6e-21
cd07137432 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase 8e-21
PLN02419604 PLN02419, PLN02419, methylmalonate-semialdehyde de 1e-20
TIGR03250472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 2e-20
TIGR03374472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 4e-20
cd07125518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 5e-20
PRK09847494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 8e-20
TIGR03374472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 1e-19
cd07125518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 1e-19
PLN02315508 PLN02315, PLN02315, aldehyde dehydrogenase family 1e-19
PRK09457487 PRK09457, astD, succinylglutamic semialdehyde dehy 1e-19
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 3e-19
PRK119041038 PRK11904, PRK11904, bifunctional proline dehydroge 4e-19
TIGR01722477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 6e-19
cd07130474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 1e-18
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 2e-18
cd07103451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 3e-18
PRK13968462 PRK13968, PRK13968, putative succinate semialdehyd 3e-18
cd07114457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 5e-18
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 5e-18
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 6e-18
TIGR01236532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 7e-18
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 1e-17
PLN00412496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 1e-17
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 2e-17
PLN02766501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 8e-17
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 8e-17
PLN02419604 PLN02419, PLN02419, methylmalonate-semialdehyde de 8e-17
PRK11905 1208 PRK11905, PRK11905, bifunctional proline dehydroge 9e-17
PLN02466538 PLN02466, PLN02466, aldehyde dehydrogenase family 1e-16
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 1e-16
PRK13473475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 2e-16
cd07137432 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase 2e-16
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 3e-16
COG4230 769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 7e-16
PLN02315508 PLN02315, PLN02315, aldehyde dehydrogenase family 1e-15
PTZ00381493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 1e-15
PRK09847494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 2e-15
TIGR01238500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 2e-15
PLN00412496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 4e-15
cd07123522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 5e-15
PRK119041038 PRK11904, PRK11904, bifunctional proline dehydroge 5e-15
cd07149453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 6e-15
TIGR03240484 TIGR03240, arg_catab_astD, succinylglutamic semial 7e-15
cd07123522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 1e-14
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 2e-14
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 2e-14
PLN02419604 PLN02419, PLN02419, methylmalonate-semialdehyde de 3e-14
PRK119041038 PRK11904, PRK11904, bifunctional proline dehydroge 5e-14
cd07092450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 7e-14
TIGR01780448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 1e-13
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 1e-13
PLN02174484 PLN02174, PLN02174, aldehyde dehydrogenase family 2e-13
PLN02203484 PLN02203, PLN02203, aldehyde dehydrogenase 3e-13
cd07139471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 4e-13
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 4e-13
PRK119051208 PRK11905, PRK11905, bifunctional proline dehydroge 4e-13
TIGR01238500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 6e-13
PLN02278498 PLN02278, PLN02278, succinic semialdehyde dehydrog 9e-13
TIGR01236532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 9e-13
cd07109454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 1e-12
cd07111480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 1e-12
cd07095431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 1e-12
cd07095431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 1e-12
TIGR01236532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 1e-12
PRK119051208 PRK11905, PRK11905, bifunctional proline dehydroge 1e-12
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 2e-12
PRK09457487 PRK09457, astD, succinylglutamic semialdehyde dehy 2e-12
cd07138466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 3e-12
COG4230769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 3e-12
cd07089459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 4e-12
cd07147452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 6e-12
COG4230769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 1e-11
PRK13252488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 2e-11
TIGR02299488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 2e-11
TIGR01238500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 3e-11
PLN02203484 PLN02203, PLN02203, aldehyde dehydrogenase 6e-11
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 7e-11
TIGR03216481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 9e-11
PRK11809 1318 PRK11809, putA, trifunctional transcriptional regu 9e-11
cd07128513 cd07128, ALDH_MaoC-N, N-terminal domain of the mon 1e-10
cd07090457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 2e-10
PLN02467503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 2e-10
cd07145456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 2e-10
PRK09457487 PRK09457, astD, succinylglutamic semialdehyde dehy 2e-10
TIGR03240484 TIGR03240, arg_catab_astD, succinylglutamic semial 2e-10
cd07094453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 3e-10
TIGR03374472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 3e-10
cd07088468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 4e-10
PRK119051208 PRK11905, PRK11905, bifunctional proline dehydroge 4e-10
COG4230769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 1e-09
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 2e-09
cd07099453 cd07099, ALDH_DDALDH, Methylomonas sp 2e-09
cd07146451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 2e-09
PTZ00381493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 2e-09
PRK09407524 PRK09407, gabD2, succinic semialdehyde dehydrogena 3e-09
PRK119041038 PRK11904, PRK11904, bifunctional proline dehydroge 3e-09
TIGR01238500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 3e-09
PRK118091318 PRK11809, putA, trifunctional transcriptional regu 3e-09
PRK118091318 PRK11809, putA, trifunctional transcriptional regu 3e-09
cd07085478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 6e-09
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 7e-09
cd07128513 cd07128, ALDH_MaoC-N, N-terminal domain of the mon 9e-09
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 2e-08
cd07101454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 3e-08
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 4e-08
cd07137432 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase 4e-08
PLN02174484 PLN02174, PLN02174, aldehyde dehydrogenase family 4e-08
cd07104431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 5e-08
TIGR03240484 TIGR03240, arg_catab_astD, succinylglutamic semial 5e-08
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 6e-08
cd07106446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 7e-08
cd07095431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 9e-08
cd07150451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 1e-07
cd07102452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 1e-07
cd07148455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 2e-07
cd07152443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 3e-07
PRK11563 675 PRK11563, PRK11563, bifunctional aldehyde dehydrog 3e-07
TIGR02278 663 TIGR02278, PaaN-DH, phenylacetic acid degradation 5e-07
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 6e-07
PRK118091318 PRK11809, putA, trifunctional transcriptional regu 6e-07
PRK11903521 PRK11903, PRK11903, aldehyde dehydrogenase; Provis 6e-07
cd07125518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 8e-07
cd07100429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 2e-06
cd07151465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 2e-06
PRK09457487 PRK09457, astD, succinylglutamic semialdehyde dehy 3e-06
cd07107456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 6e-06
cd07120455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 7e-06
PRK11563675 PRK11563, PRK11563, bifunctional aldehyde dehydrog 7e-06
TIGR03250472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 1e-05
TIGR01722477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 1e-05
cd07082473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 2e-05
cd07105432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 3e-05
TIGR04284480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 3e-05
TIGR03240484 TIGR03240, arg_catab_astD, succinylglutamic semial 3e-05
TIGR02278663 TIGR02278, PaaN-DH, phenylacetic acid degradation 8e-05
PRK11903521 PRK11903, PRK11903, aldehyde dehydrogenase; Provis 8e-05
PRK09406457 PRK09406, gabD1, succinic semialdehyde dehydrogena 1e-04
cd07084442 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+ 2e-04
PLN00412496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 3e-04
cd07128513 cd07128, ALDH_MaoC-N, N-terminal domain of the mon 4e-04
cd07130474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 0.001
PLN02203484 PLN02203, PLN02203, aldehyde dehydrogenase 0.002
PRK11563675 PRK11563, PRK11563, bifunctional aldehyde dehydrog 0.002
cd07084442 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+ 0.002
cd07129454 cd07129, ALDH_KGSADH, Alpha-Ketoglutaric Semialdeh 0.002
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 0.003
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 0.003
PLN02419604 PLN02419, PLN02419, methylmalonate-semialdehyde de 0.003
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 0.004
cd07123522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 0.004
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
 Score =  367 bits (945), Expect = e-121
 Identities = 146/242 (60%), Positives = 178/242 (73%), Gaps = 17/242 (7%)

Query: 373 HSIMAAAAASNLKRVSLELGGKSPLVICADADVD----MAYYYCFV------CAGSRTYV 422
             I  AA  SNLKRV+LELGGKSP ++ ADAD+D     A+   F       CAGSRT+V
Sbjct: 238 KLIQQAAGKSNLKRVTLELGGKSPNIVFADADLDYAVEQAHEALFFNMGQCCCAGSRTFV 297

Query: 423 QEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAG 482
           QE IYD FVK++VE+A  R VG+PFD   +QGPQ+D E F K+L  I+SG ++G KLE G
Sbjct: 298 QESIYDEFVKRSVERAKKRVVGNPFDPKTEQGPQIDEEQFKKILELIESGKKEGAKLECG 357

Query: 483 GKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASG 542
           GKR GDKGYFI+PTVFS+VTDD +IA+EEIFGPVQ I KFKT+DEVIERAN+T YGLA+ 
Sbjct: 358 GKRHGDKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIFKFKTIDEVIERANNTTYGLAAA 417

Query: 543 IVTTNIDTANTFAHAINAGS-------AVVPQAPFGGFKESGIGRELGKAALDEYTELKT 595
           + T +ID A TF++A+ AG+        V PQAPFGG+K SG GRELG+  L EYTE+KT
Sbjct: 418 VFTKDIDKAITFSNALRAGTVWVNCYNVVSPQAPFGGYKMSGNGRELGEYGLQEYTEVKT 477

Query: 596 VT 597
           VT
Sbjct: 478 VT 479


NAD+-dependent retinal dehydrogenase 1 (RALDH 1, ALDH1, EC=1.2.1.36) also known as aldehyde dehydrogenase family 1 member A1 (ALDH1A1) in humans, is a homotetrameric, cytosolic enzyme that catalyzes the oxidation of retinaldehyde to retinoic acid. Human ALDH1B1 and ALDH2 are also in this cluster; both are mitochrondrial homotetramers which play important roles in acetaldehyde oxidation; ALDH1B1 in response to UV light exposure and ALDH2 during ethanol metabolism. Length = 481

>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143431 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|143431 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|143434 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|143434 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143455 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>gnl|CDD|166060 PLN02419, PLN02419, methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|166060 PLN02419, PLN02419, methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143455 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|166060 PLN02419, PLN02419, methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|177831 PLN02174, PLN02174, aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>gnl|CDD|165847 PLN02203, PLN02203, aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|165847 PLN02203, PLN02203, aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|236989 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143446 cd07128, ALDH_MaoC-N, N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|236989 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|236989 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143446 cd07128, ALDH_MaoC-N, N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|143455 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>gnl|CDD|177831 PLN02174, PLN02174, aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|236931 PRK11563, PRK11563, bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131331 TIGR02278, PaaN-DH, phenylacetic acid degradation protein paaN Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236989 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|237016 PRK11903, PRK11903, aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|236931 PRK11563, PRK11563, bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|131331 TIGR02278, PaaN-DH, phenylacetic acid degradation protein paaN Back     alignment and domain information
>gnl|CDD|237016 PRK11903, PRK11903, aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143403 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143446 cd07128, ALDH_MaoC-N, N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>gnl|CDD|165847 PLN02203, PLN02203, aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|236931 PRK11563, PRK11563, bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|143403 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>gnl|CDD|143447 cd07129, ALDH_KGSADH, Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|166060 PLN02419, PLN02419, methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 605
KOG2450|consensus501 100.0
KOG2451|consensus503 100.0
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 100.0
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 100.0
PLN02766501 coniferyl-aldehyde dehydrogenase 100.0
PLN02174484 aldehyde dehydrogenase family 3 member H1 100.0
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 100.0
PLN02466538 aldehyde dehydrogenase family 2 member 100.0
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 100.0
PRK10090409 aldehyde dehydrogenase A; Provisional 100.0
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 100.0
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 100.0
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 100.0
PLN02278498 succinic semialdehyde dehydrogenase 100.0
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 100.0
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 100.0
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 100.0
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 100.0
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 100.0
PRK13252488 betaine aldehyde dehydrogenase; Provisional 100.0
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 100.0
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 100.0
PLN02315508 aldehyde dehydrogenase family 7 member 100.0
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 100.0
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 100.0
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 100.0
PLN02467503 betaine aldehyde dehydrogenase 100.0
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 100.0
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 100.0
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 100.0
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 100.0
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 100.0
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 100.0
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 100.0
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 100.0
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 100.0
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 100.0
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 100.0
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 100.0
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 100.0
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 100.0
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 100.0
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 100.0
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 100.0
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 100.0
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 100.0
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 100.0
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 100.0
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 100.0
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 100.0
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 100.0
PTZ00381493 aldehyde dehydrogenase family protein; Provisional 100.0
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 100.0
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 100.0
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 100.0
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 100.0
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 100.0
KOG2456|consensus477 100.0
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 100.0
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 100.0
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 100.0
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 100.0
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 100.0
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 100.0
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 100.0
cd07128513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 100.0
PLN02203484 aldehyde dehydrogenase 100.0
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 100.0
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 100.0
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 100.0
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 100.0
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 100.0
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 100.0
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 100.0
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 100.0
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 100.0
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 100.0
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 100.0
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 100.0
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 100.0
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 100.0
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 100.0
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 100.0
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 100.0
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 100.0
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 100.0
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 100.0
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 100.0
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 100.0
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 100.0
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 100.0
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 100.0
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 100.0
PRK11903521 aldehyde dehydrogenase; Provisional 100.0
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 100.0
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 100.0
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 100.0
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 100.0
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 100.0
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 100.0
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 100.0
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 100.0
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
PRK11809 1318 putA trifunctional transcriptional regulator/proli 100.0
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 100.0
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 100.0
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 100.0
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 100.0
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 100.0
KOG2454|consensus583 100.0
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 100.0
cd07127549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 100.0
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 100.0
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 100.0
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 100.0
PRK15398465 aldehyde dehydrogenase EutE; Provisional 100.0
KOG2455|consensus561 100.0
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 100.0
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 100.0
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 100.0
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 100.0
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 100.0
KOG2450|consensus501 100.0
KOG2452|consensus881 100.0
KOG2453|consensus507 100.0
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 100.0
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 100.0
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 100.0
KOG2451|consensus503 100.0
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 100.0
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 100.0
PLN02174484 aldehyde dehydrogenase family 3 member H1 100.0
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 100.0
PLN02766501 coniferyl-aldehyde dehydrogenase 100.0
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 100.0
PRK10090409 aldehyde dehydrogenase A; Provisional 100.0
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 100.0
PLN02466538 aldehyde dehydrogenase family 2 member 100.0
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 100.0
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 100.0
PLN02278498 succinic semialdehyde dehydrogenase 100.0
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 100.0
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 100.0
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 100.0
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 100.0
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 100.0
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 100.0
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 100.0
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 100.0
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 100.0
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 100.0
PRK13252488 betaine aldehyde dehydrogenase; Provisional 100.0
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 100.0
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 100.0
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 100.0
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 100.0
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 100.0
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 100.0
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 100.0
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 100.0
PLN02315508 aldehyde dehydrogenase family 7 member 100.0
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 100.0
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 100.0
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 100.0
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 100.0
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 100.0
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 100.0
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 100.0
PLN02467503 betaine aldehyde dehydrogenase 100.0
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 100.0
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 100.0
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 100.0
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 100.0
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 100.0
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 100.0
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 100.0
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 100.0
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 100.0
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 100.0
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 100.0
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 100.0
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 100.0
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 100.0
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 100.0
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 100.0
PLN02203484 aldehyde dehydrogenase 100.0
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 100.0
TIGR02278663 PaaN-DH phenylacetic acid degradation protein paaN 100.0
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 100.0
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 100.0
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 100.0
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 100.0
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 100.0
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 100.0
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 100.0
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 100.0
cd07128513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 100.0
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 100.0
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 100.0
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 100.0
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 100.0
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 100.0
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 100.0
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 100.0
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 100.0
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 100.0
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 100.0
KOG2456|consensus477 100.0
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 100.0
PTZ00381493 aldehyde dehydrogenase family protein; Provisional 100.0
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 100.0
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 100.0
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 100.0
PRK11563675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 100.0
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 100.0
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 100.0
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 99.98
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 99.98
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 99.98
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 99.98
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 99.98
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 99.98
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 99.98
PRK11903521 aldehyde dehydrogenase; Provisional 99.98
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 99.97
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 99.97
KOG2452|consensus881 99.97
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 99.97
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 99.97
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 99.97
KOG2454|consensus583 99.97
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 99.97
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 99.96
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 99.96
PRK119051208 bifunctional proline dehydrogenase/pyrroline-5-car 99.96
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 99.95
PRK118091318 putA trifunctional transcriptional regulator/proli 99.95
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 99.94
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 99.94
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 99.93
KOG2455|consensus561 99.92
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 99.92
PRK15398465 aldehyde dehydrogenase EutE; Provisional 99.91
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 99.91
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 99.91
cd07127549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 99.9
KOG2453|consensus507 99.89
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 99.89
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 99.89
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 99.88
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 99.88
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 99.88
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 99.84
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 99.83
COG4230769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 99.83
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 99.82
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 99.76
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 99.62
cd07080422 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC. Ac 99.59
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 99.41
KOG2449|consensus157 99.4
KOG2449|consensus157 99.35
KOG4165|consensus433 98.96
KOG4165|consensus433 98.85
PF07368215 DUF1487: Protein of unknown function (DUF1487); In 98.29
PF07368215 DUF1487: Protein of unknown function (DUF1487); In 97.3
PF05893399 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR0086 96.57
PF05893399 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR0086 96.17
>KOG2450|consensus Back     alignment and domain information
Probab=100.00  E-value=2.1e-63  Score=506.58  Aligned_cols=243  Identities=55%  Similarity=0.872  Sum_probs=228.0

Q ss_pred             ceeEEEecCCccccHHHHHHHHHhccccceeeecCCCCcEEEcCCCCHHHHH----------hcccccccCeEEEecccH
Q psy1099         358 ELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAY----------YYCFVCAGSRTYVQEDIY  427 (605)
Q Consensus       358 ~~k~~t~s~~~~~~g~~v~~~~a~~~~~~~~lElgG~~p~iV~~dad~~~a~----------~~~~c~a~~~v~v~~~~~  427 (605)
                      ...+||+|.   .+|+.|++.++.+++||++||||||+|.||++|||++.|+          .|+-|++.+|+|||+++|
T Consensus       239 ~kiaFTGSt---~~G~~I~~aaa~~n~K~vtLElGGKsp~Ivf~Dadld~av~~~~~~iF~nqGq~C~a~sR~~Vqe~iy  315 (501)
T KOG2450|consen  239 DKVAFTGST---PVGKEIMEAAAESNLKPVTLELGGKSPIIVFDDADLDLAVENAAFGIFFNQGQCCTAGSRVFVQESIY  315 (501)
T ss_pred             ceEEecCCC---cchhHHhhhhhhcCCceeccccCCCCcceEecccchHHHHHHHHHHhhcccccccccCceeEEechHH
Confidence            344788885   9999999999988899999999999999999999999987          333499999999999999


Q ss_pred             HHHHHHHHHHHhh-cccCCCCCCCCCCCcccCHHHHHHHHHHHHHHHHcCCeEEeCCcccCCCCeeEeeEEeecCCCCCc
Q psy1099         428 DTFVKKAVEKAAA-RKVGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFK  506 (605)
Q Consensus       428 ~~~~~~l~~~~~~-~~~g~~~~~~~~~gpli~~~~~~~~~~~i~~a~~~g~~v~~gg~~~~~~g~~~~Pti~~~~~~~~~  506 (605)
                      |+|+++++++..+ +++|||.++.+.+||.+++.|++|++++++.++++|+++++||.+..+.|||+.|||+.++.++|.
T Consensus       316 defv~~~v~~a~~~~kvGdP~~~~~~qG~~i~~~q~ekI~~yi~~~k~eGa~l~~gG~~~g~~Gyfi~Ptv~~~v~~~m~  395 (501)
T KOG2450|consen  316 DEFVEKFVAAAKKKLKVGDPFDEGTEQGPQISKTQYEKILGYIESGKKEGATLLCGGVRLGDKGYFIKPTVFTNVTDDMR  395 (501)
T ss_pred             HHHHHHHHHHHhcccccCCCCCcccccccccCHHHHHHHHHHHHHHHhcCCEEEecCcccCCCceEECCeeccCCChhhh
Confidence            9999999999976 999999999999999999999999999999999999999999987777899999999999999999


Q ss_pred             ccccceeeeeeeeEeeCCHHHHHHHhhcCCCCceEEEEcCCHHHHHHHHHHcccCcccC-------CCCcccccCCCCCC
Q psy1099         507 IAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSAVV-------PQAPFGGFKESGIG  579 (605)
Q Consensus       507 ~~~eE~FGPvl~i~~~~~~~eai~~~n~~~~gL~a~vft~d~~~~~~~~~~~~~G~~~~-------~~~PfGG~~~SG~G  579 (605)
                      +++|||||||+.|++|++.||+|+++|.++|||+++|||+|.+++.++++++++|+++.       ...||||+|+||+|
T Consensus       396 i~~EEIFGPVv~v~~F~t~eE~i~~AN~t~yGLAa~V~t~dl~~a~~va~~l~aGtVwiN~y~~~~~~~PfgG~K~SG~G  475 (501)
T KOG2450|consen  396 IAKEEIFGPVVVVLKFKTEEEVIERANNTTYGLAAGVFTKDLDKAHRVANALQAGTVWINCYNVFDAQVPFGGFKMSGIG  475 (501)
T ss_pred             hhHhhccCceEEEEecCcHHHHHHHhcCCcccceeeEeccChHHHHHHHHHhcCceEEEeccccccccCCccccccccCC
Confidence            99999999999999999999999999999999999999999999999999999999543       56899999999999


Q ss_pred             ChhHHHHHHHhhhceEEEEcCCCC
Q psy1099         580 RELGKAALDEYTELKTVTESPLRS  603 (605)
Q Consensus       580 ~~~g~~~~~~~~~~k~v~~~~~~~  603 (605)
                      |+.|.+++.+||+.|+|+.+--.+
T Consensus       476 RE~g~~~l~~ytevKtv~v~~~~~  499 (501)
T KOG2450|consen  476 RELGEYGLEAYTEVKTVTVKLPQK  499 (501)
T ss_pred             ccccHHHHhhcceeeEEEEeCCCC
Confidence            999999999999999999875543



>KOG2451|consensus Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>KOG2456|consensus Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>KOG2454|consensus Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>KOG2455|consensus Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>KOG2450|consensus Back     alignment and domain information
>KOG2452|consensus Back     alignment and domain information
>KOG2453|consensus Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>KOG2451|consensus Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>KOG2456|consensus Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>KOG2452|consensus Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>KOG2454|consensus Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>KOG2455|consensus Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>KOG2453|consensus Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd07080 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC Back     alignment and domain information
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2449|consensus Back     alignment and domain information
>KOG2449|consensus Back     alignment and domain information
>KOG4165|consensus Back     alignment and domain information
>KOG4165|consensus Back     alignment and domain information
>PF07368 DUF1487: Protein of unknown function (DUF1487); InterPro: IPR009961 This family consists of several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>PF07368 DUF1487: Protein of unknown function (DUF1487); InterPro: IPR009961 This family consists of several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>PF05893 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR008670 This family consists of several bacterial Acyl-CoA reductase (LuxC) proteins Back     alignment and domain information
>PF05893 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR008670 This family consists of several bacterial Acyl-CoA reductase (LuxC) proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query605
1bxs_A501 Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad 4e-63
1o9j_A501 The X-Ray Crystal Structure Of Eta-Crystallin Lengt 5e-63
1o9j_A501 The X-Ray Crystal Structure Of Eta-Crystallin Lengt 2e-58
1ag8_A499 Aldehyde Dehydrogenase From Bovine Mitochondria Len 1e-62
1bi9_A499 Retinal Dehydrogenase Type Two With Nad Bound Lengt 2e-62
1o05_A500 Apo Form Of Human Mitochondrial Aldehyde Dehydrogen 3e-62
3n81_A500 T244a Mutant Of Human Mitochondrial Aldehyde Dehydr 3e-62
1cw3_A494 Human Mitochondrial Aldehyde Dehydrogenase Complexe 4e-62
3n80_A500 Human Mitochondrial Aldehyde Dehydrogenase, Apo For 4e-62
1nzw_A500 Cys302ser Mutant Of Human Mitochondrial Aldehyde De 4e-62
2onn_A500 Arg475gln Mutant Of Human Mitochondrial Aldehyde De 1e-61
4fr8_A500 Crystal Structure Of Human Aldehyde Dehydrogenase-2 1e-60
1zum_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 6e-59
3inl_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 8e-59
2wme_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 2e-44
2wox_A489 Betaine Aldehyde Dehydrogenase From Pseudomonas Aer 2e-44
3zqa_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 5e-44
2wme_C490 Crystallographic Structure Of Betaine Aldehyde Dehy 7e-44
2o2p_A517 Crystal Structure Of The C-Terminal Domain Of Rat 1 8e-44
3rhr_A517 Crystal Structure Of The C707a Mutant Of The C-Term 8e-44
4gnz_A517 Crystal Structure Of The C707s Mutant Of C-terminal 9e-44
2xdr_A489 Crystallographic Structure Of Betaine Aldehyde Dehy 1e-43
3rhm_A517 Crystal Structure Of The E673q Mutant Of C-Terminal 1e-43
3rhj_A517 Crystal Structure Of The E673a Mutant Of The C-Term 4e-43
3rhl_A517 Crystal Structure Of The E673aC707A DOUBLE MUTANT O 4e-43
4i8p_A520 Crystal Structure Of Aminoaldehyde Dehydrogenase 1a 3e-42
4i8p_A520 Crystal Structure Of Aminoaldehyde Dehydrogenase 1a 2e-39
3r31_A517 Crystal Structure Of Betaine Aldehyde Dehydrogenase 5e-42
3ty7_A478 Crystal Structure Of Aldehyde Dehydrogenase Family 6e-41
3iwk_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 1 6e-40
3iwj_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 2 4e-39
4a0m_A496 Crystal Structure Of Betaine Aldehyde Dehydrogenase 2e-38
4a0m_A496 Crystal Structure Of Betaine Aldehyde Dehydrogenase 7e-37
4i9b_A517 Structure Of Aminoaldehyde Dehydrogenase 1 From Sol 2e-37
3u4j_A528 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 4e-37
3u4j_A528 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 1e-36
1a4s_A503 Betaine Aldehyde Dehydrogenase From Cod Liver Lengt 5e-37
2d4e_A515 Crystal Structure Of The Hpcc From Thermus Thermoph 5e-37
4i8q_A514 Structure Of The Aminoaldehyde Dehydrogenase 1 E260 1e-36
3ed6_A520 1.7 Angstrom Resolution Crystal Structure Of Betain 4e-36
3b4w_A495 Crystal Structure Of Mycobacterium Tuberculosis Ald 3e-34
3jz4_C481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 9e-33
3jz4_A481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 1e-32
3rjl_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 1e-32
2opx_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 2e-32
3ek1_A504 Crystal Structure Of Aldehyde Dehydrogenase From Br 3e-32
2imp_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 1e-31
2hg2_A479 Structure Of Lactaldehyde Dehydrogenase Length = 47 1e-31
3qan_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 2e-30
3ifg_A484 Crystal Structure Of Succinate-Semialdehyde Dehydro 1e-29
3i44_A497 Crystal Structure Of Aldehyde Dehydrogenase From Ba 2e-29
3k2w_A497 Crystal Structure Of Betaine-Aldehyde Dehydrogenase 4e-27
4dng_A485 Crystal Structure Of Putative Aldehyde Dehydrogenas 4e-27
1wnb_A495 Escherichia Coli Ydcw Gene Product Is A Medium-Chai 7e-27
1wnb_A495 Escherichia Coli Ydcw Gene Product Is A Medium-Chai 2e-26
4dal_A498 Crystal Structure Of Putative Aldehyde Dehydrogenas 4e-26
1uzb_A516 1-pyrroline-5-carboxylate Dehydrogenase Length = 51 6e-26
2bhp_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 8e-26
2w8n_A487 The Crytal Structure Of The Oxidized Form Of Human 9e-26
2bja_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 9e-26
2w8p_A487 The Crystal Structure Of Human C340a Ssadh Length = 1e-25
3rh9_A506 The Crystal Structure Of Oxidoreductase From Marino 2e-25
3pqa_A486 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 3e-25
1t90_A486 Crystal Structure Of Methylmalonate Semialdehyde De 3e-24
3efv_A462 Crystal Structure Of A Putative Succinate-Semialdeh 7e-24
3r64_A508 Crystal Structure Of A Nad-Dependent Benzaldehyde D 4e-21
3ros_A484 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 6e-21
2jg7_A510 Crystal Structure Of Seabream Antiquitin And Elucid 6e-20
1ky8_A501 Crystal Structure Of The Non-Phosphorylating Glycer 2e-19
1uxv_A501 Structural Basis For Allosteric Regulation And Subs 4e-19
1uxn_A501 Structural Basis For Allosteric Regulation And Subs 7e-19
3prl_A505 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 7e-19
2j6l_A500 Structure Of Aminoadipate-Semialdehyde Dehydrogenas 3e-18
4h7n_A474 The Structure Of Putative Aldehyde Dehydrogenase Pu 1e-16
4e4g_A521 Crystal Structure Of Putative Methylmalonate-Semial 2e-16
4f9i_A1026 Crystal Structure Of Proline Utilization A (Puta) F 3e-16
2id2_A475 Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 6e-16
1euh_A475 Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase 6e-16
1qi1_A475 Ternary Complex Of An Nadp Dependent Aldehyde Dehyd 9e-16
2esd_A475 Crystal Structure Of Thioacylenzyme Intermediate Of 3e-15
3sza_A469 Crystal Structure Of Human Aldh3a1 - Apo Form Lengt 3e-14
1ad3_A452 Class 3 Aldehyde Dehydrogenase Complex With Nicotin 9e-14
3haz_A1001 Crystal Structure Of Bifunctional Proline Utilizati 1e-09
3v9g_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 7e-09
3v9h_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 7e-09
3lns_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 1e-08
3lv1_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 1e-08
3v9j_A563 Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylat 1e-08
3v9i_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 3e-08
3ju8_A490 Crystal Structure Of Succinylglutamic Semialdehyde 1e-07
>pdb|1BXS|A Chain A, Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad Bound Length = 501 Back     alignment and structure

Iteration: 1

Score = 239 bits (609), Expect = 4e-63, Method: Compositional matrix adjust. Identities = 128/240 (53%), Positives = 161/240 (67%), Gaps = 17/240 (7%) Query: 375 IMAAAAASNLKRVSLELGGKSPLVICADADVDMA--------YYYCFVC--AGSRTYVQE 424 I AA SNLKRVSLELGGKSP ++ ADAD+D A +Y+ C A SR +V+E Sbjct: 254 IKEAAGKSNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEE 313 Query: 425 DIYDTFXXXXXXXXXXXXXGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGK 484 IYD F G+P V QGPQ+D E + K+L+ I+SG ++G KLE GG Sbjct: 314 SIYDEFVRRSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGG 373 Query: 485 RKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIV 544 G+KGYFI+PTVFS+VTDD +IA+EEIFGPVQ I+KFK+LD+VI+RAN+T YGL++GI Sbjct: 374 PWGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIF 433 Query: 545 TTNIDTANTFAHAINAG-------SAVVPQAPFGGFKESGIGRELGKAALDEYTELKTVT 597 T +ID A T + A+ +G S V Q PFGGFK SG GRELG+ EYTE+KTVT Sbjct: 434 TNDIDKAITVSSALQSGTVWVNCYSVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVT 493
>pdb|1O9J|A Chain A, The X-Ray Crystal Structure Of Eta-Crystallin Length = 501 Back     alignment and structure
>pdb|1O9J|A Chain A, The X-Ray Crystal Structure Of Eta-Crystallin Length = 501 Back     alignment and structure
>pdb|1AG8|A Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria Length = 499 Back     alignment and structure
>pdb|1BI9|A Chain A, Retinal Dehydrogenase Type Two With Nad Bound Length = 499 Back     alignment and structure
>pdb|1O05|A Chain A, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|3N81|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1CW3|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nad+ And Mn2+ Length = 494 Back     alignment and structure
>pdb|3N80|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1NZW|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nadh And Mg2+ Length = 500 Back     alignment and structure
>pdb|2ONN|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|4FR8|A Chain A, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In Complex With Nitroglycerin Length = 500 Back     alignment and structure
>pdb|1ZUM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Apo Form Length = 500 Back     alignment and structure
>pdb|3INL|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Complexed With Agonist Alda-1 Length = 500 Back     alignment and structure
>pdb|2WME|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2WOX|A Chain A, Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa With Nad(P)h-Catalytic Thiol Adduct. Length = 489 Back     alignment and structure
>pdb|3ZQA|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant C286a From Pseudomonas Aeruginosa In Complex With Nadph Length = 490 Back     alignment and structure
>pdb|2WME|C Chain C, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2O2P|A Chain A, Crystal Structure Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|3RHR|A Chain A, Crystal Structure Of The C707a Mutant Of The C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadph Length = 517 Back     alignment and structure
>pdb|4GNZ|A Chain A, Crystal Structure Of The C707s Mutant Of C-terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadp Length = 517 Back     alignment and structure
>pdb|2XDR|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant E252a From Pseudomonas Aeruginosa Length = 489 Back     alignment and structure
>pdb|3RHM|A Chain A, Crystal Structure Of The E673q Mutant Of C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|3RHJ|A Chain A, Crystal Structure Of The E673a Mutant Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|3RHL|A Chain A, Crystal Structure Of The E673aC707A DOUBLE MUTANT OF THE C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|4I8P|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1a From Zea Mays (zmamadh1a) Length = 520 Back     alignment and structure
>pdb|4I8P|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1a From Zea Mays (zmamadh1a) Length = 520 Back     alignment and structure
>pdb|3R31|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Agrobacterium Tumefaciens Length = 517 Back     alignment and structure
>pdb|3TY7|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase Family Protein From Staphylococcus Aureus Length = 478 Back     alignment and structure
>pdb|3IWK|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1 From Pisum Sativum (Psamadh1) Length = 503 Back     alignment and structure
>pdb|3IWJ|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 2 From Pisum Sativum (Psamadh2) Length = 503 Back     alignment and structure
>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Spinach In Complex With Nad Length = 496 Back     alignment and structure
>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Spinach In Complex With Nad Length = 496 Back     alignment and structure
>pdb|4I9B|A Chain A, Structure Of Aminoaldehyde Dehydrogenase 1 From Solanum Lycopersium (slamadh1) With A Thiohemiacetal Intermediate Length = 517 Back     alignment and structure
>pdb|3U4J|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Sinorhizobium Meliloti Length = 528 Back     alignment and structure
>pdb|3U4J|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Sinorhizobium Meliloti Length = 528 Back     alignment and structure
>pdb|1A4S|A Chain A, Betaine Aldehyde Dehydrogenase From Cod Liver Length = 503 Back     alignment and structure
>pdb|2D4E|A Chain A, Crystal Structure Of The Hpcc From Thermus Thermophilus Hb8 Length = 515 Back     alignment and structure
>pdb|4I8Q|A Chain A, Structure Of The Aminoaldehyde Dehydrogenase 1 E260a Mutant From Solanum Lycopersicum (slamadh1-e260a) Length = 514 Back     alignment and structure
>pdb|3ED6|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of Betaine Aldehyde Dehydrogenase (Betb) From Staphylococcus Aureus Length = 520 Back     alignment and structure
>pdb|3B4W|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Aldehyde Dehydrogenase Complexed With Nad+ Length = 495 Back     alignment and structure
>pdb|3JZ4|C Chain C, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|3JZ4|A Chain A, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|3RJL|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Licheniformis (Target Nysgrc-000337) Length = 538 Back     alignment and structure
>pdb|2OPX|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From Escherichia Coli Length = 479 Back     alignment and structure
>pdb|3EK1|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Brucella Melitensis Biovar Abortus 2308 Length = 504 Back     alignment and structure
>pdb|2IMP|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From E. Coli: The Ternary Complex With Product Bound (L)-Lactate And Nadh. Length = 479 Back     alignment and structure
>pdb|2HG2|A Chain A, Structure Of Lactaldehyde Dehydrogenase Length = 479 Back     alignment and structure
>pdb|3QAN|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Halodurans Length = 538 Back     alignment and structure
>pdb|3IFG|A Chain A, Crystal Structure Of Succinate-Semialdehyde Dehydrogenase From Burkholderia Pseudomallei, Part 1 Of 2 Length = 484 Back     alignment and structure
>pdb|3I44|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Bartonella Henselae At 2.0a Resolution Length = 497 Back     alignment and structure
>pdb|3K2W|A Chain A, Crystal Structure Of Betaine-Aldehyde Dehydrogenase From Pseudoalteromonas Atlantica T6c Length = 497 Back     alignment and structure
>pdb|4DNG|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Bacillus Subtilis Subsp. Subtilis Str. 168 Length = 485 Back     alignment and structure
>pdb|1WNB|A Chain A, Escherichia Coli Ydcw Gene Product Is A Medium-Chain Aldehyde Dehydrogenase (Complexed With Nadh And Betaine Aldehyde) Length = 495 Back     alignment and structure
>pdb|1WNB|A Chain A, Escherichia Coli Ydcw Gene Product Is A Medium-Chain Aldehyde Dehydrogenase (Complexed With Nadh And Betaine Aldehyde) Length = 495 Back     alignment and structure
>pdb|4DAL|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 498 Back     alignment and structure
>pdb|1UZB|A Chain A, 1-pyrroline-5-carboxylate Dehydrogenase Length = 516 Back     alignment and structure
>pdb|2BHP|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nad. Length = 516 Back     alignment and structure
>pdb|2W8N|A Chain A, The Crytal Structure Of The Oxidized Form Of Human Ssadh Length = 487 Back     alignment and structure
>pdb|2BJA|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nadh Length = 516 Back     alignment and structure
>pdb|2W8P|A Chain A, The Crystal Structure Of Human C340a Ssadh Length = 487 Back     alignment and structure
>pdb|3RH9|A Chain A, The Crystal Structure Of Oxidoreductase From Marinobacter Aquaeolei Length = 506 Back     alignment and structure
>pdb|3PQA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Gapn From Methanocaldococcus Jannaschii Dsm 2661 Length = 486 Back     alignment and structure
>pdb|1T90|A Chain A, Crystal Structure Of Methylmalonate Semialdehyde Dehydrogenase From Bacillus Subtilis Length = 486 Back     alignment and structure
>pdb|3EFV|A Chain A, Crystal Structure Of A Putative Succinate-Semialdehyde Dehydrogenase From Salmonella Typhimurium Lt2 With Bound Nad Length = 462 Back     alignment and structure
>pdb|3R64|A Chain A, Crystal Structure Of A Nad-Dependent Benzaldehyde Dehydrogenase From Corynebacterium Glutamicum Length = 508 Back     alignment and structure
>pdb|3ROS|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Lactobacillus Acidophilus Length = 484 Back     alignment and structure
>pdb|2JG7|A Chain A, Crystal Structure Of Seabream Antiquitin And Elucidation Of Its Substrate Specificity Length = 510 Back     alignment and structure
>pdb|1KY8|A Chain A, Crystal Structure Of The Non-Phosphorylating Glyceraldehyde-3- Phosphate Dehydrogenase Length = 501 Back     alignment and structure
>pdb|1UXV|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|1UXN|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|3PRL|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Halodurans C-125 Length = 505 Back     alignment and structure
>pdb|2J6L|A Chain A, Structure Of Aminoadipate-Semialdehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|4H7N|A Chain A, The Structure Of Putative Aldehyde Dehydrogenase Puta From Anabaena Variabilis. Length = 474 Back     alignment and structure
>pdb|4E4G|A Chain A, Crystal Structure Of Putative Methylmalonate-Semialdehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 521 Back     alignment and structure
>pdb|4F9I|A Chain A, Crystal Structure Of Proline Utilization A (Puta) From Geobacter Sulfurreducens Pca Length = 1026 Back     alignment and structure
>pdb|2ID2|A Chain A, Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 475 Back     alignment and structure
>pdb|1EUH|A Chain A, Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase From Streptococcus Mutans Length = 475 Back     alignment and structure
>pdb|1QI1|A Chain A, Ternary Complex Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|2ESD|A Chain A, Crystal Structure Of Thioacylenzyme Intermediate Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|3SZA|A Chain A, Crystal Structure Of Human Aldh3a1 - Apo Form Length = 469 Back     alignment and structure
>pdb|1AD3|A Chain A, Class 3 Aldehyde Dehydrogenase Complex With Nicotinamide- Adenine-Dinucleotide Length = 452 Back     alignment and structure
>pdb|3HAZ|A Chain A, Crystal Structure Of Bifunctional Proline Utilization A (Puta) Protein Length = 1001 Back     alignment and structure
>pdb|3V9G|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Length = 566 Back     alignment and structure
>pdb|3V9H|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352a Length = 566 Back     alignment and structure
>pdb|3LNS|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ And Benzoate Adduct Length = 457 Back     alignment and structure
>pdb|3LV1|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ Length = 457 Back     alignment and structure
>pdb|3V9J|A Chain A, Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylate Dehydrogenase Complexed With Sulfate Ion Length = 563 Back     alignment and structure
>pdb|3V9I|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352l Length = 566 Back     alignment and structure
>pdb|3JU8|A Chain A, Crystal Structure Of Succinylglutamic Semialdehyde Dehydrogenase From Pseudomonas Aeruginosa. Length = 490 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query605
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 1e-128
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 1e-85
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 2e-80
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 2e-25
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 1e-127
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 2e-85
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 2e-80
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 2e-25
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 1e-125
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 5e-83
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 1e-77
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 1e-25
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 1e-125
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 4e-83
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 3e-77
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 1e-24
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 1e-123
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 1e-84
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 2e-76
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 2e-24
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 1e-122
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 1e-82
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 2e-75
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 4e-24
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 1e-122
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 2e-82
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 2e-76
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 2e-24
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 1e-122
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 3e-82
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 2e-76
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 2e-22
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 1e-121
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 1e-82
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 6e-76
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 4e-25
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 1e-119
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 6e-80
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 6e-74
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 8e-22
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 1e-118
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 1e-79
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 6e-74
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 7e-22
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 1e-116
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 2e-76
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 7e-72
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 3e-24
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 1e-109
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 1e-71
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 2e-70
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 7e-22
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 1e-108
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 6e-72
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 3e-66
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 5e-21
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 1e-107
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 2e-71
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 2e-65
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 5e-21
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 1e-107
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 3e-71
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 1e-64
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 1e-19
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 1e-100
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 8e-68
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 1e-63
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 5e-22
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 2e-97
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 1e-62
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 1e-59
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 6e-20
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 8e-90
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 2e-57
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 2e-54
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 3e-22
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 2e-87
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 2e-57
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 9e-54
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 3e-21
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 1e-86
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 5e-55
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 6e-52
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 6e-20
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 3e-83
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 1e-54
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 1e-49
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 1e-19
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 9e-83
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 2e-52
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 1e-48
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 5e-18
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 1e-81
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 1e-52
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 2e-49
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 1e-19
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 1e-81
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 2e-50
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 4e-50
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 1e-14
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 3e-81
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 3e-51
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 2e-48
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 1e-19
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 5e-79
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 9e-48
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 3e-46
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 1e-15
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 1e-74
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 5e-47
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 1e-44
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 8e-14
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 2e-74
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 4e-47
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 2e-44
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 1e-13
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 5e-74
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 2e-43
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 3e-43
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 2e-18
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 8e-74
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 4e-44
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 1e-43
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 2e-18
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 1e-73
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 5e-44
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 1e-43
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 2e-18
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 7e-73
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 2e-43
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 5e-43
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 3e-18
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 9e-73
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 3e-43
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 1e-42
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 3e-18
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 2e-72
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 3e-44
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 2e-42
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 2e-18
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 7e-71
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 1e-47
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 1e-46
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 3e-16
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 3e-55
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 2e-35
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 4e-35
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 4e-11
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 4e-49
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 2e-34
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 1e-33
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 2e-09
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 1e-46
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 6e-33
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 6e-32
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 2e-09
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 5e-43
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 3e-33
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 8e-23
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 3e-42
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 4e-29
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 3e-23
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 4e-15
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 2e-38
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 1e-25
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 4e-23
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 4e-13
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 9e-37
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 8e-27
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 5e-25
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 8e-10
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 1e-33
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 7e-22
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 2e-13
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 5e-30
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 4e-18
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 8e-09
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 7e-28
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 2e-22
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 8e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
 Score =  384 bits (989), Expect = e-128
 Identities = 129/244 (52%), Positives = 167/244 (68%), Gaps = 17/244 (6%)

Query: 371 TSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAYYYCFV----------CAGSRT 420
               I  AA  SNLKRVSLELGGKSP ++ ADAD+D A  +              A SR 
Sbjct: 250 VGKLIKEAAGKSNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRL 309

Query: 421 YVQEDIYDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLE 480
           +V+E IYD FV+++VE+A    +G+P    V QGPQ+D E + K+L+ I+SG ++G KLE
Sbjct: 310 FVEESIYDEFVRRSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLE 369

Query: 481 AGGKRKGDKGYFIEPTVFSNVTDDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLA 540
            GG   G+KGYFI+PTVFS+VTDD +IA+EEIFGPVQ I+KFK+LD+VI+RAN+T YGL+
Sbjct: 370 CGGGPWGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLS 429

Query: 541 SGIVTTNIDTANTFAHAINAGS-------AVVPQAPFGGFKESGIGRELGKAALDEYTEL 593
           +GI T +ID A T + A+ +G+        V  Q PFGGFK SG GRELG+    EYTE+
Sbjct: 430 AGIFTNDIDKAITVSSALQSGTVWVNCYSVVSAQCPFGGFKMSGNGRELGEYGFHEYTEV 489

Query: 594 KTVT 597
           KTVT
Sbjct: 490 KTVT 493


>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query605
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 100.0
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 100.0
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 100.0
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 100.0
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 100.0
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 100.0
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 100.0
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 100.0
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 100.0
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 100.0
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 100.0
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 100.0
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 100.0
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 100.0
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 100.0
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 100.0
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 100.0
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 100.0
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 100.0
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 100.0
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 100.0
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 100.0
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 100.0
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 100.0
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 100.0
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 100.0
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 100.0
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 100.0
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 100.0
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 100.0
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 100.0
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 100.0
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 100.0
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 100.0
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 100.0
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 100.0
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 100.0
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 100.0
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 100.0
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 100.0
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 100.0
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 100.0
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 100.0
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 100.0
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 100.0
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 100.0
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 100.0
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 100.0
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 100.0
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 100.0
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 100.0
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 100.0
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 100.0
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 100.0
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 100.0
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 100.0
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 100.0
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 100.0
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 100.0
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 100.0
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 100.0
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 100.0
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 100.0
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 100.0
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 100.0
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 100.0
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 100.0
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 100.0
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 100.0
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 100.0
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 100.0
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 100.0
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 100.0
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 100.0
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 100.0
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 100.0
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 100.0
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 100.0
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 100.0
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 100.0
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 100.0
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 100.0
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 100.0
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 100.0
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 100.0
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 100.0
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 100.0
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 100.0
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 99.98
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 99.98
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 99.97
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 99.96
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 99.95
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 99.95
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 99.91
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 99.91
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 99.9
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 99.89
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 99.89
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 99.85
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
Probab=100.00  E-value=3.9e-64  Score=541.89  Aligned_cols=242  Identities=41%  Similarity=0.665  Sum_probs=226.2

Q ss_pred             cceeEEEecCCccccHHHHHHHHHhccccceeeecCCCCcEEEcCCCCHHHHH----------hcccccccCeEEEeccc
Q psy1099         357 TELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAY----------YYCFVCAGSRTYVQEDI  426 (605)
Q Consensus       357 ~~~k~~t~s~~~~~~g~~v~~~~a~~~~~~~~lElgG~~p~iV~~dad~~~a~----------~~~~c~a~~~v~v~~~~  426 (605)
                      .+..+||||+   .+|+++++.++++++||++||||||||+||++|||++.|+          .|+.|++++|+|||+++
T Consensus       222 v~~I~FTGS~---~~G~~i~~~~a~~~lk~v~lELGGk~p~iV~~dAdl~~A~~~~~~~~~~n~GQ~C~a~~rv~V~~~i  298 (490)
T 2wme_A          222 IEKISFTGGT---STGKKVMASASSSSLKEVTMELGGKSPLIIFPDADLDRAADIAVMANFFSSGQVCTNGTRVFIHRSQ  298 (490)
T ss_dssp             CCEEEEESCH---HHHHHHHHHHHHHHCCEEEEECCCCCEEEECTTSCHHHHHHHHHHHHHGGGGCCTTCCCEEEEEGGG
T ss_pred             CCEEEEECCh---HHHHHHHHhhhccCCceEEEEcCCcCeEEEccCccHHHHHHHHHHHHhccCCCcCCCceeeccchhH
Confidence            3455789986   9999998877777899999999999999999999999986          56669999999999999


Q ss_pred             HHHHHHHHHHHHhhcccCCCCCCCCCCCcccCHHHHHHHHHHHHHHHHcCCeEEeCCcccC----CCCeeEeeEEeecCC
Q psy1099         427 YDTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKG----DKGYFIEPTVFSNVT  502 (605)
Q Consensus       427 ~~~~~~~l~~~~~~~~~g~~~~~~~~~gpli~~~~~~~~~~~i~~a~~~g~~v~~gg~~~~----~~g~~~~Pti~~~~~  502 (605)
                      +|+|+++|+++++++++|+|.++++++||++++.+++++.+++++++++|+++++||+...    ..|+|++|||+.+++
T Consensus       299 ~d~f~~~l~~~~~~l~vGdp~~~~~~~Gpli~~~~~~rv~~~i~~a~~~Ga~v~~gG~~~~~~~~~~G~~~~Ptvl~~v~  378 (490)
T 2wme_A          299 QARFEAKVLERVQRIRLGDPQDENTNFGPLVSFPHMESVLGYIESGKAQKARLLCGGERVTDGAFGKGAYVAPTVFTDCR  378 (490)
T ss_dssp             HHHHHHHHHHHHHTCCBSCTTSTTCCBCCCSCHHHHHHHHHHHHHHHHTTCEEEECCSBCCTTTGGGTTCBCCEEEESCC
T ss_pred             HHHHHHHHHHHHHhCcCCCCccccCccCCcCCHHHHHHHHHHHHHHHhcCCEEEECCcccCcccccCCCccCCEEEEcCC
Confidence            9999999999999999999999999999999999999999999999999999999997643    368999999999999


Q ss_pred             CCCcccccceeeeeeeeEeeCCHHHHHHHhhcCCCCceEEEEcCCHHHHHHHHHHcccCccc-------CCCCcccccCC
Q psy1099         503 DDFKIAREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSAV-------VPQAPFGGFKE  575 (605)
Q Consensus       503 ~~~~~~~eE~FGPvl~i~~~~~~~eai~~~n~~~~gL~a~vft~d~~~~~~~~~~~~~G~~~-------~~~~PfGG~~~  575 (605)
                      ++|++++||+||||++|++|+|+||||+++|+++|||++||||+|.++++++++++++|.++       .+.+||||+|.
T Consensus       379 ~~~~i~~eEiFGPVl~v~~~~~~deAi~~aN~~~yGL~a~v~t~d~~~a~~~~~~l~aG~v~iN~~~~~~~~~PFGG~k~  458 (490)
T 2wme_A          379 DDMTIVREEIFGPVMSILVYDDEDEAIRRANDTEYGLAAGVVTQDLARAHRAIHRLEAGICWINTWGESPAEMPVGGYKQ  458 (490)
T ss_dssp             TTSHHHHSCCCSSEEEEEEESCHHHHHHHHHCSSCCSEEEEECSBHHHHHHHHHHSCCSEEEESCCSCCCTTSCBCCSGG
T ss_pred             CCChhhhccccCCEEEEEEeCCHHHHHHHHhcCCCCCeEEEEcCCHHHHHHHHHHCCeeEEEEeCCCCCCCCCCcccccc
Confidence            99999999999999999999999999999999999999999999999999999999999843       35689999999


Q ss_pred             CCCCChhHHHHHHHhhhceEEEEcCC
Q psy1099         576 SGIGRELGKAALDEYTELKTVTESPL  601 (605)
Q Consensus       576 SG~G~~~g~~~~~~~~~~k~v~~~~~  601 (605)
                      ||+|+++|++++++||+.|+|+++..
T Consensus       459 SG~Gre~G~~gl~~ft~~K~v~i~~g  484 (490)
T 2wme_A          459 SGVGRENGLTTLAHYTRIKSVQVELG  484 (490)
T ss_dssp             GEESCBSHHHHHHTTEEEEEEEEECS
T ss_pred             cccCchhHHHHHHHhhceeEEEEECC
Confidence            99999999999999999999997653



>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 605
d1o04a_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-80
d1o04a_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-78
d1bxsa_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 8e-79
d1bxsa_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 3e-75
d1a4sa_503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-72
d1a4sa_503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-67
d1wnda_474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 2e-63
d1wnda_474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 1e-55
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 7e-59
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 5e-57
d1ky8a_499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 3e-58
d1ky8a_499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 1e-41
d1ky8a_499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 3e-29
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-53
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-43
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 8e-21
d1euha_474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-47
d1euha_474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 6e-47
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 2e-26
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 4e-23
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 3e-13
d1ez0a_504 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 7e-24
d1ez0a_504 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-19
d1ez0a_504 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 5e-12
d1vlua_436 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 6e-10
d1vlua_436 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 6e-08
d1vlua_436 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 3e-07
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]
 Score =  259 bits (664), Expect = 2e-80
 Identities = 133/273 (48%), Positives = 172/273 (63%), Gaps = 21/273 (7%)

Query: 343 GIGRELGKA-ALDEYTELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICA 401
           G G   G A A  E  +    T S   +     I  AA +SNLKRV+LELGGKSP +I +
Sbjct: 217 GFGPTAGAAIASHEDVDKVAFTGS---TEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMS 273

Query: 402 DADVDMAYYY----------CFVCAGSRTYVQEDIYDTFVKKAVEKAAARKVGDPFDKSV 451
           DAD+D A                CAGSRT+VQEDIYD FV+++V +A +R VG+PFD   
Sbjct: 274 DADMDWAVEQAHFALFFNQGQCSCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKT 333

Query: 452 QQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKIAREE 511
           +QGPQVD   F K+L YI +G ++G KL  GG    D+GYFI+PTVF +V D   IA+EE
Sbjct: 334 EQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEE 393

Query: 512 IFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAG-------SAV 564
           IFGPV  I+KFKT++EV+ RAN++ YGLA+ + T ++D AN  + A+ AG          
Sbjct: 394 IFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVF 453

Query: 565 VPQAPFGGFKESGIGRELGKAALDEYTELKTVT 597
             Q+PFGG+K SG GRELG+  L  YTE+KTVT
Sbjct: 454 GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVT 486


>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 436 Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 436 Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 436 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query605
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 100.0
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 100.0
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 100.0
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 100.0
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 100.0
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 100.0
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 100.0
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 100.0
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 100.0
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 100.0
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 100.0
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 100.0
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 100.0
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 100.0
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 100.0
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 99.97
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 99.97
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 99.95
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 99.94
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 99.82
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 99.81
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 99.5
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Sheep (Ovis aries) [TaxId: 9940]
Probab=100.00  E-value=2.2e-60  Score=515.37  Aligned_cols=241  Identities=54%  Similarity=0.837  Sum_probs=226.9

Q ss_pred             ceeEEEecCCccccHHHHHHHHHhccccceeeecCCCCcEEEcCCCCHHHHH----------hcccccccCeEEEecccH
Q psy1099         358 ELKTVTESPLRSYTSHSIMAAAAASNLKRVSLELGGKSPLVICADADVDMAY----------YYCFVCAGSRTYVQEDIY  427 (605)
Q Consensus       358 ~~k~~t~s~~~~~~g~~v~~~~a~~~~~~~~lElgG~~p~iV~~dad~~~a~----------~~~~c~a~~~v~v~~~~~  427 (605)
                      +...||||.   .+|+.|.+.++..++||+++|||||||+||++|||++.|+          .|+.|++++|+|||++++
T Consensus       233 ~~i~fTGS~---~~g~~i~~~aa~~~~~~~~lElGG~np~iV~~dadl~~a~~~i~~~~~~~~GQ~C~a~~rv~V~~~~~  309 (494)
T d1bxsa_         233 DKVAFTGST---EVGKLIKEAAGKSNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIY  309 (494)
T ss_dssp             SEEEEESCH---HHHHHHHHHHHHTTCCEEEEECCCCCEEEECTTSCHHHHHHHHHHHHHTTTTCCTTCCCEEEEEHHHH
T ss_pred             CEEEecCCH---HHHHHHHHHhcccCCCeEEEEcCCcCcEEECcCcchhHhHHHHHHHHhcCCCcccccceEEecccchh
Confidence            445789985   9999999888765799999999999999999999999986          456699999999999999


Q ss_pred             HHHHHHHHHHHhhcccCCCCCCCCCCCcccCHHHHHHHHHHHHHHHHcCCeEEeCCcccCCCCeeEeeEEeecCCCCCcc
Q psy1099         428 DTFVKKAVEKAAARKVGDPFDKSVQQGPQVDAEMFTKVLNYIKSGVEQGGKLEAGGKRKGDKGYFIEPTVFSNVTDDFKI  507 (605)
Q Consensus       428 ~~~~~~l~~~~~~~~~g~~~~~~~~~gpli~~~~~~~~~~~i~~a~~~g~~v~~gg~~~~~~g~~~~Pti~~~~~~~~~~  507 (605)
                      |+|+++|++++.++++|+|.++++++||++++.+++++++++++++++|++++.||......|+|++|||+.++++++++
T Consensus       310 d~f~~~l~~~~~~~~~g~~~~~~~~~gpli~~~~~~~~~~~i~~a~~~Ga~~~~gg~~~~~~g~~~~Ptvl~~~~~~~~~  389 (494)
T d1bxsa_         310 DEFVRRSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSDVTDDMRI  389 (494)
T ss_dssp             HHHHHHHHHHHTCCCBSCTTSTTCCBCCCSCHHHHHHHHHHHHHHHHTTCEECSCCSEECSSSCEECCEEEESCCTTSHH
T ss_pred             HHHHHHHHhhhhheeeeccCCCCCcCCCcCCHHHHHHHHHHHHHHHHcCCEEEeCCCccCCCceeEcCEEEeCCCCCcHH
Confidence            99999999999999999999999999999999999999999999999999999999887788999999999999999999


Q ss_pred             cccceeeeeeeeEeeCCHHHHHHHhhcCCCCceEEEEcCCHHHHHHHHHHcccCcc-------cCCCCcccccCCCCCCC
Q psy1099         508 AREEIFGPVQTIIKFKTLDEVIERANDTKYGLASGIVTTNIDTANTFAHAINAGSA-------VVPQAPFGGFKESGIGR  580 (605)
Q Consensus       508 ~~eE~FGPvl~i~~~~~~~eai~~~n~~~~gL~a~vft~d~~~~~~~~~~~~~G~~-------~~~~~PfGG~~~SG~G~  580 (605)
                      ++||+||||++|++|+|++|||+++|+++|||+++|||+|.+.++++++++++|.+       ..+.+||||+|.||+|+
T Consensus       390 ~~~E~FGPvl~v~~~~~~~eai~~~n~~~~gL~a~i~t~d~~~~~~~~~~l~~G~v~iN~~~~~~~~~PfGG~~~SG~G~  469 (494)
T d1bxsa_         390 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNCYSVVSAQCPFGGFKMSGNGR  469 (494)
T ss_dssp             HHSCCCSSEEEEEEECCHHHHHHHHHCSSCCSEEEEECSBHHHHHHHHHHSCCSEEEESCCCCCCTTSCBCCSGGGEESC
T ss_pred             HhccccCceEEEEEECCHHHHHHHHhCCCCCCeEEEEeCCHHHHHHHHHhCCEeEEEEcCCCCcCCCCCcCccccccCCh
Confidence            99999999999999999999999999999999999999999999999999999983       33568999999999999


Q ss_pred             hhHHHHHHHhhhceEEEEcCC
Q psy1099         581 ELGKAALDEYTELKTVTESPL  601 (605)
Q Consensus       581 ~~g~~~~~~~~~~k~v~~~~~  601 (605)
                      ++|.+++++||+.|+|+++..
T Consensus       470 ~~g~~~~~~ft~~k~i~~~~~  490 (494)
T d1bxsa_         470 ELGEYGFHEYTEVKTVTIKIS  490 (494)
T ss_dssp             BSHHHHHHTTEEEEEEEEECS
T ss_pred             hhHHHHHHHhcceEEEEEecC
Confidence            999999999999999998764



>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure