Psyllid ID: psy11015


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MVESDPLKNFLKDLIRTHNMPQSDTMSQKSTKHKRTASGKLSNLGDQDLSMLRTHLNSEYDDVVLPSSVKFKLNSLFSQIEREFELLYLENLNLQDKIDMLMEKLDRESIINEKYPECNDMECVTNMNKNFNKQKVLASNPSAQKLKTTNKLKVQTSKIVSSFKTSLLSCYKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLPNKDLVLSASGDKSVHIWQAVINWECLVSNNDNDSDLDESKEPDESSITLRTPVKELLGHSNVVIAADWLSDGEQVITASWDRVANLFDVETGTILQSLTEPGEAIRAAAGRTGGPIRASPLLLAIRSK
cccccHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccccccEEEEEcccccccEEEEEEcccccEEEEEcccccccccEEEccccccccEEEEEEEEcccccEEEEEEcccccEEEEccccccEEEEcccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEcccccccEEEEEEccccccEEEccccEEEEcccccEEEEEEcccccEEEEccccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEccccccccc
cccccHccccHHHHccccccccccccccccccEEEcccccEEEEEEccccccccEcccccccEEEEcccccEEEEEEcccccEEEEEEccccEEEcccccEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEccccccEEEEEEEEEEcccccccEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEccccccccc
MVESDPLKNFLKDLIrthnmpqsdtmsqkstkhkrtasgklsnlgdqdLSMLRTHlnseyddvvlpssvkfkLNSLFSQIEREFELLYLENLNLQDKIDMLMEKLDRESiinekypecndmecVTNMNknfnkqkvlasnpsaqklkttnklkVQTSKIVSSFKTSLLSCYKIrsfsghrdgvwdvavrpgqpvlgsasadRTVRLWStqtgkcvlqysghsgsvnsvrflpnkdlvlsasgdksVHIWQAVINWEClvsnndndsdldeskepdessitlrtPVKELLGHSNVVIaadwlsdgeQVITASWDRVANLFDVETGTILQSLTEPGEAIRAAagrtggpirasPLLLAIRSK
MVESDPLKNFLKDlirthnmpqsdtmsqkstkhkrtasgklsnlgdqDLSMLRTHLNSEYDDVVLPSSVKFKLNSLFSQIEREFELLYLENLNLQDKIDMLMEKLDRESIINEKYPECNDMECVTNMNKNFNKQKVLasnpsaqklkttnklkvqtskivssfktslLSCYKIRSFSGHRDGVWDVAVRPGQpvlgsasadrtvRLWSTQTGKCVLQYSGHSGSVNSVRFLPNKDLVLSASGDKSVHIWQAVINWECLVSNNDNDSDLDESKEPDESSITLRTPVKELLGHSNVVIAADWLSDGEQVITASWDRVANLFDVETGTILQSLTEPGEAIRaaagrtggpirasplllairsk
MVESDPLKNFLKDLIRTHNMPQSDTMSQKSTKHKRTASGKLSNLGDQDLSMLRTHLNSEYDDVVLPSSVKFKLNSLFSQIEREFellylenlnlQDKIDMLMEKLDRESIINEKYPECNDMECVTNMNKNFNKQKVLASNPSAQKLKTTNKLKVQTSKIVSSFKTSLLSCYKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLPNKDLVLSASGDKSVHIWQAVINWECLVsnndndsdldesKEPDESSITLRTPVKELLGHSNVVIAADWLSDGEQVITASWDRVANLFDVETGTILQSLTEPGEAIRAAAGRTGGPIRASPLLLAIRSK
*****************************************************THLNSEYDDVVLPSSVKFKLNSLFSQIEREFELLYLENLNLQDKIDMLMEKLDRESIINEKYPECNDMECVTNMN*************************VQTSKIVSSFKTSLLSCYKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLPNKDLVLSASGDKSVHIWQAVINWECLVS************************VKELLGHSNVVIAADWLSDGEQVITASWDRVANLFDVETGTILQSLTE****************************
*******KNFL********************************LGDQDLSML*************PSSVKFKLNSLFSQIEREFELLYLENLNLQDK***************EKYPECNDMECVTNMNKNFNKQKVLASNPSAQKLKTTNKLKVQTSKIVSSFKTSLLSCYKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLPNKDLVLSASGDKSVHIWQAVINWECLVSNNDNDSDLDESKEPDESSITLRTPVKELLGHSNVVIAADWLSDGEQVITASWDRVANLFDVETGTILQSLTEPGEAIRAAAGRTGGPIRASPLLLAIR**
MVESDPLKNFLKDLIRTHNMP*****************GKLSNLGDQDLSMLRTHLNSEYDDVVLPSSVKFKLNSLFSQIEREFELLYLENLNLQDKIDMLMEKLDRESIINEKYPECNDMECVTNMNKNFNKQKVLASNPSAQKLKTTNKLKVQTSKIVSSFKTSLLSCYKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLPNKDLVLSASGDKSVHIWQAVINWECLVSNNDN*************SITLRTPVKELLGHSNVVIAADWLSDGEQVITASWDRVANLFDVETGTILQSLTEPGEAIRAAAGRTGGPIRASPLLLAIRSK
****DPLKNFLKDLIRTHNMPQSDTMSQKSTKHKRTASGKLSNLGDQDLSMLRTHLNSEYDDVVLPSSVKFKLNSLFSQIEREFELLYLENLNLQDKIDMLMEKLDRESIINEKYPECNDMECVTNMNKNFNKQKVLASNPSAQKLKTTNKLKVQTSKIVSSFKTSLLSCYKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLPNKDLVLSASGDKSVHIWQAVINWECLVSNNDNDSDLDESKEPDESSITLRTPVKELLGHSNVVIAADWLSDGEQVITASWDRVANLFDVETGTILQSLTEPGEAIRAAAGRTGGPIRASP********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVESDPLKNFLKDLIRTHNMPQSDTMSQKSTKHKRTASGKLSNLGDQDLSMLRTHLNSEYDDVVLPSSVKFKLNSLFSQIEREFELLYLENLNLQDKIDMLMEKLDRESIINEKYPECNDMECVTNMNKNFNKQKVLASNPSAQKLKTTNKLKVQTSKIVSSFKTSLLSCYKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLPNKDLVLSASGDKSVHIWQAVINWECLVSNNDNDSDLDESKEPDESSITLRTPVKELLGHSNVVIAADWLSDGEQVITASWDRVANLFDVETGTILQSLTEPGEAIRAAAGRTGGPIRASPLLLAIRSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query360 2.2.26 [Sep-21-2011]
Q8CBE3 496 WD repeat-containing prot yes N/A 0.719 0.522 0.460 1e-58
A4IIX9 494 WD repeat-containing prot yes N/A 0.788 0.574 0.439 2e-58
Q5R650 495 WD repeat-containing prot yes N/A 0.8 0.581 0.436 2e-58
Q9Y2I8 494 WD repeat-containing prot yes N/A 0.797 0.580 0.427 4e-58
Q6DDF0 495 WD repeat-containing prot N/A N/A 0.786 0.571 0.439 8e-58
B3S4I5409 Lissencephaly-1 homolog O N/A N/A 0.477 0.420 0.293 2e-15
Q00808 1356 Vegetative incompatibilit yes N/A 0.588 0.156 0.257 3e-15
Q8YRI11526 Uncharacterized WD repeat no N/A 0.630 0.148 0.272 5e-15
A0CH87 403 Lissencephaly-1 homolog 2 N/A N/A 0.377 0.337 0.292 5e-14
Q8YTC21258 Uncharacterized WD repeat no N/A 0.608 0.174 0.281 6e-14
>sp|Q8CBE3|WDR37_MOUSE WD repeat-containing protein 37 OS=Mus musculus GN=Wdr37 PE=2 SV=1 Back     alignment and function desciption
 Score =  226 bits (577), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 135/293 (46%), Positives = 176/293 (60%), Gaps = 34/293 (11%)

Query: 59  EYDDVVLPSSVKFKLNSLFSQIEREFELLYLENLNLQDKIDMLMEKLDRESIINEKYPEC 118
           E  D  LPSSV+  L  LF QIEREFE LY+ENL L+ +ID L E+L  E          
Sbjct: 44  EGQDSKLPSSVRSTLLELFGQIEREFENLYIENLELRREIDTLNERLAGEG--------- 94

Query: 119 NDMECVTNMNKNFNKQKVLASNPSAQ---KLKTTNKLKVQTSKIVSSFKT--SLLSCYKI 173
              + +     +  + K  AS+ ++Q   KLKTT   K  TSKIVSSFKT  S   C  +
Sbjct: 95  ---QAIDGAELSKGQLKTKASHSTSQLSQKLKTT--YKASTSKIVSSFKTTTSRAICQLV 149

Query: 174 RSFSGHRDGVWDVAVRPGQP-VLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLP 232
           + + GHRDG+WDV+V   QP VLG+ASAD T  LWS +TGKC+++Y+GH GSVNS++F P
Sbjct: 150 KEYIGHRDGIWDVSVTRTQPIVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHP 209

Query: 233 NKDLVLSASGDKSVHIWQAVINWECL-----VSNNDNDSDLDESKEPDESSI-------- 279
           ++ L L+ASGD++ HIW+ V+           S   +  D  E  + DE  I        
Sbjct: 210 SEQLALTASGDQTAHIWRYVVQLPTPQPVADTSQQISGEDEIECSDKDEPDIDGDVSSDC 269

Query: 280 -TLRTPVKELLGHSNVVIAADWLSDGEQVITASWDRVANLFDVETGTILQSLT 331
            T+R P+  L  H  VVIAADWL  G+QV+TASWDR ANL+DVET  ++ SLT
Sbjct: 270 PTVRVPLTSLKSHQGVVIAADWLVGGKQVVTASWDRTANLYDVETSELVHSLT 322





Mus musculus (taxid: 10090)
>sp|A4IIX9|WDR37_XENTR WD repeat-containing protein 37 OS=Xenopus tropicalis GN=wdr37 PE=2 SV=1 Back     alignment and function description
>sp|Q5R650|WDR37_PONAB WD repeat-containing protein 37 OS=Pongo abelii GN=WDR37 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y2I8|WDR37_HUMAN WD repeat-containing protein 37 OS=Homo sapiens GN=WDR37 PE=2 SV=2 Back     alignment and function description
>sp|Q6DDF0|WDR37_XENLA WD repeat-containing protein 37 OS=Xenopus laevis GN=wdr37 PE=2 SV=1 Back     alignment and function description
>sp|B3S4I5|LIS1_TRIAD Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 Back     alignment and function description
>sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=4 SV=1 Back     alignment and function description
>sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=4 SV=1 Back     alignment and function description
>sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 Back     alignment and function description
>sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
307183988 509 WD repeat-containing protein 37 [Campono 0.830 0.587 0.447 4e-76
383863272 507 PREDICTED: WD repeat-containing protein 0.772 0.548 0.505 2e-75
307199085 512 WD repeat-containing protein 37 [Harpegn 0.733 0.515 0.483 2e-74
357621111 466 hypothetical protein KGM_07136 [Danaus p 0.752 0.581 0.506 4e-74
322802316 471 hypothetical protein SINV_12250 [Solenop 0.705 0.539 0.477 5e-74
242018602 490 WD-repeat protein, putative [Pediculus h 0.755 0.555 0.506 7e-74
380021536 510 PREDICTED: WD repeat-containing protein 0.758 0.535 0.5 3e-73
328787768 510 PREDICTED: WD repeat-containing protein 0.783 0.552 0.484 4e-73
340724308 514 PREDICTED: WD repeat-containing protein 0.783 0.548 0.484 4e-73
350420808 515 PREDICTED: WD repeat-containing protein 0.783 0.547 0.478 5e-73
>gi|307183988|gb|EFN70559.1| WD repeat-containing protein 37 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  291 bits (744), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 155/346 (44%), Positives = 221/346 (63%), Gaps = 47/346 (13%)

Query: 21  PQSDTMSQKSTKHKRTASGKLSNLGDQDL-------------SMLRTHLNSEYDDVVLPS 67
           P + T ++ S K KR +  ++ +  D +L             ++      SE +D  +P 
Sbjct: 5   PSATTGNKSSGKAKRISIPRVQSSTDTELQSQQSGSTPLQPTALHYVSFRSELEDSPIPP 64

Query: 68  SVKFKLNSLFSQIEREFELLYLENLNLQDKIDMLMEKLDRESIINEK----------YPE 117
           +++ +L  LF QIE+EFE+LY ENL LQ+KID+L +KL+RE   + +          YPE
Sbjct: 65  TLRCRLYDLFQQIEKEFEMLYTENLGLQEKIDILNDKLERECYGSGERSLPPGDLTDYPE 124

Query: 118 CNDMECVTNMNKNFNKQKVLASNPSAQKLKTTNKLKVQTSKIVSSFKTSLLSCYKIRSFS 177
                      KN +KQK + +N SAQK+KT++KLK QTSKIVSSFKT  ++C   R + 
Sbjct: 125 ----------TKNLSKQKSMGAN-SAQKIKTSHKLKAQTSKIVSSFKTPSMTCTMQREYV 173

Query: 178 GHRDGVWDVAV-RPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLPNKDL 236
           GHRDGVW+++V R GQP++ +ASAD T R+W+  + +C+LQY GHSGSVNSVRF PN++L
Sbjct: 174 GHRDGVWEISVSRSGQPIIATASADHTARIWAIDSSRCLLQYIGHSGSVNSVRFHPNREL 233

Query: 237 VLSASGDKSVHIWQAVINW----------ECLVSNNDNDS--DLDESKEPDESSITLRTP 284
            LSASGD S H+WQA ++W          E  V++++  +  +L  + +  E   TLRTP
Sbjct: 234 ALSASGDGSAHVWQAAVDWDMPKRVPSLEELPVASSERSATNNLISTNDEQEDPPTLRTP 293

Query: 285 VKELLGHSNVVIAADWLSDGEQVITASWDRVANLFDVETGTILQSL 330
           ++ELLGHS+VV+AADWL   EQ++TASWDR ANL+D ETG I+ +L
Sbjct: 294 IRELLGHSSVVMAADWLCGAEQLVTASWDRTANLYDTETGEIIHTL 339




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383863272|ref|XP_003707105.1| PREDICTED: WD repeat-containing protein 37-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307199085|gb|EFN79795.1| WD repeat-containing protein 37 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|357621111|gb|EHJ73064.1| hypothetical protein KGM_07136 [Danaus plexippus] Back     alignment and taxonomy information
>gi|322802316|gb|EFZ22712.1| hypothetical protein SINV_12250 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|242018602|ref|XP_002429763.1| WD-repeat protein, putative [Pediculus humanus corporis] gi|212514775|gb|EEB17025.1| WD-repeat protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|380021536|ref|XP_003694619.1| PREDICTED: WD repeat-containing protein 37-like [Apis florea] Back     alignment and taxonomy information
>gi|328787768|ref|XP_394678.3| PREDICTED: WD repeat-containing protein 37-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340724308|ref|XP_003400524.1| PREDICTED: WD repeat-containing protein 37-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350420808|ref|XP_003492632.1| PREDICTED: WD repeat-containing protein 37-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
FB|FBgn0038617 487 CG12333 [Drosophila melanogast 0.541 0.400 0.487 2e-53
MGI|MGI:1920393 496 Wdr37 "WD repeat domain 37" [M 0.816 0.592 0.417 7.4e-50
ZFIN|ZDB-GENE-030131-8101 494 wdr37 "WD repeat domain 37" [D 0.836 0.609 0.383 2.6e-47
UNIPROTKB|B5DG67423 wdr12 "Ribosome biogenesis pro 0.433 0.368 0.343 2.7e-14
UNIPROTKB|I3L3N5208 PAFAH1B1 "Platelet-activating 0.430 0.745 0.291 4.8e-14
UNIPROTKB|B4DF38205 PAFAH1B1 "Platelet-activating 0.430 0.756 0.291 4.8e-14
UNIPROTKB|Q5BJ90423 wdr12 "Ribosome biogenesis pro 0.430 0.366 0.333 9.6e-13
ZFIN|ZDB-GENE-030131-371422 wdr12 "WD repeat domain 12" [D 0.411 0.350 0.339 1.6e-12
UNIPROTKB|Q5REE6423 WDR12 "Ribosome biogenesis pro 0.708 0.602 0.289 2.1e-12
UNIPROTKB|Q9GZL7423 WDR12 "Ribosome biogenesis pro 0.708 0.602 0.285 2.8e-12
FB|FBgn0038617 CG12333 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 502 (181.8 bits), Expect = 2.0e-53, Sum P(2) = 2.0e-53
 Identities = 98/201 (48%), Positives = 129/201 (64%)

Query:   137 LASNPSAQKLKTTNKLKVQTSKIVSSFKTSLLSCYKIRSFSGHRDGVWDVAVRPGQPVLG 196
             L+S     K K +NK+K QTS+IVSSFK   +    +R F GH+DG+W VA + GQP++G
Sbjct:   117 LSSATGGSKAKASNKIKAQTSRIVSSFKAPTVVSTVVREFGGHKDGIWQVAAKAGQPIIG 176

Query:   197 SASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLPNKDLVLSASGDKSVHIWQAVINWE 256
             +ASAD T  +W  ++ +C+LQY GH+GSVNS++F   +DLVL+ SGD + HIWQA +NWE
Sbjct:   177 TASADHTACIWGVESARCLLQYQGHAGSVNSIKFHQQRDLVLTGSGDGTAHIWQAAVNWE 236

Query:   257 CLVXXXXXXXXXXXXKEP--DESSI-TLRTPVKELLG---HSNVVIAADWLSDGEQVITA 310
                             E   D   + TLRTP+ E  G   H +VV+AADWLS  +Q+IT 
Sbjct:   237 VPKKGHSSEEELDDSDEQVEDRDRVDTLRTPLCEFTGPGGHLSVVVAADWLSSMDQIITG 296

Query:   311 SWDRVANLFDVETGTILQSLT 331
             SWDR A L+DVETG  LQ LT
Sbjct:   297 SWDRTAILWDVETGLPLQPLT 317


GO:0046331 "lateral inhibition" evidence=IMP
MGI|MGI:1920393 Wdr37 "WD repeat domain 37" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8101 wdr37 "WD repeat domain 37" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B5DG67 wdr12 "Ribosome biogenesis protein wdr12" [Salmo salar (taxid:8030)] Back     alignment and assigned GO terms
UNIPROTKB|I3L3N5 PAFAH1B1 "Platelet-activating factor acetylhydrolase IB subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DF38 PAFAH1B1 "Platelet-activating factor acetylhydrolase IB subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5BJ90 wdr12 "Ribosome biogenesis protein wdr12" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-371 wdr12 "WD repeat domain 12" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5REE6 WDR12 "Ribosome biogenesis protein WDR12" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GZL7 WDR12 "Ribosome biogenesis protein WDR12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-29
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-29
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-26
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 9e-25
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-24
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-14
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 9e-12
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 7e-11
smart0032040 smart00320, WD40, WD40 repeats 5e-09
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-08
smart0032040 smart00320, WD40, WD40 repeats 2e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-06
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-05
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-05
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-04
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 4e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 6e-04
smart0032040 smart00320, WD40, WD40 repeats 9e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  114 bits (287), Expect = 2e-29
 Identities = 54/195 (27%), Positives = 85/195 (43%), Gaps = 42/195 (21%)

Query: 161 SSFKTSLLSC--------------YKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRL 206
           S+  T L S                 +R+ +GH   V  VA  P   +L S+S D+T+++
Sbjct: 60  SADGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKV 119

Query: 207 WSTQTGKCVLQYSGHSGSVNSVRFLPNKDLVLSASGDKSVHIWQAVINWECLVSNNDNDS 266
           W  +TGKC+    GH+  VNSV F P+   V S+S D ++ +W                 
Sbjct: 120 WDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLW----------------- 162

Query: 267 DLDESKEPDESSITLRTPVKELLGHSNVVIAADWLSDGEQVITASWDRVANLFDVETGTI 326
           DL   K            V  L GH+  V +  +  DGE+++++S D    L+D+ TG  
Sbjct: 163 DLRTGK-----------CVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKC 211

Query: 327 LQSLTEPGEAIRAAA 341
           L +L      + + A
Sbjct: 212 LGTLRGHENGVNSVA 226


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 360
KOG0300|consensus 481 100.0
KOG0272|consensus459 100.0
KOG0272|consensus459 99.97
KOG0263|consensus707 99.97
KOG0271|consensus480 99.97
KOG0263|consensus 707 99.97
KOG0271|consensus 480 99.97
KOG0279|consensus315 99.96
KOG0286|consensus343 99.96
KOG0286|consensus343 99.96
KOG0279|consensus315 99.96
KOG0315|consensus311 99.95
KOG0266|consensus456 99.95
KOG0285|consensus 460 99.94
KOG0295|consensus406 99.94
KOG0285|consensus 460 99.94
KOG0276|consensus 794 99.94
KOG0291|consensus 893 99.94
KOG0645|consensus 312 99.94
KOG0273|consensus524 99.94
KOG0295|consensus406 99.93
KOG0273|consensus524 99.93
PTZ00421 493 coronin; Provisional 99.93
KOG0645|consensus312 99.93
KOG0319|consensus 775 99.93
KOG0284|consensus 464 99.92
KOG0284|consensus 464 99.92
KOG0266|consensus456 99.92
KOG0276|consensus 794 99.92
PTZ00420 568 coronin; Provisional 99.91
KOG0318|consensus 603 99.91
KOG0282|consensus503 99.91
KOG0296|consensus399 99.91
KOG0281|consensus 499 99.9
KOG0316|consensus307 99.9
KOG0316|consensus 307 99.9
KOG0283|consensus 712 99.9
KOG1407|consensus313 99.9
KOG0313|consensus423 99.9
KOG0650|consensus 733 99.9
KOG0265|consensus338 99.9
KOG0292|consensus 1202 99.9
KOG0643|consensus 327 99.9
KOG0643|consensus327 99.9
KOG0283|consensus 712 99.89
KOG0282|consensus 503 99.89
PTZ00421 493 coronin; Provisional 99.89
KOG0277|consensus311 99.89
KOG0292|consensus 1202 99.89
KOG0265|consensus338 99.89
KOG0274|consensus 537 99.89
KOG0281|consensus499 99.88
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 99.88
KOG0291|consensus 893 99.88
KOG0319|consensus 775 99.87
KOG0318|consensus 603 99.87
KOG0275|consensus 508 99.87
PLN00181793 protein SPA1-RELATED; Provisional 99.87
KOG0293|consensus519 99.87
KOG1407|consensus313 99.87
KOG0289|consensus506 99.86
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.86
KOG0296|consensus 399 99.86
KOG0288|consensus459 99.86
KOG0315|consensus 311 99.86
KOG0267|consensus 825 99.86
KOG0302|consensus440 99.85
KOG0289|consensus506 99.85
KOG0647|consensus347 99.85
KOG0264|consensus422 99.85
KOG0277|consensus311 99.85
KOG0306|consensus 888 99.85
PTZ00420 568 coronin; Provisional 99.85
KOG0275|consensus508 99.85
KOG0310|consensus 487 99.85
KOG0973|consensus 942 99.85
KOG0310|consensus 487 99.85
KOG0274|consensus537 99.85
KOG1446|consensus311 99.84
KOG0300|consensus481 99.84
KOG0308|consensus 735 99.84
KOG0264|consensus422 99.84
KOG2096|consensus420 99.84
KOG0269|consensus 839 99.84
KOG0640|consensus 430 99.84
KOG0973|consensus 942 99.84
PLN00181 793 protein SPA1-RELATED; Provisional 99.83
KOG0301|consensus 745 99.83
KOG0641|consensus350 99.83
KOG0302|consensus440 99.83
KOG1332|consensus299 99.83
KOG0278|consensus 334 99.82
KOG0640|consensus430 99.82
KOG0278|consensus334 99.82
KOG0772|consensus 641 99.82
KOG0294|consensus 362 99.82
KOG0303|consensus 472 99.82
KOG0305|consensus 484 99.82
KOG0305|consensus484 99.82
KOG0308|consensus 735 99.81
KOG0647|consensus 347 99.81
KOG0294|consensus362 99.81
KOG0267|consensus 825 99.81
KOG0646|consensus 476 99.8
KOG0772|consensus 641 99.8
KOG0301|consensus 745 99.8
KOG0313|consensus423 99.8
KOG0299|consensus 479 99.79
KOG1036|consensus323 99.79
KOG0639|consensus705 99.79
KOG4283|consensus 397 99.79
KOG1273|consensus 405 99.77
KOG0268|consensus 433 99.77
KOG1539|consensus 910 99.77
KOG0306|consensus 888 99.76
KOG0641|consensus350 99.76
KOG0293|consensus519 99.76
KOG1446|consensus 311 99.76
KOG0269|consensus 839 99.75
KOG0268|consensus433 99.74
KOG2055|consensus 514 99.74
KOG1332|consensus 299 99.74
KOG0270|consensus463 99.73
KOG0299|consensus479 99.73
KOG1009|consensus 434 99.72
KOG0642|consensus577 99.72
KOG4328|consensus 498 99.72
KOG1274|consensus 933 99.71
KOG2445|consensus361 99.7
KOG0646|consensus 476 99.7
KOG1063|consensus764 99.7
KOG0771|consensus398 99.69
KOG1274|consensus 933 99.69
KOG1034|consensus385 99.67
KOG1063|consensus 764 99.65
KOG1036|consensus 323 99.65
KOG2445|consensus 361 99.64
KOG0321|consensus 720 99.63
KOG0639|consensus705 99.63
KOG4328|consensus498 99.62
KOG2919|consensus406 99.62
KOG1009|consensus 434 99.62
KOG1445|consensus 1012 99.62
KOG4283|consensus397 99.61
KOG2048|consensus 691 99.6
KOG0288|consensus 459 99.6
KOG1408|consensus 1080 99.6
KOG0307|consensus 1049 99.59
KOG1007|consensus370 99.59
KOG0303|consensus 472 99.59
KOG2394|consensus 636 99.58
KOG2106|consensus 626 99.58
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.58
KOG1034|consensus 385 99.58
KOG0642|consensus 577 99.57
KOG1523|consensus 361 99.57
KOG4378|consensus 673 99.57
KOG0322|consensus323 99.57
KOG0644|consensus 1113 99.57
KOG1273|consensus 405 99.56
KOG2048|consensus 691 99.55
KOG0644|consensus 1113 99.55
KOG0290|consensus364 99.54
KOG1524|consensus 737 99.54
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.54
KOG1310|consensus 758 99.53
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.53
KOG0270|consensus463 99.53
KOG1523|consensus 361 99.53
KOG2055|consensus514 99.52
KOG1188|consensus 376 99.52
COG2319 466 FOG: WD40 repeat [General function prediction only 99.52
KOG1007|consensus370 99.52
KOG0321|consensus 720 99.52
KOG1538|consensus 1081 99.51
KOG1408|consensus 1080 99.5
KOG4378|consensus 673 99.5
KOG2106|consensus 626 99.49
KOG1445|consensus 1012 99.49
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.49
KOG0650|consensus733 99.48
KOG2110|consensus 391 99.45
KOG0649|consensus325 99.45
KOG2096|consensus420 99.44
KOG2394|consensus 636 99.43
KOG1188|consensus 376 99.42
KOG0649|consensus 325 99.41
KOG1272|consensus 545 99.4
KOG1539|consensus 910 99.4
PRK01742429 tolB translocation protein TolB; Provisional 99.39
KOG0290|consensus364 99.39
COG2319 466 FOG: WD40 repeat [General function prediction only 99.38
KOG1538|consensus 1081 99.37
KOG0307|consensus 1049 99.37
KOG2110|consensus 391 99.37
KOG4227|consensus 609 99.35
PRK05137435 tolB translocation protein TolB; Provisional 99.35
KOG1963|consensus 792 99.35
KOG2919|consensus 406 99.34
KOG2139|consensus445 99.34
KOG1240|consensus 1431 99.32
KOG1524|consensus 737 99.3
KOG0974|consensus 967 99.3
KOG3881|consensus412 99.29
KOG0974|consensus 967 99.28
KOG0322|consensus323 99.27
PRK02889427 tolB translocation protein TolB; Provisional 99.27
KOG2139|consensus 445 99.26
KOG2111|consensus346 99.26
PRK04922433 tolB translocation protein TolB; Provisional 99.26
PRK03629429 tolB translocation protein TolB; Provisional 99.25
KOG2321|consensus 703 99.24
PRK01742429 tolB translocation protein TolB; Provisional 99.24
KOG1517|consensus1387 99.22
KOG2111|consensus346 99.2
KOG1409|consensus404 99.2
KOG1587|consensus555 99.2
KOG1272|consensus 545 99.19
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.19
KOG3881|consensus412 99.18
PRK03629429 tolB translocation protein TolB; Provisional 99.15
KOG1517|consensus1387 99.13
KOG1963|consensus 792 99.13
KOG0771|consensus398 99.13
KOG1310|consensus 758 99.13
KOG4547|consensus 541 99.11
PRK04922433 tolB translocation protein TolB; Provisional 99.11
PRK00178430 tolB translocation protein TolB; Provisional 99.11
PRK05137435 tolB translocation protein TolB; Provisional 99.11
PRK11028 330 6-phosphogluconolactonase; Provisional 99.11
KOG1587|consensus555 99.1
PRK02889427 tolB translocation protein TolB; Provisional 99.08
PRK11028330 6-phosphogluconolactonase; Provisional 99.07
KOG4190|consensus1034 99.03
PRK04792448 tolB translocation protein TolB; Provisional 99.03
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.01
KOG0280|consensus339 99.0
KOG0280|consensus339 99.0
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.96
PRK01029428 tolB translocation protein TolB; Provisional 98.93
KOG1334|consensus 559 98.93
KOG4227|consensus 609 98.91
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.91
KOG2321|consensus 703 98.88
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.88
KOG3914|consensus 390 98.87
KOG2315|consensus 566 98.86
KOG2695|consensus425 98.85
KOG4547|consensus 541 98.82
KOG4497|consensus 447 98.82
KOG4497|consensus 447 98.79
PRK00178430 tolB translocation protein TolB; Provisional 98.79
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.78
PRK04792448 tolB translocation protein TolB; Provisional 98.76
PRK01029428 tolB translocation protein TolB; Provisional 98.76
KOG1354|consensus 433 98.74
KOG2315|consensus 566 98.74
KOG2066|consensus 846 98.73
KOG1064|consensus2439 98.73
KOG1334|consensus559 98.72
COG4946 668 Uncharacterized protein related to the periplasmic 98.68
KOG1240|consensus1431 98.61
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.61
KOG0309|consensus 1081 98.57
KOG4714|consensus319 98.56
PRK04043419 tolB translocation protein TolB; Provisional 98.53
KOG1064|consensus2439 98.52
KOG4532|consensus344 98.52
KOG1832|consensus 1516 98.52
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.49
COG4946 668 Uncharacterized protein related to the periplasmic 98.47
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.47
KOG1409|consensus404 98.46
KOG4532|consensus344 98.45
KOG1354|consensus433 98.45
KOG3914|consensus 390 98.43
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.41
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.41
KOG2041|consensus 1189 98.41
KOG4714|consensus319 98.4
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.4
KOG2314|consensus 698 98.4
KOG2041|consensus 1189 98.39
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.36
PRK04043419 tolB translocation protein TolB; Provisional 98.36
KOG1912|consensus 1062 98.35
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.35
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.35
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.33
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.27
KOG1275|consensus 1118 98.26
KOG2066|consensus 846 98.25
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.23
KOG2695|consensus425 98.22
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.21
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 98.21
KOG2314|consensus 698 98.14
KOG0309|consensus 1081 98.13
KOG0882|consensus 558 98.1
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.07
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.04
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.03
KOG1645|consensus463 98.01
KOG1920|consensus 1265 97.97
KOG3621|consensus 726 97.92
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 97.87
KOG1912|consensus 1062 97.86
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.84
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.82
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.78
KOG4640|consensus 665 97.77
KOG1645|consensus 463 97.76
KOG4190|consensus 1034 97.76
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.74
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.74
KOG0882|consensus 558 97.73
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.73
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.71
KOG4640|consensus 665 97.66
KOG2114|consensus 933 97.65
KOG4649|consensus 354 97.61
KOG3617|consensus 1416 97.6
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.59
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.55
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.52
PF15492 282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.48
KOG2395|consensus 644 97.45
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.39
KOG2114|consensus 933 97.37
KOG1275|consensus 1118 97.35
KOG1008|consensus 783 97.31
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.26
PRK02888 635 nitrous-oxide reductase; Validated 97.23
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.2
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 97.18
KOG1008|consensus 783 97.1
KOG3617|consensus 1416 97.06
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.99
PF08145260 BOP1NT: BOP1NT (NUC169) domain; InterPro: IPR01295 96.98
KOG4499|consensus310 96.95
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.95
PRK13616591 lipoprotein LpqB; Provisional 96.95
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.95
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.93
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.89
KOG1920|consensus 1265 96.86
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.84
KOG3621|consensus 726 96.76
KOG2079|consensus 1206 96.73
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.71
PRK02888 635 nitrous-oxide reductase; Validated 96.69
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.68
KOG2079|consensus 1206 96.61
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.55
COG3391 381 Uncharacterized conserved protein [Function unknow 96.54
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.37
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.28
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.15
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.14
KOG2444|consensus238 96.1
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.05
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 96.04
COG3391 381 Uncharacterized conserved protein [Function unknow 96.02
PRK13616591 lipoprotein LpqB; Provisional 95.98
KOG2444|consensus238 95.93
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.9
KOG1832|consensus 1516 95.81
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 95.68
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.68
KOG1916|consensus 1283 95.54
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 95.46
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.46
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.41
KOG4649|consensus 354 95.37
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.35
KOG3630|consensus 1405 95.35
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.31
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.26
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 95.19
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 95.11
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.03
PHA02713557 hypothetical protein; Provisional 94.99
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.95
PRK13684334 Ycf48-like protein; Provisional 94.83
KOG2395|consensus 644 94.7
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 94.34
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 94.24
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 94.04
KOG2247|consensus 615 93.78
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 93.65
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 93.61
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.29
PF10647 253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.23
PRK10115 686 protease 2; Provisional 93.12
PHA02713557 hypothetical protein; Provisional 93.07
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 93.03
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 92.93
KOG1916|consensus 1283 92.84
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 92.78
KOG2377|consensus 657 92.7
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 92.48
COG3386307 Gluconolactonase [Carbohydrate transport and metab 92.47
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 92.46
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 92.22
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 92.06
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 91.99
PLN00033398 photosystem II stability/assembly factor; Provisio 91.52
KOG4441|consensus571 91.49
COG5167 776 VID27 Protein involved in vacuole import and degra 91.25
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 91.18
PHA03098534 kelch-like protein; Provisional 91.1
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 90.97
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 90.73
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 90.48
PF13449326 Phytase-like: Esterase-like activity of phytase 90.38
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 90.02
KOG4441|consensus571 89.91
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 89.9
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 89.79
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 89.72
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 89.69
PF12768 281 Rax2: Cortical protein marker for cell polarity 89.62
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 89.15
KOG2280|consensus 829 88.43
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 87.94
PHA03098534 kelch-like protein; Provisional 87.85
PHA02790480 Kelch-like protein; Provisional 87.55
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 87.5
KOG4499|consensus310 87.32
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 87.11
PRK13684334 Ycf48-like protein; Provisional 86.87
PHA02790480 Kelch-like protein; Provisional 85.87
KOG4460|consensus 741 85.74
KOG3616|consensus 1636 85.59
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 85.26
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 84.99
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 84.45
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 84.26
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 83.56
KOG3630|consensus 1405 82.9
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 82.32
KOG2377|consensus 657 81.95
PRK10115 686 protease 2; Provisional 81.94
KOG1897|consensus 1096 81.89
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 81.41
>KOG0300|consensus Back     alignment and domain information
Probab=100.00  E-value=4.2e-38  Score=264.10  Aligned_cols=280  Identities=39%  Similarity=0.641  Sum_probs=228.8

Q ss_pred             ChhhHHHHHHHHHHHHHHHHHhHHhhhhHHHHHHHHh--hcccccccccccCCCCCCcchhhccccCcccccccccCCCc
Q psy11015         66 PSSVKFKLNSLFSQIEREFELLYLENLNLQDKIDMLM--EKLDRESIINEKYPECNDMECVTNMNKNFNKQKVLASNPSA  143 (360)
Q Consensus        66 ~~~~~~~l~~l~~~~e~e~~~l~~e~~~l~~~~~~l~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  143 (360)
                      ..++|+||.+||.+||+||+.||.||.+|+++++-+.  ++.+.+.+.....    ..+..    ....+.| .+....+
T Consensus        41 da~~RarL~~LFgqIErEFe~LY~EN~aL~~~~di~~~~~r~aaeGqA~~~a----~~~~~----G~qlk~K-~S~~t~q  111 (481)
T KOG0300|consen   41 DAPYRARLYQLFGQIEREFETLYAENCALQERADIVQLTARSAAEGQAANVA----AQEVF----GVQLKGK-SSRKTIQ  111 (481)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHHHhhHHHHHhhhhhhhhhhhhccccccchh----hhccc----ccccccc-cchhhhh
Confidence            4569999999999999999999999999999987665  3332222111000    00000    0111222 3345567


Q ss_pred             ccceeeeeeeecCCeEEEeeecCccceeeeeeeecCCCCEEEEEECCCCCEEEEEeCCCcEEEEECCCCeEEEEEeCCCc
Q psy11015        144 QKLKTTNKLKVQTSKIVSSFKTSLLSCYKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSG  223 (360)
Q Consensus       144 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~h~~~V~~l~~~~~~~~l~sgs~Dg~v~iwd~~~~~~~~~~~~h~~  223 (360)
                      +.++....+++.+++++++|+.....++++++|.||.++||.++.....+.+.++|.|.+.+||.+++|.|+.+|.||.+
T Consensus       112 ~~qKl~t~~ka~tsrivssFk~~t~~~~lvre~~GHkDGiW~Vaa~~tqpi~gtASADhTA~iWs~Esg~CL~~Y~GH~G  191 (481)
T KOG0300|consen  112 MGQKLRTALKAPTSRIVSSFKDGTVKFRLVRELEGHKDGIWHVAADSTQPICGTASADHTARIWSLESGACLATYTGHTG  191 (481)
T ss_pred             hhHHHHHhhcCCcchheeeecCCceeEeehhhhcccccceeeehhhcCCcceeecccccceeEEeeccccceeeeccccc
Confidence            78888999999999999999999999999999999999999999998888999999999999999999999999999999


Q ss_pred             CeEEEEEeeCCCEEEEEeCCCcEEEEEcccCeeEeeeCCCCCCCCCCC--C----------CCCCCccccccceeEeeCC
Q psy11015        224 SVNSVRFLPNKDLVLSASGDKSVHIWQAVINWECLVSNNDNDSDLDES--K----------EPDESSITLRTPVKELLGH  291 (360)
Q Consensus       224 ~v~~i~~~p~~~~l~s~s~d~~i~vwd~~~~~~~~~~~~~~~~~~~~~--~----------~~~~~~~~~~~~~~~~~~h  291 (360)
                      .|++|+|++.+.+++++++|++.+||....+++.+....+........  .          ...........|+..+.+|
T Consensus       192 SVNsikfh~s~~L~lTaSGD~taHIW~~av~~~vP~~~a~~~hSsEeE~e~sDe~~~d~d~~~~sD~~tiRvPl~~ltgH  271 (481)
T KOG0300|consen  192 SVNSIKFHNSGLLLLTASGDETAHIWKAAVNWEVPSNNAPSDHSSEEEEEHSDEHNRDTDSSEKSDGHTIRVPLMRLTGH  271 (481)
T ss_pred             ceeeEEeccccceEEEccCCcchHHHHHhhcCcCCCCCCCCCCCchhhhhcccccccccccccccCCceeeeeeeeeecc
Confidence            999999999999999999999999999887777766444422211111  0          0111223556789999999


Q ss_pred             CCcEEEEEEcCCCCEEEEEECCCcEEEEECCCCeEEEEEecCCCceEEEEEcCCCCEEEcccc
Q psy11015        292 SNVVIAADWLSDGEQVITASWDRVANLFDVETGTILQSLTEPGEAIRAAAGRTGGPIRASPLL  354 (360)
Q Consensus       292 ~~~v~~i~~sp~g~~l~tgs~dg~i~iwd~~~~~~~~~l~~h~~~v~~~~~~~~g~~las~~~  354 (360)
                      .+.|.++.|...|++++|+|+|++..+||+++|..++.+.+|...++.++-+|..++++|++.
T Consensus       272 ~~vV~a~dWL~gg~Q~vTaSWDRTAnlwDVEtge~v~~LtGHd~ELtHcstHptQrLVvTsSr  334 (481)
T KOG0300|consen  272 RAVVSACDWLAGGQQMVTASWDRTANLWDVETGEVVNILTGHDSELTHCSTHPTQRLVVTSSR  334 (481)
T ss_pred             ccceEehhhhcCcceeeeeeccccceeeeeccCceeccccCcchhccccccCCcceEEEEecc
Confidence            999999999999999999999999999999999999999999999999999999999998874



>KOG0272|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08145 BOP1NT: BOP1NT (NUC169) domain; InterPro: IPR012953 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 3e-14
2gnq_A336 Structure Of Wdr5 Length = 336 3e-14
2h9l_A329 Wdr5delta23 Length = 329 4e-14
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-14
2g99_A308 Structural Basis For The Specific Recognition Of Me 5e-14
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 5e-14
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-14
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 5e-14
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 5e-14
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 5e-14
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 5e-14
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 6e-14
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 6e-14
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 6e-14
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 6e-14
2g9a_A311 Structural Basis For The Specific Recognition Of Me 6e-14
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 7e-14
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 3e-13
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 1e-12
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 3e-10
1erj_A 393 Crystal Structure Of The C-Terminal Wd40 Domain Of 3e-08
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 5e-08
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 5e-08
3fm0_A 345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 7e-04
1nex_B 464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 5e-08
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 1e-07
1trj_A 314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 6e-04
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 1e-07
3izb_a 319 Localization Of The Small Subunit Ribosomal Protein 6e-04
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 1e-07
3rfg_A 319 Crystal Structure Of The Yeast Rack1 Dimer In Space 6e-04
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 1e-07
3jyv_R 313 Structure Of The 40s Rrna And Proteins And PE TRNA 6e-04
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-07
3rfh_A 319 Crystal Structure Of The Yeast Rack1 Dimer In Space 7e-04
3zey_7318 High-resolution Cryo-electron Microscopy Structure 2e-07
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 3e-07
3frx_A 319 Crystal Structure Of The Yeast Orthologue Of Rack1, 8e-04
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 5e-07
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 3e-06
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 3e-06
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 3e-06
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 3e-06
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 4e-06
1p22_A 435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 4e-06
3jpx_A 402 Eed: A Novel Histone Trimethyllysine Binder Within 6e-06
3jzn_A 366 Structure Of Eed In Apo Form Length = 366 7e-06
3iiw_A 365 Crystal Structure Of Eed In Complex With A Trimethy 7e-06
3iiy_A 365 Crystal Structure Of Eed In Complex With A Trimethy 8e-06
2qxv_A 361 Structural Basis Of Ezh2 Recognition By Eed Length 8e-06
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 1e-05
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 1e-05
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 2e-05
4aow_A 340 Crystal Structure Of The Human Rack1 Protein At A R 2e-04
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 3e-05
2zkq_a 317 Structure Of A Mammalian Ribosomal 40s Subunit With 2e-04
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 5e-05
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 5e-05
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 8e-05
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 8e-05
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 9e-05
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 9e-05
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 9e-05
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 2e-04
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 3e-04
2aq5_A 402 Crystal Structure Of Murine Coronin-1 Length = 402 5e-04
2b4e_A 402 Crystal Structure Of Murine Coronin-1: Monoclinic F 6e-04
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure

Iteration: 1

Score = 53.5 bits (127), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 47/201 (23%), Positives = 85/201 (42%), Gaps = 20/201 (9%) Query: 173 IRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLP 232 +++ GH + V+ P ++ S S D +VR+W +TGKC+ HS V++V F Sbjct: 122 LKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNR 181 Query: 233 NKDLVLSASGDKSVHIWQAVINWECL--VXXXXXXXXXXXXKEPDESSITLRT------- 283 + L++S+S D IW +CL + P+ I T Sbjct: 182 DGSLIVSSSYDGLCRIWDTASG-QCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKL 240 Query: 284 -------PVKELLGHSN---VVIAADWLSDGEQVITASWDRVANLFDVETGTILQSLTEP 333 +K GH N + A ++ G+ +++ S D + +++++T I+Q L Sbjct: 241 WDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH 300 Query: 334 GEAIRAAAGRTGGPIRASPLL 354 + + + A I AS L Sbjct: 301 TDVVISTACHPTENIIASAAL 321
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|3JPX|A Chain A, Eed: A Novel Histone Trimethyllysine Binder Within The Eed-Ezh2 Polycomb Complex Length = 402 Back     alignment and structure
>pdb|3JZN|A Chain A, Structure Of Eed In Apo Form Length = 366 Back     alignment and structure
>pdb|3IIW|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H3k27 Peptide Length = 365 Back     alignment and structure
>pdb|3IIY|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H1k26 Peptide Length = 365 Back     alignment and structure
>pdb|2QXV|A Chain A, Structural Basis Of Ezh2 Recognition By Eed Length = 361 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.97
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.97
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.97
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.97
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.96
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.96
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.96
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.96
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.96
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.96
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.96
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.96
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.96
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.96
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.95
2pm7_B297 Protein transport protein SEC13, protein transport 99.95
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.95
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.95
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.95
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.95
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.95
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.95
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.95
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.95
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.94
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.94
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.94
2pm7_B 297 Protein transport protein SEC13, protein transport 99.94
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.94
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.94
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.94
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.94
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.94
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.94
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.94
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.94
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.94
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.94
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.94
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.93
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.93
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.93
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.93
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.93
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.93
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.93
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.93
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.93
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.93
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.93
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.92
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.92
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.92
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.92
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.92
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.92
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.92
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.92
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.92
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.92
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.92
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 99.91
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.91
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.91
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.91
3jro_A 753 Fusion protein of protein transport protein SEC13 99.91
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.91
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.91
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.91
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.91
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.91
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.91
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.91
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.91
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.91
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.91
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.91
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.91
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.91
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.91
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.9
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.9
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.9
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.9
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.9
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.9
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.9
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.89
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 99.89
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.89
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.89
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.89
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.89
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.89
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.89
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.89
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.89
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.89
3jro_A 753 Fusion protein of protein transport protein SEC13 99.89
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.89
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.88
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.88
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.88
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.88
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.88
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.88
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.88
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.87
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.87
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.87
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.87
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.87
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.87
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.87
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.87
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.87
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.86
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.86
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.86
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.85
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.83
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.82
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.81
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.79
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.79
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.78
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.77
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.77
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.77
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.74
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.66
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.65
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.62
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.62
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.6
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.6
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.6
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.59
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.59
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.57
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.56
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.56
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 99.56
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.56
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.55
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.55
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.54
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.52
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.52
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.52
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.52
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.52
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.51
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.51
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.5
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.48
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.46
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.45
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.44
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.43
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.41
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.4
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.4
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 99.38
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 99.37
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.37
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.36
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 99.35
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.34
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.33
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.3
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.29
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.25
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.22
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.22
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.22
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.2
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.19
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.18
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.16
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.13
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 99.12
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 99.11
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.11
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.07
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.07
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.05
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.03
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.02
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.01
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.99
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.96
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.96
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.94
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.91
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.85
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.84
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.83
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.82
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 98.81
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.77
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.77
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 98.76
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 98.74
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.72
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.71
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.68
2qe8_A343 Uncharacterized protein; structural genomics, join 98.67
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.67
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.61
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.61
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 98.59
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.58
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.56
2qe8_A 343 Uncharacterized protein; structural genomics, join 98.56
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.56
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.55
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 98.47
2ece_A462 462AA long hypothetical selenium-binding protein; 98.39
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.39
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.34
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.34
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 98.33
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 98.3
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.29
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.27
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.23
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.2
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.16
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.09
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.07
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.02
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.01
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.95
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.95
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.94
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.93
2ece_A 462 462AA long hypothetical selenium-binding protein; 97.92
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.9
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.9
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 97.9
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 97.74
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.67
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 97.67
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.62
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.6
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.58
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 97.56
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.54
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.5
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.49
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.43
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.43
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.4
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 97.27
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 97.25
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.22
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 97.16
2p4o_A 306 Hypothetical protein; putative lactonase, structur 97.16
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.14
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.14
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.09
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.08
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.07
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.07
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.06
3v65_B386 Low-density lipoprotein receptor-related protein; 96.96
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 96.92
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.9
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.87
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.8
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 96.78
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.78
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.68
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.64
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 96.59
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 96.59
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.57
3kya_A 496 Putative phosphatase; structural genomics, joint c 96.57
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.54
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.5
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 96.39
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.29
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.25
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.25
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.24
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.22
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 96.19
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.15
2p4o_A 306 Hypothetical protein; putative lactonase, structur 96.09
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 95.99
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 95.98
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.96
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 95.86
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 95.82
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.82
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.8
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.69
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 95.66
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 95.5
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.46
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.45
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 95.28
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 94.93
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 94.8
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 94.42
3kya_A496 Putative phosphatase; structural genomics, joint c 94.32
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 94.03
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 93.92
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 93.83
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 93.49
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 93.23
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 93.23
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 93.11
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 93.04
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 92.36
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 92.31
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 92.18
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 92.1
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 91.96
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 91.86
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 91.8
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 91.57
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 91.53
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 90.33
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 90.3
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 90.12
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 89.82
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 89.56
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 89.26
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 89.04
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 88.94
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 87.39
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 87.23
3m48_A33 General control protein GCN4; leucine zipper, synt 86.94
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 86.72
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 86.5
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 85.85
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 85.56
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 84.71
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 84.2
1uo4_A34 General control protein GCN4; four helix bundle, c 84.11
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 84.1
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 83.79
2bni_A34 General control protein GCN4; four helix bundle, a 83.72
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 82.83
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 82.78
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 82.74
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 82.57
2xzh_A 365 Clathrin heavy chain 1; endocytosis, endocytosis i 82.07
2hy6_A34 General control protein GCN4; protein design, para 81.36
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 81.05
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 80.58
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 80.36
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 80.18
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=1.6e-28  Score=223.89  Aligned_cols=206  Identities=16%  Similarity=0.113  Sum_probs=159.5

Q ss_pred             eeecCCeEEEeeecCccce--eeeeeeecCCCCEEEEEECCCCCEEEEEeCCCcEEEEECCCCeEEEEEeCCCcCeEEEE
Q psy11015        152 LKVQTSKIVSSFKTSLLSC--YKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVR  229 (360)
Q Consensus       152 ~~~~~~~~~~~~~~~~~~~--~~~~~l~~h~~~V~~l~~~~~~~~l~sgs~Dg~v~iwd~~~~~~~~~~~~h~~~v~~i~  229 (360)
                      +.+...+.+.+|+......  .....+.+|.+.|++++|+|++++|++|+.|++|++||+.+++++..+.+|.+.|.+++
T Consensus        97 ~~~s~dg~v~lWd~~~~~~~~~~~~~~~~H~~~V~~v~~spdg~~l~sgs~d~~i~iwd~~~~~~~~~~~~h~~~V~~~~  176 (344)
T 4gqb_B           97 LVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVA  176 (344)
T ss_dssp             EEEETTSEEEEEEECTTSSCEEEEEEEECCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEE
T ss_pred             EEEECCCEEEEEeccCCCceeEeeccccCCCCCEEEEEECCCCCEEEEEeCCCeEEEEECCCCcEEEEEcCcCCceEEEE
Confidence            3455566667776654332  23345679999999999999999999999999999999999999999999999999999


Q ss_pred             EeeCCC-EEEEEeCCCcEEEEEcccCeeEeeeCCCCCCC--CC----------CCCCCCCC-----ccccccceeEeeCC
Q psy11015        230 FLPNKD-LVLSASGDKSVHIWQAVINWECLVSNNDNDSD--LD----------ESKEPDES-----SITLRTPVKELLGH  291 (360)
Q Consensus       230 ~~p~~~-~l~s~s~d~~i~vwd~~~~~~~~~~~~~~~~~--~~----------~~~~~~~~-----~~~~~~~~~~~~~h  291 (360)
                      |+|++. +|++|+.|++|++||++++.....+.......  ..          ......+.     ......++..+.+|
T Consensus       177 ~~~~~~~~l~s~s~D~~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~l~sg~~dg~v~~wd~~~~~~~~~~~~h  256 (344)
T 4gqb_B          177 ASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVH  256 (344)
T ss_dssp             ECSSCTTEEEEEETTSCEEEEETTSSSCEEECC----CCCEEEEEECSSCTTEEEEEETTSEEEEEESCC--CCEEEECC
T ss_pred             ecCCCCCceeeeccccccccccccccceeeeeecceeeccceeeeecCCCCcceEEeccCCcEEEEECCCCcEEEEEcCC
Confidence            999884 78999999999999999887655443221110  00          00011111     22345577889999


Q ss_pred             CCcEEEEEEcCCC-CEEEEEECCCcEEEEECCCCeEEEEEecCCCceEEEEEcCCCC-EEEcc-cccchh
Q psy11015        292 SNVVIAADWLSDG-EQVITASWDRVANLFDVETGTILQSLTEPGEAIRAAAGRTGGP-IRASP-LLLAIR  358 (360)
Q Consensus       292 ~~~v~~i~~sp~g-~~l~tgs~dg~i~iwd~~~~~~~~~l~~h~~~v~~~~~~~~g~-~las~-~~~~ir  358 (360)
                      ...|++++|+|+| ++|++|+.||+|+|||+.+++.+ .+.+|.+.|++++|+|+|. +++|+ .|+.|+
T Consensus       257 ~~~v~~v~fsp~g~~~lasgs~D~~i~vwd~~~~~~~-~~~~H~~~V~~v~~sp~~~~llas~s~D~~v~  325 (344)
T 4gqb_B          257 SQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELF-RSQAHRDFVRDATWSPLNHSLLTTVGWDHQVV  325 (344)
T ss_dssp             SSCEEEEEECSSSSCCEEEEETTSCEEEECTTCCEEE-EECCCSSCEEEEEECSSSTTEEEEEETTSCEE
T ss_pred             CCCEEEEEEccCCCeEEEEEeCCCeEEEEECCCCcEE-EEcCCCCCEEEEEEeCCCCeEEEEEcCCCeEE
Confidence            9999999999998 57999999999999999998765 5678999999999999885 67665 477765



>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 360
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-19
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-18
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-17
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-11
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-17
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-06
d1tbga_ 340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-05
d1tbga_ 340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-16
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.002
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-15
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-14
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-13
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 9e-08
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-14
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-07
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-07
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.003
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-13
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-11
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.002
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-13
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-11
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 8e-08
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.001
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.004
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-12
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-10
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.002
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.003
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 6e-12
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-09
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 8e-09
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 7e-07
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.002
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-12
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-09
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-07
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.002
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.002
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-12
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-11
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 5e-11
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-10
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-07
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-04
d1p22a2 293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.001
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-10
d1pgua1 325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 8e-05
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 8e-10
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 5e-06
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-09
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 6e-08
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 8e-04
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-07
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-05
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-04
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 5e-07
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 0.003
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 7e-06
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-04
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.004
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 1e-05
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-05
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-05
d1l0qa2 301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 1e-05
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 2e-04
d2p4oa1302 b.68.6.3 (A:4-305) Hypothetical protein All0351 ho 0.001
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 85.9 bits (211), Expect = 1e-19
 Identities = 32/151 (21%), Positives = 53/151 (35%), Gaps = 28/151 (18%)

Query: 170 CYKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVR 229
                S      G          P L S S D+T+++W   TG C++   GH   V  V 
Sbjct: 195 PESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVL 254

Query: 230 FLPNKDLVLSASGDKSVHIWQAVINWECLVSNNDNDSDLDESKEPDESSITLRTPVKELL 289
           F      +LS + DK++ +W                 D    +            +K L 
Sbjct: 255 FHSGGKFILSCADDKTLRVW-----------------DYKNKR-----------CMKTLN 286

Query: 290 GHSNVVIAADWLSDGEQVITASWDRVANLFD 320
            H + V + D+      V+T S D+   +++
Sbjct: 287 AHEHFVTSLDFHKTAPYVVTGSVDQTVKVWE 317


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Length = 302 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.96
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.95
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.95
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.94
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.93
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.93
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.91
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.9
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.9
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.89
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.89
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.88
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.88
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.88
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.88
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.87
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.86
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.85
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.84
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.84
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.84
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.81
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.8
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.78
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.77
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.76
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.74
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.67
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.61
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.6
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.54
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.51
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.49
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.48
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.48
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.43
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.38
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.38
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.38
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.27
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.23
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.21
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 99.17
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.02
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.96
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.77
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.72
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 98.46
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.44
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.44
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.41
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.28
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.23
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.19
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.13
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.12
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.1
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.02
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.02
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.99
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.9
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.88
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.75
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.75
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.56
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.35
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 97.25
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 97.14
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.84
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 94.76
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.16
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 94.08
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 94.06
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 93.77
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 93.75
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 93.56
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.28
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.11
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 92.36
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 92.28
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 91.62
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 91.25
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 90.17
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 88.74
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 88.7
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 87.24
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 86.65
d1v04a_ 340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 85.07
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 84.58
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 84.47
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 84.44
d1utca2 327 Clathrin heavy-chain terminal domain {Rat (Rattus 82.74
d1h6la_ 353 Thermostable phytase (3-phytase) {Bacillus amyloli 82.51
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 82.22
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 80.39
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.96  E-value=9.9e-28  Score=213.59  Aligned_cols=188  Identities=14%  Similarity=0.129  Sum_probs=143.8

Q ss_pred             eeeeeeecCCCCEEEEEECCCCCEEEEEeCCCcEEEEECCCCeEEEEEeCCCcCeEEEEEeeCCCEEEEEeCCCcEEEEE
Q psy11015        171 YKIRSFSGHRDGVWDVAVRPGQPVLGSASADRTVRLWSTQTGKCVLQYSGHSGSVNSVRFLPNKDLVLSASGDKSVHIWQ  250 (360)
Q Consensus       171 ~~~~~l~~h~~~V~~l~~~~~~~~l~sgs~Dg~v~iwd~~~~~~~~~~~~h~~~v~~i~~~p~~~~l~s~s~d~~i~vwd  250 (360)
                      +..++|+||++.|++|+|+|++++|+||+.||+|+|||+.+++.+..+.+|.+.|.+++|+|++.++++|+.|+.+++|+
T Consensus        46 ~~~~tL~GH~~~I~~l~~s~~~~~l~sgs~Dg~v~iWd~~~~~~~~~~~~~~~~v~~v~~~~~~~~l~~~~~d~~i~~~~  125 (340)
T d1tbga_          46 RTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYN  125 (340)
T ss_dssp             CEEEEECCCSSCEEEEEECTTSSEEEEEETTTEEEEEETTTTEEEEEEECSCSCEEEEEECTTSSEEEEEETTCCEEEEE
T ss_pred             eeeEEECCCCCCEEEEEECCCCCEEEEEECCCceeeeecccceeEEEEecccccEEeeEeeccceeeeeecccceeeccc
Confidence            35578999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             cccCeeEee----eCCC---------------------------------------------------CC--------CC
Q psy11015        251 AVINWECLV----SNND---------------------------------------------------ND--------SD  267 (360)
Q Consensus       251 ~~~~~~~~~----~~~~---------------------------------------------------~~--------~~  267 (360)
                      .........    ...+                                                   ..        ..
T Consensus       126 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d  205 (340)
T d1tbga_         126 LKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACD  205 (340)
T ss_dssp             SSSSCSCCCEEEEECCCSSCEEEEEEEETTEEEEEETTTEEEEEETTTTEEEEEEECCSSCEEEEEECTTSSEEEEEETT
T ss_pred             ccccccccccceecccccccccccccccccccccccccccccccccccccccccccccceeEeeeccccccceeEEeecC
Confidence            654311000    0000                                                   00        00


Q ss_pred             CC------------------------CCCCCC---------CCcc-----ccccceeEe--eCCCCcEEEEEEcCCCCEE
Q psy11015        268 LD------------------------ESKEPD---------ESSI-----TLRTPVKEL--LGHSNVVIAADWLSDGEQV  307 (360)
Q Consensus       268 ~~------------------------~~~~~~---------~~~~-----~~~~~~~~~--~~h~~~v~~i~~sp~g~~l  307 (360)
                      ..                        ....+.         +...     ........+  ..|...|.+++|+|+|++|
T Consensus       206 ~~v~i~d~~~~~~~~~~~~h~~~i~~v~~~p~~~~l~s~s~d~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~s~~~~~l  285 (340)
T d1tbga_         206 ASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLL  285 (340)
T ss_dssp             TEEEEEETTTTEEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCTTCCSCEEEEEECSSSCEE
T ss_pred             ceEEEEECCCCcEEEEEeCCCCCeEEEEECCCCCEEEEEeCCCeEEEEeecccccccccccccccCceEEEEECCCCCEE
Confidence            00                        000000         0000     000111222  2455678999999999999


Q ss_pred             EEEECCCcEEEEECCCCeEEEEEecCCCceEEEEEcCCCCEEEccc-ccchh
Q psy11015        308 ITASWDRVANLFDVETGTILQSLTEPGEAIRAAAGRTGGPIRASPL-LLAIR  358 (360)
Q Consensus       308 ~tgs~dg~i~iwd~~~~~~~~~l~~h~~~v~~~~~~~~g~~las~~-~~~ir  358 (360)
                      ++|+.||.|++||+.+++++.++.+|.++|++++|+|+|.+++|++ |+.||
T Consensus       286 ~~g~~dg~i~iwd~~~~~~~~~~~~H~~~V~~l~~s~d~~~l~s~s~Dg~v~  337 (340)
T d1tbga_         286 LAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLK  337 (340)
T ss_dssp             EEEETTSCEEEEETTTCCEEEEECCCSSCEEEEEECTTSSCEEEEETTSCEE
T ss_pred             EEEECCCEEEEEECCCCcEEEEEcCCCCCEEEEEEeCCCCEEEEEccCCEEE
Confidence            9999999999999999999999999999999999999999888765 66665



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure