Psyllid ID: psy11062


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MKILLLDQSNPIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKVTIEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFERSEYFVSVSEALPAKSQVRTTCTPLYVLVEGQCSLVCWSTLRLMTHSTLKSELNSPLGSNSFQLSILWYSIFLRTNTMQIYRQFWYLSQVIP
cEEEEccccccEEEEEEEccccccEEEEcccEEEEEccccccccccEEEEEEEEEEcccccEEEEEEEEEEEEccccccEEEEEEEEEEEccccccccEEEEEEEEEcccccccEEEEEEccccccccccEEEEccEEEEEEcccccccccccEEEEEEEEEcccccccEEEEEEEEEEEEcccccccccccEEEEEEcccccccEEEEEEccccccccccEEEEEEEEEEcccccEEEEEEcccccEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEc
ccccccccccEEEEEEEccccccEEEEEccccEEEEEcccccccccEEEEEEEEEccccccccEEEEEEEEEEccccccccccccEEEEEccccccccEEEEEEEEccccccccEEEEEEEccccccccEEEEEccccEEEEEcccccccccEEEEEEEEEcccccccccEEEEEEEEEEccccccccccccEEEEEEcccccccEEEEEEEEccccccccccccEEEEEEEEccccccEEEEEEEccccEEEEEEccccHHccccEEEEEEEcccccccc
mkillldqsnpirytihsgdpegyftldstTGVIRTAATLDHEVTGVLLLSVqassgspplysyaQVKVTIedrndnapefesttirlsvpesaalglplYTVVArdkdsgdngkiryhlasgnfgdsrlfavdqtsghlslskhldyetsqrHTIVVsatdqgdppmssnlTVLLEvqdvndnppvferseYFVSVsealpaksqvrttctplyVLVEGQCSLVCWSTLRLMTHSTlkselnsplgsnsfqLSILWYSIFLRTNTMQIYRQFWYLSQVIP
MKILLLDQSNPIrytihsgdpegyFTLDSTTGVIRTAATLDHEVTGVLLLSvqassgspplYSYAQVKVTIEDRNDNAPEFESTTirlsvpesaalgLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLSKHLDYETSQRHTIVVsatdqgdppMSSNLTVLLEVQDVNDNPPVFERSEYFVSVSealpaksqvrtTCTPLYVLVEGQCSLVCWSTLRLMTHSTLKSelnsplgsnsFQLSILWYSIFLRTNTMQIYRQFWYLSQVIP
MKILLLDQSNPIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKVTIEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFERSEYFVSVSEALPAKSQVRTTCTPLYVLVEGQCSLVCWSTLRLMTHSTLKSELNSPLGSNSFQLSILWYSIFLRTNTMQIYRQFWYLSQVIP
****LL**SNPIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSG*PPLYSYAQVKVTIE************TIRLSVPESAALGLPLYTVVARDKD*GDNGKIRYHLASGNFGDSRLFAVDQTSGHLSL**HLDY*******IV**************LTVLLEVQDVNDNPPVFERSEYFVSVSEALPAKSQVRTTCTPLYVLVEGQCSLVCWSTLRLMTHSTLKSELNSPLGSNSFQLSILWYSIFLRTNTMQIYRQFWYLSQV**
MKILLLDQSNPIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKVTIEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFERSEYFVSVSEALPAKSQVRTTCTPLYVLVEGQCSLVCWSTLRLMTHSTL*******LGSNSFQLSILWYSIFLRTNTMQIYRQFWYLSQVIP
MKILLLDQSNPIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKVTIEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFERSEYFVSVSEALPAKSQVRTTCTPLYVLVEGQCSLVCWSTLRLMTHSTLKSELNSPLGSNSFQLSILWYSIFLRTNTMQIYRQFWYLSQVIP
*****LDQSNPIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKVTIEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFERSEYFVSVSEALPAKSQVRTTCTPLYVLVEGQCSLVCWSTLRLMTHSTLKSELNSPLGSNSFQLSILWYSIFLRTNTMQIYRQFWYL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKILLLDQSNPIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKVTIEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFERSEYFVSVSEALPAKSQVRTTCTPLYVLVEGQCSLVCWSTLRLMTHSTLKSELNSPLGSNSFQLSILWYSIFLRTNTMQIYRQFWYLSQVIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query281 2.2.26 [Sep-21-2011]
Q24292 3503 Protein dachsous OS=Droso yes N/A 0.693 0.055 0.558 4e-62
Q8BNA6 4555 Protocadherin Fat 3 OS=Mu yes N/A 0.711 0.043 0.372 6e-30
Q9VW71 4705 Fat-like cadherin-related no N/A 0.658 0.039 0.389 6e-30
Q6V0I7 4981 Protocadherin Fat 4 OS=Ho yes N/A 0.690 0.038 0.370 7e-30
Q2PZL6 4981 Protocadherin Fat 4 OS=Mu no N/A 0.690 0.038 0.380 7e-30
Q14517 4588 Protocadherin Fat 1 OS=Ho no N/A 0.672 0.041 0.395 8e-29
Q8R508 4555 Protocadherin Fat 3 OS=Ra no N/A 0.711 0.043 0.362 1e-28
Q96JQ0 3298 Protocadherin-16 OS=Homo no N/A 0.690 0.058 0.365 5e-28
Q6V1P9 2916 Protocadherin-23 OS=Homo no N/A 0.733 0.070 0.379 6e-27
Q5F226 4351 Protocadherin Fat 2 OS=Mu no N/A 0.633 0.040 0.349 1e-26
>sp|Q24292|DS_DROME Protein dachsous OS=Drosophila melanogaster GN=ds PE=1 SV=3 Back     alignment and function desciption
 Score =  238 bits (607), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 110/197 (55%), Positives = 151/197 (76%), Gaps = 2/197 (1%)

Query: 11   PIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKVT 70
            P+RY+I+SGDP+GYF++++ +G IR A  LDHE    +LL++QA+ G PP+Y + QV + 
Sbjct: 808  PVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIE 867

Query: 71   IEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRL 130
            +ED NDNAPEFE++ +R+SVPESA LG PLY   A DKDSG +G++ Y L   +     L
Sbjct: 868  VEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKES--GKGL 925

Query: 131  FAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFER 190
            FA+D  SGHL LS+HLDYE+SQRHT++V+ATD G P +S+NLT+L++VQDVNDNPPVFE+
Sbjct: 926  FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEK 985

Query: 191  SEYFVSVSEALPAKSQV 207
             EY V+VSE+    +Q+
Sbjct: 986  DEYSVNVSESRSINAQI 1002




Involved in morphogenesis. May also be involved in cell adhesion.
Drosophila melanogaster (taxid: 7227)
>sp|Q8BNA6|FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus GN=Fat3 PE=1 SV=2 Back     alignment and function description
>sp|Q9VW71|FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster GN=kug PE=2 SV=2 Back     alignment and function description
>sp|Q6V0I7|FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens GN=FAT4 PE=1 SV=2 Back     alignment and function description
>sp|Q2PZL6|FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus GN=Fat4 PE=1 SV=2 Back     alignment and function description
>sp|Q14517|FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens GN=FAT1 PE=1 SV=2 Back     alignment and function description
>sp|Q8R508|FAT3_RAT Protocadherin Fat 3 OS=Rattus norvegicus GN=Fat3 PE=1 SV=1 Back     alignment and function description
>sp|Q96JQ0|PCD16_HUMAN Protocadherin-16 OS=Homo sapiens GN=DCHS1 PE=2 SV=1 Back     alignment and function description
>sp|Q6V1P9|PCD23_HUMAN Protocadherin-23 OS=Homo sapiens GN=DCHS2 PE=2 SV=1 Back     alignment and function description
>sp|Q5F226|FAT2_MOUSE Protocadherin Fat 2 OS=Mus musculus GN=Fat2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
195159445 1812 GL15349 [Drosophila persimilis] gi|19411 0.686 0.106 0.588 7e-65
198475184 3586 GA26057 [Drosophila pseudoobscura pseudo 0.686 0.053 0.583 2e-64
194758613 3563 GF14875 [Drosophila ananassae] gi|190615 0.693 0.054 0.583 1e-63
270006362 3474 dachsous [Tribolium castaneum] 0.708 0.057 0.572 1e-63
195032868 3594 GH10500 [Drosophila grimshawi] gi|193904 0.711 0.055 0.545 2e-63
195437548 3471 GK24627 [Drosophila willistoni] gi|19416 0.711 0.057 0.577 7e-63
195388388 3639 GJ19658 [Drosophila virilis] gi|19414931 0.711 0.054 0.531 4e-62
195118208 2980 GI18019 [Drosophila mojavensis] gi|19391 0.708 0.066 0.528 7e-62
195470324 3556 GE15963 [Drosophila yakuba] gi|194173559 0.686 0.054 0.567 1e-61
194853658 3556 GG24633 [Drosophila erecta] gi|190660069 0.693 0.054 0.558 1e-61
>gi|195159445|ref|XP_002020589.1| GL15349 [Drosophila persimilis] gi|194117539|gb|EDW39582.1| GL15349 [Drosophila persimilis] Back     alignment and taxonomy information
 Score =  253 bits (646), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 116/197 (58%), Positives = 155/197 (78%), Gaps = 4/197 (2%)

Query: 11   PIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKVT 70
            P+RY+I+SGDP+GYF ++  +G IR A  LDHE  G +LL++QA++G PP+Y + QV + 
Sbjct: 850  PVRYSIYSGDPDGYFGIEGGSGNIRIARPLDHEAKGQVLLNIQATAGEPPVYGHTQVNIE 909

Query: 71   IEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRL 130
            +ED NDNAPEFE++ +R+SVPE+A LG PLY   A DKDSG +G++ Y LA     + +L
Sbjct: 910  VEDVNDNAPEFEASLVRISVPENADLGAPLYAAHAHDKDSGSSGQVTYSLAR----ERQL 965

Query: 131  FAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFER 190
            FA+D  SGHL LS+HLDYETSQRHT+VV+ATD G PP+++NLT+L++VQDVNDNPPVFER
Sbjct: 966  FAIDPRSGHLVLSQHLDYETSQRHTLVVTATDGGVPPLATNLTILVDVQDVNDNPPVFER 1025

Query: 191  SEYFVSVSEALPAKSQV 207
             EY V+VSE+ P  SQ+
Sbjct: 1026 DEYAVNVSESRPVNSQI 1042




Source: Drosophila persimilis

Species: Drosophila persimilis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|198475184|ref|XP_002132853.1| GA26057 [Drosophila pseudoobscura pseudoobscura] gi|198138709|gb|EDY70255.1| GA26057 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|194758613|ref|XP_001961556.1| GF14875 [Drosophila ananassae] gi|190615253|gb|EDV30777.1| GF14875 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|270006362|gb|EFA02810.1| dachsous [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195032868|ref|XP_001988576.1| GH10500 [Drosophila grimshawi] gi|193904576|gb|EDW03443.1| GH10500 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195437548|ref|XP_002066702.1| GK24627 [Drosophila willistoni] gi|194162787|gb|EDW77688.1| GK24627 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195388388|ref|XP_002052862.1| GJ19658 [Drosophila virilis] gi|194149319|gb|EDW65017.1| GJ19658 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195118208|ref|XP_002003632.1| GI18019 [Drosophila mojavensis] gi|193914207|gb|EDW13074.1| GI18019 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195470324|ref|XP_002087458.1| GE15963 [Drosophila yakuba] gi|194173559|gb|EDW87170.1| GE15963 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194853658|ref|XP_001968202.1| GG24633 [Drosophila erecta] gi|190660069|gb|EDV57261.1| GG24633 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
FB|FBgn0000497 3503 ds "dachsous" [Drosophila mela 0.697 0.055 0.560 4.6e-57
UNIPROTKB|E1C566 2926 E1C566 "Uncharacterized protei 0.693 0.066 0.434 1.7e-38
UNIPROTKB|F1NB81 2475 F1NB81 "Uncharacterized protei 0.693 0.078 0.434 3.9e-38
WB|WBGene00019994 2779 cdh-1 [Caenorhabditis elegans 0.686 0.069 0.418 3.5e-33
ZFIN|ZDB-GENE-050208-41 3286 dchs1b "dachsous 1b (Drosophil 0.704 0.060 0.401 4.2e-33
RGD|1309878 3278 Dchs1 "dachsous 1 (Drosophila) 0.690 0.059 0.37 4.6e-30
UNIPROTKB|Q6V0I7 4981 FAT4 "Protocadherin Fat 4" [Ho 0.861 0.048 0.333 5e-30
MGI|MGI:2444314 4555 Fat3 "FAT tumor suppressor hom 0.711 0.043 0.372 5.8e-30
UNIPROTKB|E2R353 4591 FAT1 "Uncharacterized protein" 0.693 0.042 0.383 6e-30
UNIPROTKB|F6XXM1 5056 FAT1 "Uncharacterized protein" 0.693 0.038 0.383 7.4e-30
FB|FBgn0000497 ds "dachsous" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 605 (218.0 bits), Expect = 4.6e-57, P = 4.6e-57
 Identities = 111/198 (56%), Positives = 153/198 (77%)

Query:    10 NPIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKV 69
             +P+RY+I+SGDP+GYF++++ +G IR A  LDHE    +LL++QA+ G PP+Y + QV +
Sbjct:   807 SPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNI 866

Query:    70 TIEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSR 129
              +ED NDNAPEFE++ +R+SVPESA LG PLY   A DKDSG +G++ Y L   + G   
Sbjct:   867 EVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKES-GKG- 924

Query:   130 LFAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFE 189
             LFA+D  SGHL LS+HLDYE+SQRHT++V+ATD G P +S+NLT+L++VQDVNDNPPVFE
Sbjct:   925 LFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFE 984

Query:   190 RSEYFVSVSEALPAKSQV 207
             + EY V+VSE+    +Q+
Sbjct:   985 KDEYSVNVSESRSINAQI 1002


GO:0000904 "cell morphogenesis involved in differentiation" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
GO:0005886 "plasma membrane" evidence=ISS
GO:0018149 "peptide cross-linking" evidence=IPI
GO:0016021 "integral to membrane" evidence=TAS
GO:0004872 "receptor activity" evidence=ISS
GO:0007156 "homophilic cell adhesion" evidence=IEA;ISS
GO:0050839 "cell adhesion molecule binding" evidence=ISS;IDA
GO:0016339 "calcium-dependent cell-cell adhesion" evidence=ISS
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0004871 "signal transducer activity" evidence=NAS
GO:0042067 "establishment of ommatidial planar polarity" evidence=IMP;TAS
GO:0016318 "ommatidial rotation" evidence=TAS
GO:0001737 "establishment of imaginal disc-derived wing hair orientation" evidence=IMP;TAS
GO:0045317 "equator specification" evidence=IMP
GO:0045198 "establishment of epithelial cell apical/basal polarity" evidence=IMP
GO:0007164 "establishment of tissue polarity" evidence=NAS
GO:0001736 "establishment of planar polarity" evidence=IGI;IMP;TAS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0035222 "wing disc pattern formation" evidence=IMP
GO:0030010 "establishment of cell polarity" evidence=IMP
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0048592 "eye morphogenesis" evidence=IMP
GO:0016337 "cell-cell adhesion" evidence=IMP
GO:0035159 "regulation of tube length, open tracheal system" evidence=IMP
GO:0090176 "microtubule cytoskeleton organization involved in establishment of planar polarity" evidence=IMP
GO:0090175 "regulation of establishment of planar polarity" evidence=IGI
UNIPROTKB|E1C566 E1C566 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NB81 F1NB81 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00019994 cdh-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-41 dchs1b "dachsous 1b (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1309878 Dchs1 "dachsous 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6V0I7 FAT4 "Protocadherin Fat 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2444314 Fat3 "FAT tumor suppressor homolog 3 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R353 FAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6XXM1 FAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q24292DS_DROMENo assigned EC number0.55830.69390.0556yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 1e-32
smart0011281 smart00112, CA, Cadherin repeats 4e-28
pfam0002892 pfam00028, Cadherin, Cadherin domain 2e-21
smart0011281 smart00112, CA, Cadherin repeats 8e-21
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 1e-19
pfam0002892 pfam00028, Cadherin, Cadherin domain 3e-10
cd0003198 cd00031, CA_like, Cadherin repeat-like domain 0.004
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information
 Score =  115 bits (289), Expect = 1e-32
 Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 2/100 (2%)

Query: 85  TIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLSK 144
           +  +SVPE+A  G  + TV A D DSG+NG++ Y + SGN  +  LF++D ++G ++ +K
Sbjct: 1   SYEVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVSGN--EDGLFSIDPSTGEITTAK 58

Query: 145 HLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDN 184
            LD E    +T+ V+ATD G PP+SS  TV + V DVNDN
Sbjct: 59  PLDREEQSSYTLTVTATDGGGPPLSSTATVTITVLDVNDN 98


Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98

>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|206635 cd00031, CA_like, Cadherin repeat-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 281
KOG4289|consensus 2531 100.0
KOG4289|consensus 2531 100.0
KOG1219|consensus 4289 100.0
KOG1219|consensus 4289 100.0
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.97
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.94
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.79
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.72
KOG1834|consensus 952 99.69
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.6
KOG1834|consensus 952 99.57
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.34
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 97.36
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 97.09
TIGR0196599 VCBS_repeat VCBS repeat. This domain of about 100 96.56
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 96.52
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 96.5
TIGR0196599 VCBS_repeat VCBS repeat. This domain of about 100 95.73
PF13750158 Big_3_3: Bacterial Ig-like domain (group 3) 95.62
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 95.27
TIGR00845 928 caca sodium/calcium exchanger 1. This model is spe 91.5
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 87.7
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 85.51
TIGR03660137 T1SS_rpt_143 T1SS-143 repeat domain. This model re 81.13
>KOG4289|consensus Back     alignment and domain information
Probab=100.00  E-value=4.4e-41  Score=326.17  Aligned_cols=230  Identities=32%  Similarity=0.443  Sum_probs=214.3

Q ss_pred             CEEEEecCCCcEEEEEEe---CCCCceEEEECCccEEEECcCCCceeccEEEEEEEEE-eCCCCceeEEEEEEEEEecCC
Q psy11062          1 MKILLLDQSNPIRYTIHS---GDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQAS-SGSPPLYSYAQVKVTIEDRND   76 (281)
Q Consensus         1 ~~~~d~d~~~~l~Y~i~~---g~~~~~F~Id~~~G~i~~~~~LD~E~~~~~~l~v~a~-dg~~~~~~~~~v~i~V~dvNd   76 (281)
                      ++|.++| .++|.|++..   .-..++|+||+.+|.|++++.||||+...+.|.|.|. -+.|+.+++++|+|.|.|.||
T Consensus       186 v~A~~~~-a~rl~Ysm~al~dsRS~~lFslD~~sG~irta~~lDREt~e~HvlrVtA~d~~~P~~SAtttv~V~V~D~nD  264 (2531)
T KOG4289|consen  186 VKASDPD-AGRLYYSMVALFDSRSQNLFSLDPMSGAIRTAKSLDRETKETHVLRVTAQDHGDPRRSATTTVTVLVLDTND  264 (2531)
T ss_pred             EEecCCC-cCceEEEeeeccchhccccEeeccccccchhhhhhhhhhhheeEEEEEeeecCCCcccceeEEEEEEeecCC
Confidence            3567777 4789999984   2344899999999999999999999999999999999 478899999999999999999


Q ss_pred             CCCeeccCcEEEEEeCCCCCCceEEEEEEEeCCCCCCceEEEEEeeCCCCCceeeEEeCceeEEEEceecCccCcceEEE
Q psy11062         77 NAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLSKHLDYETSQRHTI  156 (281)
Q Consensus        77 ~~P~f~~~~~~~~v~En~~~gt~v~~v~a~D~D~g~~~~i~y~l~~~~~~~~~~F~id~~tG~i~~~~~LD~E~~~~y~l  156 (281)
                      |.|.|++..|..++.||.++|..|.+++|+|.|+++|+.+.|++.+|+  ....|.||+.+|.|+++.+||||+...|+|
T Consensus       265 hsPvFEq~~Y~e~lREn~evGy~vLtvrAtD~Dsp~Nani~Yrl~eg~--~~~~f~in~rSGvI~T~a~lDRE~~~~y~L  342 (2531)
T KOG4289|consen  265 HSPVFEQDEYREELRENLEVGYEVLTVRATDGDSPPNANIRYRLLEGN--AKNVFEINPRSGVISTRAPLDREELESYQL  342 (2531)
T ss_pred             CCcccchhHHHHHHhhccccCceEEEEEeccCCCCCCCceEEEecCCC--ccceeEEcCccceeeccCccCHHhhhheEE
Confidence            999999999999999999999999999999999999999999999974  678999999999999999999999999999


Q ss_pred             EEEEEECCCCCCeEEEEEEEEEEeCCCCCCeeeCCceEEEEeCCCCCCcEEEEEEeeEEEeecCccccEEEEEeecCCh
Q psy11062        157 VVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFERSEYFVSVSEALPAKSQVRTTCTPLYVLVEGQCSLVCWSTLRLMTH  235 (281)
Q Consensus       157 ~V~a~D~~~p~~~~~~~v~I~V~DvND~~P~f~~~~y~~~v~E~~~~gt~v~~v~A~~yd~d~g~~~~~~~~~~~~~~~  235 (281)
                      .|+|+|.|.++...++.|.|.|.|+|||+|+|....|.+.|.|+..++++|++|+|+  |.|-|.||.+-|++.+....
T Consensus       343 ~VeAsDqG~~pgp~Ta~V~itV~D~NDNaPqFse~~Yvvqv~Edvt~~avvlrV~At--DrD~g~Ng~VHYsi~Sgn~~  419 (2531)
T KOG4289|consen  343 DVEASDQGRPPGPRTAMVEITVEDENDNAPQFSEKRYVVQVREDVTPPAVVLRVTAT--DRDKGTNGKVHYSIASGNGR  419 (2531)
T ss_pred             EEEeccCCCCCCCceEEEEEEEEecCCCCccccccceEEEecccCCCCceEEEEEec--ccCCCcCceEEEEeeccCcc
Confidence            999999999988889999999999999999999999999999999999999999999  99999999999987665443



>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>TIGR01965 VCBS_repeat VCBS repeat Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>TIGR01965 VCBS_repeat VCBS repeat Back     alignment and domain information
>PF13750 Big_3_3: Bacterial Ig-like domain (group 3) Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>TIGR00845 caca sodium/calcium exchanger 1 Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>TIGR03660 T1SS_rpt_143 T1SS-143 repeat domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
2yst_A119 Solution Structure Of The Third Cadherin Domain Fro 1e-15
3q2v_A 550 Crystal Structure Of Mouse E-Cadherin Ectodomain Le 2e-15
3q2w_A 559 Crystal Structure Of Mouse N-Cadherin Ectodomain Le 7e-15
3mvs_A210 Structure Of The N-Terminus Of Cadherin 23 Length = 9e-15
3mvs_A210 Structure Of The N-Terminus Of Cadherin 23 Length = 3e-05
1edh_A226 E-Cadherin Domains 1 And 2 In Complex With Calcium 1e-14
2a62_A322 Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length 2e-14
2wcp_A214 Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length 2e-14
2wcp_A214 Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length 3e-05
4aqe_A214 Crystal Structure Of Deafness Associated Mutant Mou 2e-14
4aqe_A214 Crystal Structure Of Deafness Associated Mutant Mou 3e-05
2wd0_A214 Crystal Structure Of Nonsyndromic Deafness (Dfnb12) 1e-13
2wd0_A214 Crystal Structure Of Nonsyndromic Deafness (Dfnb12) 2e-04
1l3w_A 546 C-Cadherin Ectodomain Length = 546 2e-13
1q55_A 880 W-Shaped Trans Interactions Of Cadherins Model Base 3e-13
3ubh_A419 Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le 6e-13
1ff5_A219 Structure Of E-Cadherin Double Domain Length = 219 1e-12
2ee0_A114 Solution Structures Of The Ca Domain Of Human Proto 1e-10
1q1p_A212 E-Cadherin Activation Length = 212 3e-10
3lni_A213 Crystal Structure Of E-Cadherin Ec12 E89a Length = 3e-10
2qvf_B213 Mouse E-cadherin Domains 1,2 Length = 213 3e-10
3qrb_A213 Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt 3e-10
3lne_A213 Crystal Structure Of E-Cadherin Ec12 K14e Length = 3e-10
3lng_A215 Crystal Structure Of E-Cadherin Ec12 Aa Extension L 4e-10
3lnh_A213 Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 5e-10
3lnf_A213 Crystal Structure Of E-Cadherin Ec12 K14ew2a Length 5e-10
3q2l_A213 Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 6e-10
3q2n_A213 Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 1e-09
1ncj_A215 N-Cadherin, Two-Domain Fragment Length = 215 1e-09
2o72_A213 Crystal Structure Analysis Of Human E-Cadherin (1-2 1e-09
2o72_A213 Crystal Structure Analysis Of Human E-Cadherin (1-2 3e-04
2qvi_A215 Crystal Structure Of N-Cadherin Domains Ec12 Length 2e-09
2a4e_A215 Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length 4e-09
2a4e_A215 Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length 8e-09
3lnd_A207 Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 7e-09
3lnd_A207 Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 3e-07
4apx_B242 Crystal Structure Of Mouse Cadherin-23 Ec1-2 And Pr 5e-07
3ubf_A316 Crystal Structure Of Drosophila N-Cadherin Ec1-3, I 8e-07
3ppe_A203 Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng 3e-06
1suh_A146 Amino-Terminal Domain Of Epithelial Cadherin In The 9e-06
3k5r_A218 Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt 1e-04
3k5r_A218 Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt 5e-04
3k5s_A217 Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len 3e-04
>pdb|2YST|A Chain A, Solution Structure Of The Third Cadherin Domain From Human Protocadherin 7 Length = 119 Back     alignment and structure

Iteration: 1

Score = 79.7 bits (195), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 42/112 (37%), Positives = 61/112 (54%) Query: 75 NDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVD 134 NDN+P FE + + E++A G P+ + A D D G NG+I Y + RL +D Sbjct: 8 NDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAATESVRRLLRLD 67 Query: 135 QTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPP 186 +TSG LS+ +D E + V A D+G PP + TV+L ++D NDN P Sbjct: 68 ETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVP 119
>pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 Back     alignment and structure
>pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 Back     alignment and structure
>pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 Back     alignment and structure
>pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 Back     alignment and structure
>pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 Back     alignment and structure
>pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 Back     alignment and structure
>pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 Back     alignment and structure
>pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 Back     alignment and structure
>pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 Back     alignment and structure
>pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 Back     alignment and structure
>pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 Back     alignment and structure
>pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 Back     alignment and structure
>pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 Back     alignment and structure
>pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 Back     alignment and structure
>pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 Back     alignment and structure
>pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 Back     alignment and structure
>pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 Back     alignment and structure
>pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 Back     alignment and structure
>pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 Back     alignment and structure
>pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 Back     alignment and structure
>pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 Back     alignment and structure
>pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 Back     alignment and structure
>pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 Back     alignment and structure
>pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 Back     alignment and structure
>pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 Back     alignment and structure
>pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 Back     alignment and structure
>pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 Back     alignment and structure
>pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 Back     alignment and structure
>pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 Back     alignment and structure
>pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 Back     alignment and structure
>pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 Back     alignment and structure
>pdb|4APX|B Chain B, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And Protocadherin-15 Ec1-2 Form I Length = 242 Back     alignment and structure
>pdb|3UBF|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-3, I Length = 316 Back     alignment and structure
>pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 Back     alignment and structure
>pdb|1SUH|A Chain A, Amino-Terminal Domain Of Epithelial Cadherin In The Calcium Bound State, Nmr, 20 Structures Length = 146 Back     alignment and structure
>pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 Back     alignment and structure
>pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 Back     alignment and structure
>pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 2e-57
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 2e-41
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 7e-57
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 1e-45
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 3e-29
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 7e-57
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 5e-53
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 3e-49
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 7e-48
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 5e-29
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 6e-56
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 4e-53
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 6e-49
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 8e-43
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-31
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 1e-55
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 5e-53
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 1e-51
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 4e-45
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-30
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-55
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 7e-51
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-48
1q55_A880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-41
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-34
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 4e-21
1q55_A880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-08
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-07
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 8e-54
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 3e-50
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 4e-26
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 5e-17
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 3e-53
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 4e-49
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 5e-47
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 4e-27
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 5e-09
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 1e-51
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 4e-32
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 3e-16
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 4e-50
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 9e-34
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 4e-48
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 2e-34
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 2e-47
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 2e-22
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 3e-47
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 2e-34
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 4e-46
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 2e-32
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 9e-45
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 5e-34
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 2e-43
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 4e-17
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 5e-08
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 1e-34
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 1e-08
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 5e-08
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 3e-31
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 9e-20
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 2e-27
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 4e-19
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 1e-22
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 8e-12
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 4e-22
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 3e-12
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 1e-21
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 1e-12
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 4e-19
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 3e-12
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 1e-17
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 8e-12
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 7e-17
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 4e-12
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 9e-09
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 4e-06
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 3e-05
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
 Score =  182 bits (463), Expect = 2e-57
 Identities = 47/175 (26%), Positives = 82/175 (46%), Gaps = 7/175 (4%)

Query: 11  PIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKVT 70
           P+ + +   +   +F ++  TGV+     LD E      +    S          +V + 
Sbjct: 41  PLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGV--ITRKVNIQ 98

Query: 71  IEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRL 130
           + D NDNAP F +    + +PE+  +G P++ V A D D G  G + Y         S  
Sbjct: 99  VGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQP----PSPF 154

Query: 131 FAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDP-PMSSNLTVLLEVQDVNDN 184
           FA+D   G +++ + LDYE +Q + + V+ATDQ    P+S+   + + + D+ D 
Sbjct: 155 FAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDM 209


>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Length = 125 Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Length = 125 Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Length = 103 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 100.0
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 100.0
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 100.0
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 100.0
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 100.0
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 100.0
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 100.0
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 100.0
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 100.0
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 100.0
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 100.0
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 100.0
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 100.0
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 100.0
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 100.0
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 100.0
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 100.0
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 100.0
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 100.0
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 100.0
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 100.0
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.97
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.97
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.97
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.96
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.96
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.96
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.95
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.95
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.95
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.95
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.94
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.91
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.9
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.87
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.81
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.79
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.78
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.76
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.75
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.74
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.73
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.67
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.66
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.6
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.57
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.52
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.45
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.45
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.4
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.4
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.38
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.37
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.36
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.09
2yhg_A437 SDE_182CT, cellulose-binding protein; hydrolase, g 92.78
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 90.35
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 90.23
3rb5_A298 Na/Ca exchange protein; CBD12, calcium binding and 89.49
2kpn_A103 Bacillolysin; solution structure, BIG_3 domain, PF 82.39
2yrl_A102 KIAA1837 protein; PKD domain, NPPSFA, national pro 81.74
3ead_A137 Na/Ca exchange protein; CBD1, calcium regulation, 80.4
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=2.6e-47  Score=341.50  Aligned_cols=262  Identities=24%  Similarity=0.348  Sum_probs=223.3

Q ss_pred             EEecC-CCcEEEEEEeCCCCceEEEECCccEEEECcCCCceeccEEEEEEEEEeCC--CCceeEEEEEEEEEecCCCCCe
Q psy11062          4 LLLDQ-SNPIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGS--PPLYSYAQVKVTIEDRNDNAPE   80 (281)
Q Consensus         4 ~d~d~-~~~l~Y~i~~g~~~~~F~Id~~~G~i~~~~~LD~E~~~~~~l~v~a~dg~--~~~~~~~~v~i~V~dvNd~~P~   80 (281)
                      +|.|. ++.++|+|.++...++|+|++.+|.|++.++||||+...|.|.|.|+|+.  +++++++.+.|.|.|+|||+|.
T Consensus        26 ~D~D~g~~~i~Y~l~~~~~~~~F~Id~~tG~i~~~~~LDrE~~~~y~l~v~a~D~~~~~~~~~~~~v~I~V~DvNDn~P~  105 (322)
T 2a62_A           26 TDLDPGSKKIKYILSGDGAGTIFQINDITGDIHAIKRLDREEKAEYTLTAQAVDFETNKPLEPPSEFIIKVQDINDNAPE  105 (322)
T ss_dssp             CCCCCSSCCCEEEEEETTBTTTEEEETTTTEEEECSCCCTTTCSBCCEEEEEECTTTCSEEEEEEEECEECCCCSCSCBC
T ss_pred             EcCCCCCCEEEEEEECCCCCCcEEEeCCcCEEEEeccCCcccccEEEEEEEEEECCCCCcccceEEEEEEEEecCCCCCc
Confidence            45554 47899999876556789999999999999999999999999999999754  3467788999999999999999


Q ss_pred             eccCcEEEEEeCCCCCCceEEEEEEEeCCC---CCCceEEEEEeeCCCCCceeeEEeCceeEEEEc-eecCccCcceEEE
Q psy11062         81 FESTTIRLSVPESAALGLPLYTVVARDKDS---GDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLS-KHLDYETSQRHTI  156 (281)
Q Consensus        81 f~~~~~~~~v~En~~~gt~v~~v~a~D~D~---g~~~~i~y~l~~~~~~~~~~F~id~~tG~i~~~-~~LD~E~~~~y~l  156 (281)
                      |....|.+.|+|+.++|+.++++.|+|+|.   |.|+.++|+|..+    ...|.|++.+|.|++. ++||||....|.|
T Consensus       106 F~~~~y~~~v~E~~~~gt~v~~v~A~D~D~~~~G~n~~i~Y~i~~~----~~~F~Id~~tG~i~~~~~~LD~E~~~~y~l  181 (322)
T 2a62_A          106 FLNGPYHATVPEMSILGTSVTNVTATDADDPVYGNSAKLVYSILEG----QPYFSIEPETAIIKTALPNMDREAKEEYLV  181 (322)
T ss_dssp             CSSSEEEEEECSSCCTTCBCCCCCCCBCSCSSSTTSSCEEEEEEEC----TTTEEECTTTCCEEECSSCCCGGGCSEEEE
T ss_pred             cCCCceEEEEeCCCCCCCEEEEEEEEeCCCCCCCccEEEEEEEccC----CCCEEEecCCCEEEecccCCCcccCCeEEE
Confidence            999999999999999999999999999995   7889999999985    3589999999999998 8999999999999


Q ss_pred             EEEEEECCCCC--CeEEEEEEEEEEeCCCCCCeeeCCceEEEEeCCCCCCcEEEEEEeeEEEeecCccccEEEEEeecCC
Q psy11062        157 VVSATDQGDPP--MSSNLTVLLEVQDVNDNPPVFERSEYFVSVSEALPAKSQVRTTCTPLYVLVEGQCSLVCWSTLRLMT  234 (281)
Q Consensus       157 ~V~a~D~~~p~--~~~~~~v~I~V~DvND~~P~f~~~~y~~~v~E~~~~gt~v~~v~A~~yd~d~g~~~~~~~~~~~~~~  234 (281)
                      .|+|+|++.|+  ++++++|+|.|.|+|||+|.|.+..|.+.|+|+.++|+.|++|.|+  |.|.|.|+.+.|++.....
T Consensus       182 ~V~a~D~g~p~~~~s~~~~v~I~V~DvNDn~P~F~~~~y~~~v~En~~~gt~v~~v~A~--D~D~g~n~~i~Y~i~~g~~  259 (322)
T 2a62_A          182 VIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPEDVVLGTAIGRVKAN--DQDIGENAQSSYDIIDGDG  259 (322)
T ss_dssp             EEEEEESCSSSSCCBCCEEEEEEECCCCCCCCCCSCSEEEEEECSCCSSCCEEEEEECC--CSSCGGGTCCEEEEC---C
T ss_pred             EEEEEECCCCCCCceeEEEEEEEEEecCCCCCeecCCCceeEeECCCCCCcEEEEEEEE--eCCCCCCceEEEEEECCCC
Confidence            99999999874  8899999999999999999999999999999999999999999999  9999999999999876433


Q ss_pred             h--hhhh-----ccCCCCCCCCcceEEEEEEEEEEecCcceeee
Q psy11062        235 H--STLK-----SELNSPLGSNSFQLSILWYSIFLRTNTMQIYR  271 (281)
Q Consensus       235 ~--~~l~-----~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~  271 (281)
                      .  +.++     ..|...+.+..-.-....|+|.|++.++-..+
T Consensus       260 ~~~F~I~~d~~~~tG~i~~~~~LD~E~~~~y~l~V~A~D~g~pp  303 (322)
T 2a62_A          260 TALFEITSDAQAQDGVIRLRKPLDFETKKSYTLKVEAANIHIDP  303 (322)
T ss_dssp             CSSBCCBCCTTTSEEEEEBCSCCCCSSCCEEEEEEEEECCCSSC
T ss_pred             CCcEEEeccCCCceEEEEECCcCCcccCCeEEEEEEEEECCCCC
Confidence            3  3333     12333333333223456799999987765544



>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>3rb5_A Na/Ca exchange protein; CBD12, calcium binding and regulation, metal binding protein; 2.35A {Drosophila melanogaster} PDB: 3rb7_A 3e9u_A Back     alignment and structure
>2kpn_A Bacillolysin; solution structure, BIG_3 domain, PF07523, PSI BIG-open NESG, cell WALL, hydrolase, peptidoglycan-anchor; NMR {Bacillus cereus atcc 14579} Back     alignment and structure
>2yrl_A KIAA1837 protein; PKD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ead_A Na/Ca exchange protein; CBD1, calcium regulation, membrane, transmembrane, membrane; 2.25A {Drosophila melanogaster} SCOP: b.1.27.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 281
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 2e-19
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 1e-07
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 0.004
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 7e-18
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 4e-07
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 1e-17
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 1e-04
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 4e-04
d1l3wa1100 b.1.6.1 (A:1-100) C-cadherin ectodomain {African c 4e-17
d1l3wa1100 b.1.6.1 (A:1-100) C-cadherin ectodomain {African c 1e-07
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 6e-16
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 1e-04
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 3e-04
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 7e-15
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 1e-06
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 1e-14
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 1e-04
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 5e-14
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 8e-04
d1l3wa5107 b.1.6.1 (A:434-540) C-cadherin ectodomain {African 5e-11
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 2e-10
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]
 Score = 79.3 bits (194), Expect = 2e-19
 Identities = 27/110 (24%), Positives = 52/110 (47%), Gaps = 7/110 (6%)

Query: 76  DNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQ 135
           + AP F     R+ V E  + G  + ++VA+D D     K+ Y + +          V++
Sbjct: 1   NEAPFFVPAVSRVDVSEDLSRGEKIISLVAQDPDKQQIQKLSYFIGNDPAR---WLTVNK 57

Query: 136 TSGHLSLSKHLDYETSQ----RHTIVVSATDQGDPPMSSNLTVLLEVQDV 181
            +G ++ + +LD E+       +T+++  TD G    +   T++L V DV
Sbjct: 58  DNGIVTGNGNLDRESEYVKNNTYTVIMLVTDDGVSVGTGTGTLILHVLDV 107


>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.87
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.87
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.86
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.83
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.82
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.78
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.7
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.65
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.62
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.62
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.25
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.24
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.23
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.23
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.17
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.16
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.14
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 98.9
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 98.71
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 98.67
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 88.4
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 84.72
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 80.77
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: E-cadherin (epithelial)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.87  E-value=2.4e-22  Score=150.48  Aligned_cols=106  Identities=32%  Similarity=0.448  Sum_probs=95.6

Q ss_pred             CCCCCeeccCcEEEEEeCCCCCCceEEEEEEEeCCCC---CCceEEEEEeeCCC--CCceeeEEeCceeEEEEc-eecCc
Q psy11062         75 NDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSG---DNGKIRYHLASGNF--GDSRLFAVDQTSGHLSLS-KHLDY  148 (281)
Q Consensus        75 Nd~~P~f~~~~~~~~v~En~~~gt~v~~v~a~D~D~g---~~~~i~y~l~~~~~--~~~~~F~id~~tG~i~~~-~~LD~  148 (281)
                      |||+|.|.+..|.+.|+|+.++|+.|+++.|+|+|.|   .|+.++|+|..++.  ....+|.|++.+|.|++. +.|||
T Consensus         1 NDn~P~F~~~~y~~~V~E~~~~gt~v~~v~A~D~D~g~~~~n~~v~y~i~~~~~~~~~~~~F~i~~~tG~i~~~~~~lD~   80 (112)
T d1edha2           1 NDNRPEFTQEVFEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDR   80 (112)
T ss_dssp             SCCCCEESCSEEEEEEETTCCTTCEEEECCEECCSCTTTCSTTCCEEEEEEEESCCSCSCSEEECTTTCEEEECSSCCCT
T ss_pred             CCCCCccCCCEEEEEEECCCCCCCEEEEEEEEecccCCccccceEEEEEecCCccccceeEEEEecccceEEEEeccccc
Confidence            8999999999999999999999999999999999976   46789999986532  234689999999999864 57999


Q ss_pred             cCcceEEEEEEEEECCCCCCeEEEEEEEEEEe
Q psy11062        149 ETSQRHTIVVSATDQGDPPMSSNLTVLLEVQD  180 (281)
Q Consensus       149 E~~~~y~l~V~a~D~~~p~~~~~~~v~I~V~D  180 (281)
                      |....|.|.|+|+|++.|+++++++|+|+|+|
T Consensus        81 E~~~~y~l~V~a~D~g~~~~~~~~~v~I~V~D  112 (112)
T d1edha2          81 ESYPTYTLVVQAADLQGEGLSTTAKAVITVKD  112 (112)
T ss_dssp             TTCCEEEEEEEEETGGGTSCEEEEEEEEEEEC
T ss_pred             ccCcEEEEEEEEEECCCCccEEEEEEEEEEEC
Confidence            99999999999999999999999999999987



>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure