Psyllid ID: psy11062
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 281 | ||||||
| 195159445 | 1812 | GL15349 [Drosophila persimilis] gi|19411 | 0.686 | 0.106 | 0.588 | 7e-65 | |
| 198475184 | 3586 | GA26057 [Drosophila pseudoobscura pseudo | 0.686 | 0.053 | 0.583 | 2e-64 | |
| 194758613 | 3563 | GF14875 [Drosophila ananassae] gi|190615 | 0.693 | 0.054 | 0.583 | 1e-63 | |
| 270006362 | 3474 | dachsous [Tribolium castaneum] | 0.708 | 0.057 | 0.572 | 1e-63 | |
| 195032868 | 3594 | GH10500 [Drosophila grimshawi] gi|193904 | 0.711 | 0.055 | 0.545 | 2e-63 | |
| 195437548 | 3471 | GK24627 [Drosophila willistoni] gi|19416 | 0.711 | 0.057 | 0.577 | 7e-63 | |
| 195388388 | 3639 | GJ19658 [Drosophila virilis] gi|19414931 | 0.711 | 0.054 | 0.531 | 4e-62 | |
| 195118208 | 2980 | GI18019 [Drosophila mojavensis] gi|19391 | 0.708 | 0.066 | 0.528 | 7e-62 | |
| 195470324 | 3556 | GE15963 [Drosophila yakuba] gi|194173559 | 0.686 | 0.054 | 0.567 | 1e-61 | |
| 194853658 | 3556 | GG24633 [Drosophila erecta] gi|190660069 | 0.693 | 0.054 | 0.558 | 1e-61 |
| >gi|195159445|ref|XP_002020589.1| GL15349 [Drosophila persimilis] gi|194117539|gb|EDW39582.1| GL15349 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
Score = 253 bits (646), Expect = 7e-65, Method: Compositional matrix adjust.
Identities = 116/197 (58%), Positives = 155/197 (78%), Gaps = 4/197 (2%)
Query: 11 PIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKVT 70
P+RY+I+SGDP+GYF ++ +G IR A LDHE G +LL++QA++G PP+Y + QV +
Sbjct: 850 PVRYSIYSGDPDGYFGIEGGSGNIRIARPLDHEAKGQVLLNIQATAGEPPVYGHTQVNIE 909
Query: 71 IEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRL 130
+ED NDNAPEFE++ +R+SVPE+A LG PLY A DKDSG +G++ Y LA + +L
Sbjct: 910 VEDVNDNAPEFEASLVRISVPENADLGAPLYAAHAHDKDSGSSGQVTYSLAR----ERQL 965
Query: 131 FAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFER 190
FA+D SGHL LS+HLDYETSQRHT+VV+ATD G PP+++NLT+L++VQDVNDNPPVFER
Sbjct: 966 FAIDPRSGHLVLSQHLDYETSQRHTLVVTATDGGVPPLATNLTILVDVQDVNDNPPVFER 1025
Query: 191 SEYFVSVSEALPAKSQV 207
EY V+VSE+ P SQ+
Sbjct: 1026 DEYAVNVSESRPVNSQI 1042
|
Source: Drosophila persimilis Species: Drosophila persimilis Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|198475184|ref|XP_002132853.1| GA26057 [Drosophila pseudoobscura pseudoobscura] gi|198138709|gb|EDY70255.1| GA26057 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|194758613|ref|XP_001961556.1| GF14875 [Drosophila ananassae] gi|190615253|gb|EDV30777.1| GF14875 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|270006362|gb|EFA02810.1| dachsous [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195032868|ref|XP_001988576.1| GH10500 [Drosophila grimshawi] gi|193904576|gb|EDW03443.1| GH10500 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|195437548|ref|XP_002066702.1| GK24627 [Drosophila willistoni] gi|194162787|gb|EDW77688.1| GK24627 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195388388|ref|XP_002052862.1| GJ19658 [Drosophila virilis] gi|194149319|gb|EDW65017.1| GJ19658 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195118208|ref|XP_002003632.1| GI18019 [Drosophila mojavensis] gi|193914207|gb|EDW13074.1| GI18019 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|195470324|ref|XP_002087458.1| GE15963 [Drosophila yakuba] gi|194173559|gb|EDW87170.1| GE15963 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194853658|ref|XP_001968202.1| GG24633 [Drosophila erecta] gi|190660069|gb|EDV57261.1| GG24633 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 281 | ||||||
| FB|FBgn0000497 | 3503 | ds "dachsous" [Drosophila mela | 0.697 | 0.055 | 0.560 | 4.6e-57 | |
| UNIPROTKB|E1C566 | 2926 | E1C566 "Uncharacterized protei | 0.693 | 0.066 | 0.434 | 1.7e-38 | |
| UNIPROTKB|F1NB81 | 2475 | F1NB81 "Uncharacterized protei | 0.693 | 0.078 | 0.434 | 3.9e-38 | |
| WB|WBGene00019994 | 2779 | cdh-1 [Caenorhabditis elegans | 0.686 | 0.069 | 0.418 | 3.5e-33 | |
| ZFIN|ZDB-GENE-050208-41 | 3286 | dchs1b "dachsous 1b (Drosophil | 0.704 | 0.060 | 0.401 | 4.2e-33 | |
| RGD|1309878 | 3278 | Dchs1 "dachsous 1 (Drosophila) | 0.690 | 0.059 | 0.37 | 4.6e-30 | |
| UNIPROTKB|Q6V0I7 | 4981 | FAT4 "Protocadherin Fat 4" [Ho | 0.861 | 0.048 | 0.333 | 5e-30 | |
| MGI|MGI:2444314 | 4555 | Fat3 "FAT tumor suppressor hom | 0.711 | 0.043 | 0.372 | 5.8e-30 | |
| UNIPROTKB|E2R353 | 4591 | FAT1 "Uncharacterized protein" | 0.693 | 0.042 | 0.383 | 6e-30 | |
| UNIPROTKB|F6XXM1 | 5056 | FAT1 "Uncharacterized protein" | 0.693 | 0.038 | 0.383 | 7.4e-30 |
| FB|FBgn0000497 ds "dachsous" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 605 (218.0 bits), Expect = 4.6e-57, P = 4.6e-57
Identities = 111/198 (56%), Positives = 153/198 (77%)
Query: 10 NPIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKV 69
+P+RY+I+SGDP+GYF++++ +G IR A LDHE +LL++QA+ G PP+Y + QV +
Sbjct: 807 SPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNI 866
Query: 70 TIEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSR 129
+ED NDNAPEFE++ +R+SVPESA LG PLY A DKDSG +G++ Y L + G
Sbjct: 867 EVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKES-GKG- 924
Query: 130 LFAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFE 189
LFA+D SGHL LS+HLDYE+SQRHT++V+ATD G P +S+NLT+L++VQDVNDNPPVFE
Sbjct: 925 LFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFE 984
Query: 190 RSEYFVSVSEALPAKSQV 207
+ EY V+VSE+ +Q+
Sbjct: 985 KDEYSVNVSESRSINAQI 1002
|
|
| UNIPROTKB|E1C566 E1C566 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NB81 F1NB81 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00019994 cdh-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-41 dchs1b "dachsous 1b (Drosophila)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1309878 Dchs1 "dachsous 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6V0I7 FAT4 "Protocadherin Fat 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2444314 Fat3 "FAT tumor suppressor homolog 3 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R353 FAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XXM1 FAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 281 | |||
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 1e-32 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 4e-28 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 2e-21 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 8e-21 | |
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 1e-19 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 3e-10 | |
| cd00031 | 98 | cd00031, CA_like, Cadherin repeat-like domain | 0.004 |
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
Score = 115 bits (289), Expect = 1e-32
Identities = 45/100 (45%), Positives = 66/100 (66%), Gaps = 2/100 (2%)
Query: 85 TIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLSK 144
+ +SVPE+A G + TV A D DSG+NG++ Y + SGN + LF++D ++G ++ +K
Sbjct: 1 SYEVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVSGN--EDGLFSIDPSTGEITTAK 58
Query: 145 HLDYETSQRHTIVVSATDQGDPPMSSNLTVLLEVQDVNDN 184
LD E +T+ V+ATD G PP+SS TV + V DVNDN
Sbjct: 59 PLDREEQSSYTLTVTATDGGGPPLSSTATVTITVLDVNDN 98
|
Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98 |
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|206635 cd00031, CA_like, Cadherin repeat-like domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 281 | |||
| KOG4289|consensus | 2531 | 100.0 | ||
| KOG4289|consensus | 2531 | 100.0 | ||
| KOG1219|consensus | 4289 | 100.0 | ||
| KOG1219|consensus | 4289 | 100.0 | ||
| cd00031 | 199 | CA Cadherin repeat domain; Cadherins are glycoprot | 99.97 | |
| cd00031 | 199 | CA Cadherin repeat domain; Cadherins are glycoprot | 99.94 | |
| PF00028 | 93 | Cadherin: Cadherin domain; InterPro: IPR002126 Cad | 99.79 | |
| smart00112 | 79 | CA Cadherin repeats. Cadherins are glycoproteins i | 99.72 | |
| KOG1834|consensus | 952 | 99.69 | ||
| smart00112 | 79 | CA Cadherin repeats. Cadherins are glycoproteins i | 99.6 | |
| KOG1834|consensus | 952 | 99.57 | ||
| PF00028 | 93 | Cadherin: Cadherin domain; InterPro: IPR002126 Cad | 99.34 | |
| PF08266 | 84 | Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad | 97.36 | |
| PF08758 | 90 | Cadherin_pro: Cadherin prodomain like; InterPro: I | 97.09 | |
| TIGR01965 | 99 | VCBS_repeat VCBS repeat. This domain of about 100 | 96.56 | |
| smart00736 | 97 | CADG Dystroglycan-type cadherin-like domains. Cadh | 96.52 | |
| smart00736 | 97 | CADG Dystroglycan-type cadherin-like domains. Cadh | 96.5 | |
| TIGR01965 | 99 | VCBS_repeat VCBS repeat. This domain of about 100 | 95.73 | |
| PF13750 | 158 | Big_3_3: Bacterial Ig-like domain (group 3) | 95.62 | |
| PF08266 | 84 | Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad | 95.27 | |
| TIGR00845 | 928 | caca sodium/calcium exchanger 1. This model is spe | 91.5 | |
| PF07495 | 66 | Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi | 87.7 | |
| PF08758 | 90 | Cadherin_pro: Cadherin prodomain like; InterPro: I | 85.51 | |
| TIGR03660 | 137 | T1SS_rpt_143 T1SS-143 repeat domain. This model re | 81.13 |
| >KOG4289|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.4e-41 Score=326.17 Aligned_cols=230 Identities=32% Similarity=0.443 Sum_probs=214.3
Q ss_pred CEEEEecCCCcEEEEEEe---CCCCceEEEECCccEEEECcCCCceeccEEEEEEEEE-eCCCCceeEEEEEEEEEecCC
Q psy11062 1 MKILLLDQSNPIRYTIHS---GDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQAS-SGSPPLYSYAQVKVTIEDRND 76 (281)
Q Consensus 1 ~~~~d~d~~~~l~Y~i~~---g~~~~~F~Id~~~G~i~~~~~LD~E~~~~~~l~v~a~-dg~~~~~~~~~v~i~V~dvNd 76 (281)
++|.++| .++|.|++.. .-..++|+||+.+|.|++++.||||+...+.|.|.|. -+.|+.+++++|+|.|.|.||
T Consensus 186 v~A~~~~-a~rl~Ysm~al~dsRS~~lFslD~~sG~irta~~lDREt~e~HvlrVtA~d~~~P~~SAtttv~V~V~D~nD 264 (2531)
T KOG4289|consen 186 VKASDPD-AGRLYYSMVALFDSRSQNLFSLDPMSGAIRTAKSLDRETKETHVLRVTAQDHGDPRRSATTTVTVLVLDTND 264 (2531)
T ss_pred EEecCCC-cCceEEEeeeccchhccccEeeccccccchhhhhhhhhhhheeEEEEEeeecCCCcccceeEEEEEEeecCC
Confidence 3567777 4789999984 2344899999999999999999999999999999999 478899999999999999999
Q ss_pred CCCeeccCcEEEEEeCCCCCCceEEEEEEEeCCCCCCceEEEEEeeCCCCCceeeEEeCceeEEEEceecCccCcceEEE
Q psy11062 77 NAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLSKHLDYETSQRHTI 156 (281)
Q Consensus 77 ~~P~f~~~~~~~~v~En~~~gt~v~~v~a~D~D~g~~~~i~y~l~~~~~~~~~~F~id~~tG~i~~~~~LD~E~~~~y~l 156 (281)
|.|.|++..|..++.||.++|..|.+++|+|.|+++|+.+.|++.+|+ ....|.||+.+|.|+++.+||||+...|+|
T Consensus 265 hsPvFEq~~Y~e~lREn~evGy~vLtvrAtD~Dsp~Nani~Yrl~eg~--~~~~f~in~rSGvI~T~a~lDRE~~~~y~L 342 (2531)
T KOG4289|consen 265 HSPVFEQDEYREELRENLEVGYEVLTVRATDGDSPPNANIRYRLLEGN--AKNVFEINPRSGVISTRAPLDREELESYQL 342 (2531)
T ss_pred CCcccchhHHHHHHhhccccCceEEEEEeccCCCCCCCceEEEecCCC--ccceeEEcCccceeeccCccCHHhhhheEE
Confidence 999999999999999999999999999999999999999999999974 678999999999999999999999999999
Q ss_pred EEEEEECCCCCCeEEEEEEEEEEeCCCCCCeeeCCceEEEEeCCCCCCcEEEEEEeeEEEeecCccccEEEEEeecCCh
Q psy11062 157 VVSATDQGDPPMSSNLTVLLEVQDVNDNPPVFERSEYFVSVSEALPAKSQVRTTCTPLYVLVEGQCSLVCWSTLRLMTH 235 (281)
Q Consensus 157 ~V~a~D~~~p~~~~~~~v~I~V~DvND~~P~f~~~~y~~~v~E~~~~gt~v~~v~A~~yd~d~g~~~~~~~~~~~~~~~ 235 (281)
.|+|+|.|.++...++.|.|.|.|+|||+|+|....|.+.|.|+..++++|++|+|+ |.|-|.||.+-|++.+....
T Consensus 343 ~VeAsDqG~~pgp~Ta~V~itV~D~NDNaPqFse~~Yvvqv~Edvt~~avvlrV~At--DrD~g~Ng~VHYsi~Sgn~~ 419 (2531)
T KOG4289|consen 343 DVEASDQGRPPGPRTAMVEITVEDENDNAPQFSEKRYVVQVREDVTPPAVVLRVTAT--DRDKGTNGKVHYSIASGNGR 419 (2531)
T ss_pred EEEeccCCCCCCCceEEEEEEEEecCCCCccccccceEEEecccCCCCceEEEEEec--ccCCCcCceEEEEeeccCcc
Confidence 999999999988889999999999999999999999999999999999999999999 99999999999987665443
|
|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here | Back alignment and domain information |
|---|
| >cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here | Back alignment and domain information |
|---|
| >PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >smart00112 CA Cadherin repeats | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >smart00112 CA Cadherin repeats | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion | Back alignment and domain information |
|---|
| >TIGR01965 VCBS_repeat VCBS repeat | Back alignment and domain information |
|---|
| >smart00736 CADG Dystroglycan-type cadherin-like domains | Back alignment and domain information |
|---|
| >smart00736 CADG Dystroglycan-type cadherin-like domains | Back alignment and domain information |
|---|
| >TIGR01965 VCBS_repeat VCBS repeat | Back alignment and domain information |
|---|
| >PF13750 Big_3_3: Bacterial Ig-like domain (group 3) | Back alignment and domain information |
|---|
| >PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >TIGR00845 caca sodium/calcium exchanger 1 | Back alignment and domain information |
|---|
| >PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators | Back alignment and domain information |
|---|
| >PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion | Back alignment and domain information |
|---|
| >TIGR03660 T1SS_rpt_143 T1SS-143 repeat domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 281 | ||||
| 2yst_A | 119 | Solution Structure Of The Third Cadherin Domain Fro | 1e-15 | ||
| 3q2v_A | 550 | Crystal Structure Of Mouse E-Cadherin Ectodomain Le | 2e-15 | ||
| 3q2w_A | 559 | Crystal Structure Of Mouse N-Cadherin Ectodomain Le | 7e-15 | ||
| 3mvs_A | 210 | Structure Of The N-Terminus Of Cadherin 23 Length = | 9e-15 | ||
| 3mvs_A | 210 | Structure Of The N-Terminus Of Cadherin 23 Length = | 3e-05 | ||
| 1edh_A | 226 | E-Cadherin Domains 1 And 2 In Complex With Calcium | 1e-14 | ||
| 2a62_A | 322 | Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length | 2e-14 | ||
| 2wcp_A | 214 | Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length | 2e-14 | ||
| 2wcp_A | 214 | Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length | 3e-05 | ||
| 4aqe_A | 214 | Crystal Structure Of Deafness Associated Mutant Mou | 2e-14 | ||
| 4aqe_A | 214 | Crystal Structure Of Deafness Associated Mutant Mou | 3e-05 | ||
| 2wd0_A | 214 | Crystal Structure Of Nonsyndromic Deafness (Dfnb12) | 1e-13 | ||
| 2wd0_A | 214 | Crystal Structure Of Nonsyndromic Deafness (Dfnb12) | 2e-04 | ||
| 1l3w_A | 546 | C-Cadherin Ectodomain Length = 546 | 2e-13 | ||
| 1q55_A | 880 | W-Shaped Trans Interactions Of Cadherins Model Base | 3e-13 | ||
| 3ubh_A | 419 | Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le | 6e-13 | ||
| 1ff5_A | 219 | Structure Of E-Cadherin Double Domain Length = 219 | 1e-12 | ||
| 2ee0_A | 114 | Solution Structures Of The Ca Domain Of Human Proto | 1e-10 | ||
| 1q1p_A | 212 | E-Cadherin Activation Length = 212 | 3e-10 | ||
| 3lni_A | 213 | Crystal Structure Of E-Cadherin Ec12 E89a Length = | 3e-10 | ||
| 2qvf_B | 213 | Mouse E-cadherin Domains 1,2 Length = 213 | 3e-10 | ||
| 3qrb_A | 213 | Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt | 3e-10 | ||
| 3lne_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14e Length = | 3e-10 | ||
| 3lng_A | 215 | Crystal Structure Of E-Cadherin Ec12 Aa Extension L | 4e-10 | ||
| 3lnh_A | 213 | Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 | 5e-10 | ||
| 3lnf_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14ew2a Length | 5e-10 | ||
| 3q2l_A | 213 | Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | 6e-10 | ||
| 3q2n_A | 213 | Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | 1e-09 | ||
| 1ncj_A | 215 | N-Cadherin, Two-Domain Fragment Length = 215 | 1e-09 | ||
| 2o72_A | 213 | Crystal Structure Analysis Of Human E-Cadherin (1-2 | 1e-09 | ||
| 2o72_A | 213 | Crystal Structure Analysis Of Human E-Cadherin (1-2 | 3e-04 | ||
| 2qvi_A | 215 | Crystal Structure Of N-Cadherin Domains Ec12 Length | 2e-09 | ||
| 2a4e_A | 215 | Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length | 4e-09 | ||
| 2a4e_A | 215 | Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length | 8e-09 | ||
| 3lnd_A | 207 | Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 | 7e-09 | ||
| 3lnd_A | 207 | Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 | 3e-07 | ||
| 4apx_B | 242 | Crystal Structure Of Mouse Cadherin-23 Ec1-2 And Pr | 5e-07 | ||
| 3ubf_A | 316 | Crystal Structure Of Drosophila N-Cadherin Ec1-3, I | 8e-07 | ||
| 3ppe_A | 203 | Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng | 3e-06 | ||
| 1suh_A | 146 | Amino-Terminal Domain Of Epithelial Cadherin In The | 9e-06 | ||
| 3k5r_A | 218 | Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt | 1e-04 | ||
| 3k5r_A | 218 | Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt | 5e-04 | ||
| 3k5s_A | 217 | Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len | 3e-04 |
| >pdb|2YST|A Chain A, Solution Structure Of The Third Cadherin Domain From Human Protocadherin 7 Length = 119 | Back alignment and structure |
|
| >pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 | Back alignment and structure |
| >pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 | Back alignment and structure |
| >pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 | Back alignment and structure |
| >pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 | Back alignment and structure |
| >pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 | Back alignment and structure |
| >pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 | Back alignment and structure |
| >pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 | Back alignment and structure |
| >pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 | Back alignment and structure |
| >pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 | Back alignment and structure |
| >pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 | Back alignment and structure |
| >pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 | Back alignment and structure |
| >pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 | Back alignment and structure |
| >pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 | Back alignment and structure |
| >pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 | Back alignment and structure |
| >pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 | Back alignment and structure |
| >pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 | Back alignment and structure |
| >pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 | Back alignment and structure |
| >pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 | Back alignment and structure |
| >pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 | Back alignment and structure |
| >pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 | Back alignment and structure |
| >pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 | Back alignment and structure |
| >pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | Back alignment and structure |
| >pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | Back alignment and structure |
| >pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 | Back alignment and structure |
| >pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 | Back alignment and structure |
| >pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 | Back alignment and structure |
| >pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 | Back alignment and structure |
| >pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 | Back alignment and structure |
| >pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 | Back alignment and structure |
| >pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 | Back alignment and structure |
| >pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 | Back alignment and structure |
| >pdb|4APX|B Chain B, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And Protocadherin-15 Ec1-2 Form I Length = 242 | Back alignment and structure |
| >pdb|3UBF|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-3, I Length = 316 | Back alignment and structure |
| >pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 | Back alignment and structure |
| >pdb|1SUH|A Chain A, Amino-Terminal Domain Of Epithelial Cadherin In The Calcium Bound State, Nmr, 20 Structures Length = 146 | Back alignment and structure |
| >pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 | Back alignment and structure |
| >pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 | Back alignment and structure |
| >pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 281 | |||
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 2e-57 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 2e-41 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 7e-57 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 1e-45 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 3e-29 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 7e-57 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 5e-53 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 3e-49 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 7e-48 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 5e-29 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 6e-56 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 4e-53 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 6e-49 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 8e-43 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 2e-31 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 1e-55 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 5e-53 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 1e-51 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 4e-45 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 2e-30 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 1e-55 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 7e-51 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 2e-48 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 2e-41 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 1e-34 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 4e-21 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 3e-08 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 1e-07 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 8e-54 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 3e-50 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 4e-26 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 5e-17 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 3e-53 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 4e-49 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 5e-47 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 4e-27 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 5e-09 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 1e-51 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 4e-32 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 3e-16 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 4e-50 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 9e-34 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 4e-48 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 2e-34 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 2e-47 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 2e-22 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 3e-47 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 2e-34 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 4e-46 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 2e-32 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 9e-45 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 5e-34 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 2e-43 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 4e-17 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 5e-08 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 1e-34 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 1e-08 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 5e-08 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 3e-31 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 9e-20 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 2e-27 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 4e-19 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 1e-22 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 8e-12 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 4e-22 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 3e-12 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 1e-21 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 1e-12 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 4e-19 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 3e-12 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 1e-17 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 8e-12 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 7e-17 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 4e-12 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 9e-09 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 4e-06 | |
| 1wuz_A | 103 | Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p | 3e-05 |
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
Score = 182 bits (463), Expect = 2e-57
Identities = 47/175 (26%), Positives = 82/175 (46%), Gaps = 7/175 (4%)
Query: 11 PIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGSPPLYSYAQVKVT 70
P+ + + + +F ++ TGV+ LD E + S +V +
Sbjct: 41 PLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGV--ITRKVNIQ 98
Query: 71 IEDRNDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRL 130
+ D NDNAP F + + +PE+ +G P++ V A D D G G + Y S
Sbjct: 99 VGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQP----PSPF 154
Query: 131 FAVDQTSGHLSLSKHLDYETSQRHTIVVSATDQGDP-PMSSNLTVLLEVQDVNDN 184
FA+D G +++ + LDYE +Q + + V+ATDQ P+S+ + + + D+ D
Sbjct: 155 FAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDM 209
|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Length = 125 | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Length = 125 | Back alignment and structure |
|---|
| >1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Length = 103 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 281 | |||
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 100.0 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 100.0 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 100.0 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 100.0 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 100.0 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 100.0 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 100.0 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 100.0 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 100.0 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 100.0 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 100.0 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 100.0 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 100.0 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 100.0 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 100.0 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 100.0 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 100.0 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 100.0 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 100.0 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 100.0 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 100.0 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 100.0 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 99.97 | |
| 4apx_B | 242 | Protocadherin-15, otocadherin; cell adhesion, hear | 99.97 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 99.97 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 99.96 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 99.96 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 99.96 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.95 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 99.95 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 99.95 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 99.95 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 99.94 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 99.91 | |
| 4apx_B | 242 | Protocadherin-15, otocadherin; cell adhesion, hear | 99.9 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 99.87 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 99.81 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 99.79 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 99.78 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 99.76 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 99.75 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 99.74 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 99.73 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 99.67 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 99.66 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 99.6 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 99.57 | |
| 1wuz_A | 103 | Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p | 99.52 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 99.45 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 99.45 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 99.4 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 99.4 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 99.38 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 99.37 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 99.36 | |
| 1wuz_A | 103 | Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p | 99.09 | |
| 2yhg_A | 437 | SDE_182CT, cellulose-binding protein; hydrolase, g | 92.78 | |
| 1op4_A | 159 | Neural-cadherin; beta sandwich, cadherin-like doma | 90.35 | |
| 3pdd_A | 190 | Glycoside hydrolase, family 9; CBHA, beta-sandwich | 90.23 | |
| 3rb5_A | 298 | Na/Ca exchange protein; CBD12, calcium binding and | 89.49 | |
| 2kpn_A | 103 | Bacillolysin; solution structure, BIG_3 domain, PF | 82.39 | |
| 2yrl_A | 102 | KIAA1837 protein; PKD domain, NPPSFA, national pro | 81.74 | |
| 3ead_A | 137 | Na/Ca exchange protein; CBD1, calcium regulation, | 80.4 |
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-47 Score=341.50 Aligned_cols=262 Identities=24% Similarity=0.348 Sum_probs=223.3
Q ss_pred EEecC-CCcEEEEEEeCCCCceEEEECCccEEEECcCCCceeccEEEEEEEEEeCC--CCceeEEEEEEEEEecCCCCCe
Q psy11062 4 LLLDQ-SNPIRYTIHSGDPEGYFTLDSTTGVIRTAATLDHEVTGVLLLSVQASSGS--PPLYSYAQVKVTIEDRNDNAPE 80 (281)
Q Consensus 4 ~d~d~-~~~l~Y~i~~g~~~~~F~Id~~~G~i~~~~~LD~E~~~~~~l~v~a~dg~--~~~~~~~~v~i~V~dvNd~~P~ 80 (281)
+|.|. ++.++|+|.++...++|+|++.+|.|++.++||||+...|.|.|.|+|+. +++++++.+.|.|.|+|||+|.
T Consensus 26 ~D~D~g~~~i~Y~l~~~~~~~~F~Id~~tG~i~~~~~LDrE~~~~y~l~v~a~D~~~~~~~~~~~~v~I~V~DvNDn~P~ 105 (322)
T 2a62_A 26 TDLDPGSKKIKYILSGDGAGTIFQINDITGDIHAIKRLDREEKAEYTLTAQAVDFETNKPLEPPSEFIIKVQDINDNAPE 105 (322)
T ss_dssp CCCCCSSCCCEEEEEETTBTTTEEEETTTTEEEECSCCCTTTCSBCCEEEEEECTTTCSEEEEEEEECEECCCCSCSCBC
T ss_pred EcCCCCCCEEEEEEECCCCCCcEEEeCCcCEEEEeccCCcccccEEEEEEEEEECCCCCcccceEEEEEEEEecCCCCCc
Confidence 45554 47899999876556789999999999999999999999999999999754 3467788999999999999999
Q ss_pred eccCcEEEEEeCCCCCCceEEEEEEEeCCC---CCCceEEEEEeeCCCCCceeeEEeCceeEEEEc-eecCccCcceEEE
Q psy11062 81 FESTTIRLSVPESAALGLPLYTVVARDKDS---GDNGKIRYHLASGNFGDSRLFAVDQTSGHLSLS-KHLDYETSQRHTI 156 (281)
Q Consensus 81 f~~~~~~~~v~En~~~gt~v~~v~a~D~D~---g~~~~i~y~l~~~~~~~~~~F~id~~tG~i~~~-~~LD~E~~~~y~l 156 (281)
|....|.+.|+|+.++|+.++++.|+|+|. |.|+.++|+|..+ ...|.|++.+|.|++. ++||||....|.|
T Consensus 106 F~~~~y~~~v~E~~~~gt~v~~v~A~D~D~~~~G~n~~i~Y~i~~~----~~~F~Id~~tG~i~~~~~~LD~E~~~~y~l 181 (322)
T 2a62_A 106 FLNGPYHATVPEMSILGTSVTNVTATDADDPVYGNSAKLVYSILEG----QPYFSIEPETAIIKTALPNMDREAKEEYLV 181 (322)
T ss_dssp CSSSEEEEEECSSCCTTCBCCCCCCCBCSCSSSTTSSCEEEEEEEC----TTTEEECTTTCCEEECSSCCCGGGCSEEEE
T ss_pred cCCCceEEEEeCCCCCCCEEEEEEEEeCCCCCCCccEEEEEEEccC----CCCEEEecCCCEEEecccCCCcccCCeEEE
Confidence 999999999999999999999999999995 7889999999985 3589999999999998 8999999999999
Q ss_pred EEEEEECCCCC--CeEEEEEEEEEEeCCCCCCeeeCCceEEEEeCCCCCCcEEEEEEeeEEEeecCccccEEEEEeecCC
Q psy11062 157 VVSATDQGDPP--MSSNLTVLLEVQDVNDNPPVFERSEYFVSVSEALPAKSQVRTTCTPLYVLVEGQCSLVCWSTLRLMT 234 (281)
Q Consensus 157 ~V~a~D~~~p~--~~~~~~v~I~V~DvND~~P~f~~~~y~~~v~E~~~~gt~v~~v~A~~yd~d~g~~~~~~~~~~~~~~ 234 (281)
.|+|+|++.|+ ++++++|+|.|.|+|||+|.|.+..|.+.|+|+.++|+.|++|.|+ |.|.|.|+.+.|++.....
T Consensus 182 ~V~a~D~g~p~~~~s~~~~v~I~V~DvNDn~P~F~~~~y~~~v~En~~~gt~v~~v~A~--D~D~g~n~~i~Y~i~~g~~ 259 (322)
T 2a62_A 182 VIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPEDVVLGTAIGRVKAN--DQDIGENAQSSYDIIDGDG 259 (322)
T ss_dssp EEEEEESCSSSSCCBCCEEEEEEECCCCCCCCCCSCSEEEEEECSCCSSCCEEEEEECC--CSSCGGGTCCEEEEC---C
T ss_pred EEEEEECCCCCCCceeEEEEEEEEEecCCCCCeecCCCceeEeECCCCCCcEEEEEEEE--eCCCCCCceEEEEEECCCC
Confidence 99999999874 8899999999999999999999999999999999999999999999 9999999999999876433
Q ss_pred h--hhhh-----ccCCCCCCCCcceEEEEEEEEEEecCcceeee
Q psy11062 235 H--STLK-----SELNSPLGSNSFQLSILWYSIFLRTNTMQIYR 271 (281)
Q Consensus 235 ~--~~l~-----~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~~~ 271 (281)
. +.++ ..|...+.+..-.-....|+|.|++.++-..+
T Consensus 260 ~~~F~I~~d~~~~tG~i~~~~~LD~E~~~~y~l~V~A~D~g~pp 303 (322)
T 2a62_A 260 TALFEITSDAQAQDGVIRLRKPLDFETKKSYTLKVEAANIHIDP 303 (322)
T ss_dssp CSSBCCBCCTTTSEEEEEBCSCCCCSSCCEEEEEEEEECCCSSC
T ss_pred CCcEEEeccCCCceEEEEECCcCCcccCCeEEEEEEEEECCCCC
Confidence 3 3333 12333333333223456799999987765544
|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A | Back alignment and structure |
|---|
| >4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A | Back alignment and structure |
|---|
| >1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} | Back alignment and structure |
|---|
| >1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 | Back alignment and structure |
|---|
| >3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A | Back alignment and structure |
|---|
| >3rb5_A Na/Ca exchange protein; CBD12, calcium binding and regulation, metal binding protein; 2.35A {Drosophila melanogaster} PDB: 3rb7_A 3e9u_A | Back alignment and structure |
|---|
| >2kpn_A Bacillolysin; solution structure, BIG_3 domain, PF07523, PSI BIG-open NESG, cell WALL, hydrolase, peptidoglycan-anchor; NMR {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >2yrl_A KIAA1837 protein; PKD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ead_A Na/Ca exchange protein; CBD1, calcium regulation, membrane, transmembrane, membrane; 2.25A {Drosophila melanogaster} SCOP: b.1.27.0 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 281 | ||||
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 2e-19 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 1e-07 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 0.004 | |
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 7e-18 | |
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 4e-07 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 1e-17 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 1e-04 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 4e-04 | |
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 4e-17 | |
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 1e-07 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 6e-16 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 1e-04 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 3e-04 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 7e-15 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 1e-06 | |
| d1ncja2 | 114 | b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu | 1e-14 | |
| d1ncja2 | 114 | b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu | 1e-04 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 5e-14 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 8e-04 | |
| d1l3wa5 | 107 | b.1.6.1 (A:434-540) C-cadherin ectodomain {African | 5e-11 | |
| d1op4a_ | 136 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 2e-10 |
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cadherin-like family: Cadherin domain: C-cadherin ectodomain species: African clawed frog (Xenopus laevis) [TaxId: 8355]
Score = 79.3 bits (194), Expect = 2e-19
Identities = 27/110 (24%), Positives = 52/110 (47%), Gaps = 7/110 (6%)
Query: 76 DNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSGDNGKIRYHLASGNFGDSRLFAVDQ 135
+ AP F R+ V E + G + ++VA+D D K+ Y + + V++
Sbjct: 1 NEAPFFVPAVSRVDVSEDLSRGEKIISLVAQDPDKQQIQKLSYFIGNDPAR---WLTVNK 57
Query: 136 TSGHLSLSKHLDYETSQ----RHTIVVSATDQGDPPMSSNLTVLLEVQDV 181
+G ++ + +LD E+ +T+++ TD G + T++L V DV
Sbjct: 58 DNGIVTGNGNLDRESEYVKNNTYTVIMLVTDDGVSVGTGTGTLILHVLDV 107
|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 281 | |||
| d1edha2 | 112 | E-cadherin (epithelial) {Mouse (Mus musculus) [Tax | 99.87 | |
| d1l3wa2 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.87 | |
| d1l3wa4 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.86 | |
| d1ncja2 | 114 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.83 | |
| d1op4a_ | 136 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.82 | |
| d1l3wa3 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.78 | |
| d1l3wa5 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.7 | |
| d1l3wa1 | 100 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.65 | |
| d1ncia_ | 102 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.62 | |
| d2omzb1 | 104 | E-cadherin (epithelial) {Human (Homo sapiens) [Tax | 99.62 | |
| d2omzb1 | 104 | E-cadherin (epithelial) {Human (Homo sapiens) [Tax | 99.25 | |
| d1op4a_ | 136 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.24 | |
| d1ncia_ | 102 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.23 | |
| d1l3wa1 | 100 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.23 | |
| d1l3wa4 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.17 | |
| d1l3wa2 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.16 | |
| d1edha2 | 112 | E-cadherin (epithelial) {Mouse (Mus musculus) [Tax | 99.14 | |
| d1ncja2 | 114 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 98.9 | |
| d1l3wa5 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 98.71 | |
| d1l3wa3 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 98.67 | |
| d2cqva1 | 101 | Telokin {Human (Homo sapiens) [TaxId: 9606]} | 88.4 | |
| d1u2ca1 | 103 | Dystroglycan, N-terminal domain {Mouse (Mus muscul | 84.72 | |
| d1u2ca1 | 103 | Dystroglycan, N-terminal domain {Mouse (Mus muscul | 80.77 |
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cadherin-like family: Cadherin domain: E-cadherin (epithelial) species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.87 E-value=2.4e-22 Score=150.48 Aligned_cols=106 Identities=32% Similarity=0.448 Sum_probs=95.6
Q ss_pred CCCCCeeccCcEEEEEeCCCCCCceEEEEEEEeCCCC---CCceEEEEEeeCCC--CCceeeEEeCceeEEEEc-eecCc
Q psy11062 75 NDNAPEFESTTIRLSVPESAALGLPLYTVVARDKDSG---DNGKIRYHLASGNF--GDSRLFAVDQTSGHLSLS-KHLDY 148 (281)
Q Consensus 75 Nd~~P~f~~~~~~~~v~En~~~gt~v~~v~a~D~D~g---~~~~i~y~l~~~~~--~~~~~F~id~~tG~i~~~-~~LD~ 148 (281)
|||+|.|.+..|.+.|+|+.++|+.|+++.|+|+|.| .|+.++|+|..++. ....+|.|++.+|.|++. +.|||
T Consensus 1 NDn~P~F~~~~y~~~V~E~~~~gt~v~~v~A~D~D~g~~~~n~~v~y~i~~~~~~~~~~~~F~i~~~tG~i~~~~~~lD~ 80 (112)
T d1edha2 1 NDNRPEFTQEVFEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDR 80 (112)
T ss_dssp SCCCCEESCSEEEEEEETTCCTTCEEEECCEECCSCTTTCSTTCCEEEEEEEESCCSCSCSEEECTTTCEEEECSSCCCT
T ss_pred CCCCCccCCCEEEEEEECCCCCCCEEEEEEEEecccCCccccceEEEEEecCCccccceeEEEEecccceEEEEeccccc
Confidence 8999999999999999999999999999999999976 46789999986532 234689999999999864 57999
Q ss_pred cCcceEEEEEEEEECCCCCCeEEEEEEEEEEe
Q psy11062 149 ETSQRHTIVVSATDQGDPPMSSNLTVLLEVQD 180 (281)
Q Consensus 149 E~~~~y~l~V~a~D~~~p~~~~~~~v~I~V~D 180 (281)
|....|.|.|+|+|++.|+++++++|+|+|+|
T Consensus 81 E~~~~y~l~V~a~D~g~~~~~~~~~v~I~V~D 112 (112)
T d1edha2 81 ESYPTYTLVVQAADLQGEGLSTTAKAVITVKD 112 (112)
T ss_dssp TTCCEEEEEEEEETGGGTSCEEEEEEEEEEEC
T ss_pred ccCcEEEEEEEEEECCCCccEEEEEEEEEEEC
Confidence 99999999999999999999999999999987
|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|