Psyllid ID: psy11074

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710
MTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDSPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGNLNTKQKRMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFSIDQLKNPFIEIMTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQAIMNFIYSNPFVLSGNLHGGAVARDYASRNPMMAPGHACGFDFKDGITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFVTP
ccEEccccccccHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccEEcccEEEEEEEEccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHcEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccEEEEEEccccEEEcccccEEEEEEcccEEEEEccccccccccccccccccccHHHHHHccccccccccccccccEEEEEcccccccccHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEccccccccEEEEEEEEccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccccccEEEEcccccccHHcccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccEEEEEcccccEEEcccccEEEEcccccEEEEEEEcccccEEEEEEEccccccEEEEEEEEcccccccc
cEEEEEcEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEcccccccEEEEEEEcccccccccEEccccEEEEEEEcccccEcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccEEEccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccEEEEEEcccccEEccccccEEEEEcccEEEEEEEEcccccEEEEEEEEcccccEEEEEEEcccccccccccccccccccEEccccccccccccccccccHHcccHHccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEcccccccEEEEEEEEccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHcccccHHHHHHcccEEEEEcccccccHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEEEEcccEEEEEccccccccccccccccccccccEcccEEEccccccccHHEEccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccEEEEEEcccccEEccccccEEEEEcccEEEEEEEEcccccEEEEEEEEcccccEEEEEEEccccccccc
MTLIVPSLSLLLCHVTLSTAadyyfdfddltgledadsagiDLQRYYNSTELDAFILKTVKsyphlvraetigksvqgrNLWAVEIThdvdspdgrtlmKPMFKYVANMHGDETVGYALMVFLIQYLVLkdgkddritqllnstdiyivpsinpdgfaaakegnlntkqKRMQDFNYVHSNCFEITMelscckypkasdlkHYWAANKESLIKLIENVHRGVYGIVtdtygnplpsaiitvrwndkavtvtNRGEYWRLLARGKYvvtasapgyepvttepldvpdtesVRLDFMlgkknafsidqlknpFIEIMTLIVPSLSLLLCHVTLSTAadyyfdfddltgledadsagiDLQRYYNSTELDAFILKTVKsyphlvraetigksvqgrNLWAVEIThdvdnpdgrtlmKPMFKYVANMHGDETVGYALMVFLIQYLVLkdgkddritqllnstdiyivpsinpdgfaaakegkcdsldgyvgrknahgvdlnrnfpdQFEYEakkvyepetQAIMNFiysnpfvlsgnlhggavardyasrnpmmapghacgfdfkdgitngnyWYKVTGgmqdfnyvhSNCFEITMelscckypkasdlkHYWAANKESLIKLIENVHRGVYGIVtdtygnplpsaiitvrwndkavtvtNRGEYWRLLARGKYvvtasapgyepvttepldvpdtesVRLDFMlgkknafvtp
MTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAetigksvqgrnlWAVEithdvdspdgrTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGNLNTKQKRMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAiitvrwndkavTVTNRGEYWRLLARGKYVVTasapgyepvttepldvpdTESVRLDFMLGKKNAFSIDQLKNPFIEIMTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAetigksvqgrnlWAVEithdvdnpdgrTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRknahgvdlnrnfPDQFEYEAKKVYEPETQAIMNFIYSNPFVLSGNLHGGAVARDYASRNPMMAPGHACGFDFKDGITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAiitvrwndkavTVTNRGEYWRLLARGKYVVTasapgyepvttepldvpdTESVRLDFMLGKKNAFVTP
MTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDSPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGNLNTKQKRMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFSIDQLKNPFIEIMTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQAIMNFIYSNPFVLSGNLHGGAVARDYASRNPMMAPGHACGFDFKDGITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFVTP
**LIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDSPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGNLN***KRMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFSIDQLKNPFIEIMTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQAIMNFIYSNPFVLSGNLHGGAVARDYASRNPMMAPGHACGFDFKDGITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVT************RLDFML*********
MTLIVPSLSLLLCHVTLSTAA*******************IDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDSPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGNLNTKQKRMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFSIDQLKNPFIEIMTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVD*****TLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQAIMNFIYSNPFVLSGNLHGGAVARDYASRNPMMAPGHACGFDFKDGITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKK******
MTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDSPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGNLNTKQKRMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFSIDQLKNPFIEIMTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQAIMNFIYSNPFVLSGNLHGGAVARDYASRNPMMAPGHACGFDFKDGITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFVTP
MTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDSPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGNLNTKQKRMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFSIDQLKNPFIEIMTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQAIMNFIYSNPFVLSGNLHGGAVARDYASRNPMMAPGHACGFDFKDGITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKK******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDSPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGNLNTKQKRMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFSIDQLKNPFIEIMTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQAIMNFIYSNPFVLSGNLHGGAVARDYASRNPMMAPGHACGFDFKDGITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFVTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query710 2.2.26 [Sep-21-2011]
Q90240 1389 Carboxypeptidase D OS=Ana N/A N/A 0.719 0.367 0.397 1e-106
P42787 1406 Carboxypeptidase D OS=Dro yes N/A 0.702 0.354 0.378 1e-103
Q9JHW1 1378 Carboxypeptidase D OS=Rat yes N/A 0.704 0.362 0.386 1e-101
O75976 1380 Carboxypeptidase D OS=Hom no N/A 0.707 0.363 0.380 1e-101
O89001 1377 Carboxypeptidase D OS=Mus yes N/A 0.711 0.366 0.384 1e-101
P14384443 Carboxypeptidase M OS=Hom no N/A 0.478 0.767 0.425 2e-77
Q5RFD6443 Carboxypeptidase M OS=Pon no N/A 0.480 0.769 0.421 2e-76
P83852380 Carboxypeptidase D (Fragm N/A N/A 0.474 0.886 0.411 5e-76
P37892454 Carboxypeptidase E OS=Lop N/A N/A 0.487 0.762 0.405 2e-74
Q00493476 Carboxypeptidase E OS=Mus no N/A 0.490 0.731 0.408 1e-73
>sp|Q90240|CBPD_ANAPL Carboxypeptidase D OS=Anas platyrhynchos GN=CPD PE=1 SV=1 Back     alignment and function desciption
 Score =  385 bits (989), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 229/576 (39%), Positives = 323/576 (56%), Gaps = 65/576 (11%)

Query: 172 MQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTY- 230
           MQD+NYV +NCFEIT+ELSCCKYP  S+L+  W  N+ESL+  IE VH GV G V D   
Sbjct: 337 MQDYNYVWANCFEITLELSCCKYPPTSELQQEWENNRESLLTFIEKVHIGVKGFVRDAIT 396

Query: 231 GNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESV 290
           G  L +A I V      +T    G+Y RLL  G Y VTA   GY PVT E ++V + ++ 
Sbjct: 397 GAGLENATIVVAGIAHNITAGKFGDYHRLLVPGTYNVTAVVMGYAPVTKENIEVKEADAT 456

Query: 291 RLDFMLGKKNAFSIDQLKNPFIEIM---TLIVPSLSLLLCHVTLST-AADYYFDFDDLTG 346
            +DF L +    + D     F       + + PS++ +    T S   A    DF     
Sbjct: 457 VVDFSL-QPTVVAPDPNLTQFTATPAPPSTLTPSVAQVEPPATTSLHQAVQPVDF----- 510

Query: 347 LEDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDN 406
                       R+++ ++++ F+ +    YP + R  ++GKSV+ R L+ +EI+   DN
Sbjct: 511 ------------RHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEIS---DN 555

Query: 407 PDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSI 466
           P      +P FKY+ NMHG+E VG  L++ LI+YL    G D  +T L+ ST I+I+PS+
Sbjct: 556 PGIHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHIMPSM 615

Query: 467 NPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQAIMNFIYSN 526
           NPDG+  ++EG      G VGR N++  DLNRNFPDQF ++     +PET A+M+++ + 
Sbjct: 616 NPDGYEKSQEG---DRGGTVGRNNSNNYDLNRNFPDQF-FQVTDPPQPETLAVMSWLKTY 671

Query: 527 PFVLSGNLHGGA----------------------------VARDYASRNPMMAPGHACG- 557
           PFVLS NLHGG+                            +A  Y+  N  M  G  C  
Sbjct: 672 PFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKD 731

Query: 558 ----FDFKDGITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANK 613
                 F  GITNG  WY V GGMQD+NY+++NCFE+T+EL C KYPKA +L  YW  N+
Sbjct: 732 LYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKAEELPKYWEQNR 791

Query: 614 ESLIKLIENVHRGVYGIVTD-TYGNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVV 672
            SL++ I+ VHRG++G V D T G  + +A I+V   +  VT    G+YWRLL +G Y V
Sbjct: 792 RSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWRLLVQGTYKV 851

Query: 673 TASAPGYEPVTTEPLDVPDTESVRLDFMLGKKNAFV 708
           TASA GY+PV T+ ++V     V+++F L + +A V
Sbjct: 852 TASARGYDPV-TKTVEVDSKGGVQVNFTLSRTDAKV 886

Anas platyrhynchos (taxid: 8839)
EC: 3EC: .EC: 4EC: .EC: 1EC: 7EC: .EC: 2EC: 2
>sp|P42787|CBPD_DROME Carboxypeptidase D OS=Drosophila melanogaster GN=svr PE=1 SV=2 Back     alignment and function description
>sp|Q9JHW1|CBPD_RAT Carboxypeptidase D OS=Rattus norvegicus GN=Cpd PE=2 SV=2 Back     alignment and function description
>sp|O75976|CBPD_HUMAN Carboxypeptidase D OS=Homo sapiens GN=CPD PE=1 SV=2 Back     alignment and function description
>sp|O89001|CBPD_MOUSE Carboxypeptidase D OS=Mus musculus GN=Cpd PE=1 SV=2 Back     alignment and function description
>sp|P14384|CBPM_HUMAN Carboxypeptidase M OS=Homo sapiens GN=CPM PE=1 SV=2 Back     alignment and function description
>sp|Q5RFD6|CBPM_PONAB Carboxypeptidase M OS=Pongo abelii GN=CPM PE=2 SV=1 Back     alignment and function description
>sp|P83852|CBPD_LOPSP Carboxypeptidase D (Fragment) OS=Lophonetta specularioides GN=CPD PE=1 SV=1 Back     alignment and function description
>sp|P37892|CBPE_LOPAM Carboxypeptidase E OS=Lophius americanus GN=cpe PE=2 SV=1 Back     alignment and function description
>sp|Q00493|CBPE_MOUSE Carboxypeptidase E OS=Mus musculus GN=Cpe PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query710
348542405 1360 PREDICTED: carboxypeptidase D [Oreochrom 0.7 0.365 0.417 1e-109
242015953 1268 carboxypeptidase D precursor, putative [ 0.684 0.383 0.400 1e-107
405963422 1793 Carboxypeptidase D [Crassostrea gigas] 0.738 0.292 0.395 1e-107
340715096 1676 PREDICTED: LOW QUALITY PROTEIN: carboxyp 0.695 0.294 0.394 1e-107
270009281 909 carboxypeptidase A [Tribolium castaneum] 0.683 0.533 0.406 1e-106
91084647 1366 PREDICTED: similar to AGAP002414-PA [Tri 0.683 0.355 0.406 1e-106
350414709 1616 PREDICTED: carboxypeptidase D-like isofo 0.695 0.305 0.392 1e-106
432892281 1366 PREDICTED: carboxypeptidase D-like [Oryz 0.694 0.360 0.406 1e-106
350414706 1675 PREDICTED: carboxypeptidase D-like isofo 0.695 0.294 0.392 1e-105
198434646 962 PREDICTED: similar to carboxypeptidase D 0.704 0.519 0.389 1e-105
>gi|348542405|ref|XP_003458675.1| PREDICTED: carboxypeptidase D [Oreochromis niloticus] Back     alignment and taxonomy information
 Score =  404 bits (1037), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 230/551 (41%), Positives = 311/551 (56%), Gaps = 54/551 (9%)

Query: 172 MQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTY- 230
           MQD+NY+H NC EITMELSCCKYP AS+L+  W  N+ESL+  IE VH GV G V D   
Sbjct: 302 MQDYNYIHGNCLEITMELSCCKYPSASELQREWDLNRESLLAYIEQVHIGVRGYVKDAVS 361

Query: 231 GNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESV 290
           G  L +  I V      +     G+Y+RLL  G Y +TA APGY   T   ++V + ++ 
Sbjct: 362 GAALSNVSIVVAGIRHNLMTGKYGDYYRLLLPGTYNITAVAPGYISATVSSVEVSEGKAK 421

Query: 291 RLDFMLGKKNAFSIDQLKNPFIEIMTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDA 350
            L+F L       + +       + T  VPS+S    H   ST +        +      
Sbjct: 422 ELNFTLTP----VVSEAAGNSTTVATTSVPSIS----HPDNSTTSSSGSTQTPVVTSVSP 473

Query: 351 DSAGIDLQ----RYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDN 406
            S  +  Q    R++N  +++ F+ K    +P +    +IG+SV+ R L+ + I+   DN
Sbjct: 474 TSHQLANQPQEFRHHNYADMELFLRKYSSEFPSITNLYSIGQSVEKRELYVMVIS---DN 530

Query: 407 PDGRTLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSI 466
           PD     +P FKYVANMHG+E VG  LM+ LI+YL    G D  +T+L+N+T I+I+PS+
Sbjct: 531 PDTHEHGEPEFKYVANMHGNEVVGRELMLNLIEYLCRNYGTDPEVTELVNNTRIHIMPSM 590

Query: 467 NPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQAIMNFIYSN 526
           NPDG+  A+EG   S   Y GR N +  DLNRNFPDQF     +  +PET+A+M ++ S 
Sbjct: 591 NPDGYEVAEEGDISS---YKGRNNTNNFDLNRNFPDQFA-NITEPRQPETKAVMKWLKSI 646

Query: 527 PFVLSGNLHGGA----------------------------VARDYASRNPMMAPGHAC-- 556
           PFVLS NLHGG+                            V+R Y+  NP+M  GH C  
Sbjct: 647 PFVLSANLHGGSLVVNYPFDDDKDGNSFYSKSPDDEVFQQVSRAYSQENPLMHQGHPCKD 706

Query: 557 ---GFDFKDGITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANK 613
                 FKDGITNG  WY V GGMQD+NY+++NCFE+T+ELSC KYP A DL  YW  N+
Sbjct: 707 LYPNESFKDGITNGAQWYSVPGGMQDWNYINTNCFEVTIELSCVKYPLAKDLPKYWDQNR 766

Query: 614 ESLIKLIENVHRGVYGIVTDTY-GNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVV 672
            SL++ I  VH GV G V+D + G  +P+A I+V   +  +T    G+YWRLL  G Y +
Sbjct: 767 RSLLQFIHQVHTGVKGTVSDIWNGTGIPNATISVEKINHNITTAQTGDYWRLLVPGTYAI 826

Query: 673 TASAPGYEPVT 683
           TASA GY+PVT
Sbjct: 827 TASAHGYKPVT 837

Source: Oreochromis niloticus

Species: Oreochromis niloticus

Genus: Oreochromis

Family: Cichlidae

Order: Perciformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota
>gi|242015953|ref|XP_002428607.1| carboxypeptidase D precursor, putative [Pediculus humanus corporis] gi|212513251|gb|EEB15869.1| carboxypeptidase D precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|405963422|gb|EKC28996.1| Carboxypeptidase D [Crassostrea gigas] Back     alignment and taxonomy information
>gi|340715096|ref|XP_003396056.1| PREDICTED: LOW QUALITY PROTEIN: carboxypeptidase D-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|270009281|gb|EFA05729.1| carboxypeptidase A [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91084647|ref|XP_966816.1| PREDICTED: similar to AGAP002414-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350414709|ref|XP_003490394.1| PREDICTED: carboxypeptidase D-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|432892281|ref|XP_004075743.1| PREDICTED: carboxypeptidase D-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|350414706|ref|XP_003490393.1| PREDICTED: carboxypeptidase D-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|198434646|ref|XP_002129550.1| PREDICTED: similar to carboxypeptidase D [Ciona intestinalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query710
ZFIN|ZDB-GENE-081112-21350 cpda "carboxypeptidase D, a" [ 0.690 0.362 0.351 1.7e-99
UNIPROTKB|E2R8301379 CPD "Uncharacterized protein" 0.687 0.353 0.345 1.5e-93
UNIPROTKB|E1BLR91108 LOC532189 "Uncharacterized pro 0.497 0.318 0.355 6.9e-73
UNIPROTKB|F1RN681374 CPD "Uncharacterized protein" 0.687 0.355 0.343 1.8e-92
MGI|MGI:1072651377 Cpd "carboxypeptidase D" [Mus 0.694 0.358 0.336 1.2e-93
RGD|23931378 Cpd "carboxypeptidase D" [Ratt 0.669 0.344 0.337 6.4e-92
UNIPROTKB|Q9JHW11378 Cpd "Carboxypeptidase D" [Ratt 0.669 0.344 0.337 6.4e-92
UNIPROTKB|O759761380 CPD "Carboxypeptidase D" [Homo 0.690 0.355 0.334 1.7e-91
FB|FBgn0004648 1406 svr "silver" [Drosophila melan 0.322 0.162 0.410 2.1e-77
UNIPROTKB|E1BYS4 1360 CPD "Uncharacterized protein" 0.505 0.263 0.356 2.4e-97
ZFIN|ZDB-GENE-081112-2 cpda "carboxypeptidase D, a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 717 (257.5 bits), Expect = 1.7e-99, Sum P(2) = 1.7e-99
 Identities = 189/538 (35%), Positives = 279/538 (51%)

Query:   172 MQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTY- 230
             MQD+NY+++NCFE+T+EL C KYP  +DL+ YW  N++SL++ I  VHRGV G+V D+  
Sbjct:   718 MQDWNYMNTNCFEVTIELGCHKYPPVADLQKYWEQNRKSLLQFIHQVHRGVKGMVIDSKD 777

Query:   231 GNPLPSAIITVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESV 290
             G+ +P+A ITV      VT ++ G+YWRLL  GKY +TASA GY   ++  + VP     
Sbjct:   778 GSGIPNATITVETIHHQVTSSSLGDYWRLLVPGKYKLTASAQGYMSDSSS-VTVPKDGLE 836

Query:   291 RLDFMLGKKNAFSIDQLKNPFIEIMTLIVPSLSLLLCHVTLSTAADYYFDFDDLTGLEDA 350
              ++F L +    +  Q       ++   V     L+    LST +      D L  ++D 
Sbjct:   837 IVNFTLTRIPTHANGQETENTTPVLDPSVREFQALIKQ--LSTQSG----LDKL--IQDT 888

Query:   351 DSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGR 410
              +      RY    E+  F+     ++P +    ++G+SV+ RN+WA+EI++   NP  +
Sbjct:   889 PTESSF--RYQQYGEVSEFLRGLTLNFPEITSLRSLGQSVEIRNIWALEISN---NPKVQ 943

Query:   411 TLMKPMFKYVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDG 470
                KP  ++VA +HG+  VG  L++   + L +  GK+  I +L+N T I I+PSINPDG
Sbjct:   944 EPSKPKIRFVAGIHGNAPVGTELLLEFAESLCVNYGKNAAINRLINETRIVILPSINPDG 1003

Query:   471 FAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQAIMNFIYSNPFVL 530
                AKE  C S    VG  N HG DL+ +F      +     +PET+A+MN I    F L
Sbjct:  1004 RELAKERDCTST---VGMTNVHGKDLDTDFIVGNASQRVSEPQPETRAVMNLIQERGFTL 1060

Query:   531 SGNLHGGA-------------VARD---------YASRNPMMAPGHA-CGFDFKDGITNG 567
             S  L GG+             V  D         YA  +P M  G+  C    +  I  G
Sbjct:  1061 SVALDGGSLLVTYPYDKPVQTVENDDTLRYLATVYADHHPTMHLGNTGCPNSVQSNIPGG 1120

Query:   568 ----NYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENV 623
                   W+   G M+DF+    +C EIT+  SCC +P A  L   WA N++SL+ ++  V
Sbjct:  1121 VLRAAVWHSHMGSMKDFSVDFGHCPEITVYTSCCLFPSAEMLPSLWAENRKSLLSMLVEV 1180

Query:   624 HRGVYGIVTDTYGNPLPSAIITVRWNDKAVTVTNRGEYWR-LLARGKYVVTASAPGYE 680
             H+GV GIV D  G P+  A I +  N      T+ G Y+  LLA G + + A A GY+
Sbjct:  1181 HKGVRGIVKDKNGKPIVGAAIVL--NGGVRVYTSEGGYFHALLAPGLHSIEAVADGYQ 1236
GO:0004181 "metallocarboxypeptidase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA
UNIPROTKB|E2R830 CPD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BLR9 LOC532189 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RN68 CPD "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:107265 Cpd "carboxypeptidase D" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2393 Cpd "carboxypeptidase D" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9JHW1 Cpd "Carboxypeptidase D" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O75976 CPD "Carboxypeptidase D" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0004648 svr "silver" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYS4 CPD "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.170.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
cd03868293 cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase 1e-126
cd03858293 cd03858, M14_CP_N-E_like, Peptidase M14 carboxypep 1e-126
cd03866292 cd03866, M14_CPM, Peptidase M14 carboxypeptidase s 2e-83
cd03863296 cd03863, M14_CPD_II, Peptidase M14 carboxypeptidas 3e-76
pfam00246277 pfam00246, Peptidase_M14, Zinc carboxypeptidase 3e-72
cd03864313 cd03864, M14_CPN, Peptidase M14 carboxypeptidase s 2e-69
smart00631277 smart00631, Zn_pept, Zn_pept domain 3e-66
cd03865323 cd03865, M14_CPE, Peptidase M14 carboxypeptidase s 3e-66
cd03867315 cd03867, M14_CPZ, Peptidase M14 carboxypeptidase s 1e-65
cd06245284 cd06245, M14_CPD_III, Peptidase M14 carboxypeptida 9e-57
cd03869326 cd03869, M14_CPX_like, Peptidase M14 carboxypeptid 4e-56
cd03868293 cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase 2e-45
cd03858293 cd03858, M14_CP_N-E_like, Peptidase M14 carboxypep 6e-45
smart00631277 smart00631, Zn_pept, Zn_pept domain 6e-37
pfam00246277 pfam00246, Peptidase_M14, Zinc carboxypeptidase 1e-31
cd03866292 cd03866, M14_CPM, Peptidase M14 carboxypeptidase s 3e-30
cd00596211 cd00596, Peptidase_M14_like, M14 family of metallo 3e-30
cd03859297 cd03859, M14_CPT, Peptidase M14 Carboxypeptidase T 3e-30
cd03863296 cd03863, M14_CPD_II, Peptidase M14 carboxypeptidas 4e-26
cd06245284 cd06245, M14_CPD_III, Peptidase M14 carboxypeptida 3e-24
cd1130876 cd11308, Peptidase_M14NE-CP-C_like, Peptidase asso 2e-23
cd1130876 cd11308, Peptidase_M14NE-CP-C_like, Peptidase asso 2e-23
cd03860293 cd03860, M14_CP_A-B_like, Peptidase M14 carboxypep 7e-23
cd03858293 cd03858, M14_CP_N-E_like, Peptidase M14 carboxypep 1e-21
cd03867315 cd03867, M14_CPZ, Peptidase M14 carboxypeptidase s 2e-21
cd03859297 cd03859, M14_CPT, Peptidase M14 Carboxypeptidase T 5e-21
cd03864313 cd03864, M14_CPN, Peptidase M14 carboxypeptidase s 2e-20
cd03868293 cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase 3e-20
cd06905360 cd06905, M14-like_8, Peptidase M14-like domain; un 5e-19
cd06905360 cd06905, M14-like_8, Peptidase M14-like domain; un 5e-19
cd03865323 cd03865, M14_CPE, Peptidase M14 carboxypeptidase s 9e-19
cd03869326 cd03869, M14_CPX_like, Peptidase M14 carboxypeptid 2e-18
cd03857226 cd03857, M14-like_1, Peptidase M14-like domain; un 1e-16
cd06904178 cd06904, M14_MpaA_like, Peptidase M14-like domain 4e-16
cd03860293 cd03860, M14_CP_A-B_like, Peptidase M14 carboxypep 5e-16
cd03864313 cd03864, M14_CPN, Peptidase M14 carboxypeptidase s 7e-15
cd06248303 cd06248, M14_CP_A-B_like_1, Peptidase M14 carboxyp 7e-15
cd06226293 cd06226, M14_CPT_like, Peptidase M14 Carboxypeptid 8e-14
pfam1362081 pfam13620, CarboxypepD_reg, Carboxypeptidase regul 2e-13
pfam1362081 pfam13620, CarboxypepD_reg, Carboxypeptidase regul 2e-13
cd06229256 cd06229, M14_Endopeptidase_I, Peptidase M14 carbox 3e-13
cd03866292 cd03866, M14_CPM, Peptidase M14 carboxypeptidase s 4e-13
cd03865323 cd03865, M14_CPE, Peptidase M14 carboxypeptidase s 7e-13
cd03863296 cd03863, M14_CPD_II, Peptidase M14 carboxypeptidas 2e-12
cd03857226 cd03857, M14-like_1, Peptidase M14-like domain; un 4e-12
cd03867315 cd03867, M14_CPZ, Peptidase M14 carboxypeptidase s 2e-11
cd03869326 cd03869, M14_CPX_like, Peptidase M14 carboxypeptid 2e-11
cd06239231 cd06239, M14-like_1_2, Peptidase M14-like domain; 4e-11
cd06227269 cd06227, M14-like_2, Peptidase M14-like domain; un 1e-10
cd06248303 cd06248, M14_CP_A-B_like_1, Peptidase M14 carboxyp 2e-10
cd03870301 cd03870, M14_CPA, Peptidase M14 carboxypeptidase s 6e-10
cd00596211 cd00596, Peptidase_M14_like, M14 family of metallo 1e-09
cd06246302 cd06246, M14_CPB2, Peptidase M14 carboxypeptidase 2e-09
COG2866374 COG2866, COG2866, Predicted carboxypeptidase [Amin 2e-09
cd03862273 cd03862, M14-like_7, Peptidase M14-like domain; un 2e-09
cd06243236 cd06243, M14-like_1_6, Peptidase M14-like domain; 2e-09
cd06245284 cd06245, M14_CPD_III, Peptidase M14 carboxypeptida 5e-09
cd06237245 cd06237, M14_Nna1_like_3, Peptidase M14-like domai 9e-09
cd03871300 cd03871, M14_CPB, Peptidase M14 carboxypeptidase s 9e-08
cd06243236 cd06243, M14-like_1_6, Peptidase M14-like domain; 2e-07
cd06226293 cd06226, M14_CPT_like, Peptidase M14 Carboxypeptid 3e-07
cd06234263 cd06234, M14_Nna1_like_1, Peptidase M14-like domai 3e-07
cd03870301 cd03870, M14_CPA, Peptidase M14 carboxypeptidase s 4e-07
cd06239231 cd06239, M14-like_1_2, Peptidase M14-like domain; 6e-07
cd03872300 cd03872, M14_CPA6, Peptidase M14 carboxypeptidase 6e-07
PRK10602237 PRK10602, PRK10602, murein peptide amidase A; Prov 8e-07
cd06242268 cd06242, M14-like_1_5, Peptidase M14-like domain; 1e-06
cd06246302 cd06246, M14_CPB2, Peptidase M14 carboxypeptidase 4e-06
cd06247298 cd06247, M14_CPO, Peptidase M14 carboxypeptidase s 8e-06
cd06234263 cd06234, M14_Nna1_like_1, Peptidase M14-like domai 1e-05
cd03871300 cd03871, M14_CPB, Peptidase M14 carboxypeptidase s 3e-05
cd06250359 cd06250, M14_PaAOTO_like, Peptidase M14 Succinylgl 4e-05
cd06244268 cd06244, M14-like_1_7, Peptidase M14-like domain; 4e-05
cd03856258 cd03856, M14_Nna1_like, Peptidase M14-like domain 4e-05
pfam00246277 pfam00246, Peptidase_M14, Zinc carboxypeptidase 5e-05
cd06908261 cd06908, M14_AGBL4_like, Peptidase M14-like domain 5e-05
cd06241266 cd06241, M14-like_1_4, Peptidase M14-like domain; 8e-05
cd06242268 cd06242, M14-like_1_5, Peptidase M14-like domain; 2e-04
cd06238270 cd06238, M14-like_1_1, Peptidase M14-like domain; 3e-04
cd06238270 cd06238, M14-like_1_1, Peptidase M14-like domain; 3e-04
cd06235258 cd06235, M14_Nna1_like_2, Peptidase M14-like domai 3e-04
COG3608331 COG3608, COG3608, Predicted deacylase [General fun 3e-04
cd03872300 cd03872, M14_CPA6, Peptidase M14 carboxypeptidase 5e-04
pfam1371586 pfam13715, Cna_B_2, Cna protein B-type domain 8e-04
pfam1371586 pfam13715, Cna_B_2, Cna protein B-type domain 8e-04
cd06229256 cd06229, M14_Endopeptidase_I, Peptidase M14 carbox 0.002
cd06907261 cd06907, M14_AGBL2-3_like, Peptidase M14-like doma 0.003
COG2866374 COG2866, COG2866, Predicted carboxypeptidase [Amin 0.004
>gnl|CDD|199850 cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain I subgroup Back     alignment and domain information 
 Score =  377 bits (969), Expect = e-126
 Identities = 148/296 (50%), Positives = 192/296 (64%), Gaps = 38/296 (12%)

Query: 360 YYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKY 419
           Y++  EL   +    K+YP + R  +IG+SV+GR+LWA+ I+   DN + R   +PMFKY
Sbjct: 1   YHHYDELTDLLASLEKAYPDIARLHSIGRSVEGRDLWALRIS---DNVNSREPGRPMFKY 57

Query: 420 VANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKC 479
           V NMHGDETVG  ++++L QYL+   G D R+T+L+N+TDIY++PS+NPDGF  ++EG C
Sbjct: 58  VGNMHGDETVGRQVLIYLAQYLLENYGGDPRVTRLVNTTDIYLMPSMNPDGFERSQEGDC 117

Query: 480 DSLDGYVGRKNAHGVDLNRNFPDQFE--YEAKKVYEPETQAIMNFIYSNPFVLSGNLHGG 537
               GY GR NA+ VDLNRNFPDQFE  +   +  +PET A++N+I SNPFVLS NLHGG
Sbjct: 118 S-CGGYGGRGNANNVDLNRNFPDQFEGKHVRAQERQPETLAMINWIRSNPFVLSANLHGG 176

Query: 538 AV------------------------------ARDYASRNPMMAPGHACGFD--FKDGIT 565
           +V                              A  YAS +P M  G  C  +  FKDGIT
Sbjct: 177 SVVASYPYDDSSSHNECGVYSKSPDDAVFRYLALTYASNHPTMRTGKPCCENETFKDGIT 236

Query: 566 NGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIE 621
           NG +WY V GGMQD+NY+HSNCFEIT+ELSCCKYP AS+L   W  N+ESL+  IE
Sbjct: 237 NGAHWYDVPGGMQDYNYLHSNCFEITLELSCCKYPPASELPQEWNNNRESLLAYIE 292

The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3.4.17.22), domain I. CPD differs from all other metallocarboxypeptidases in that it contains multiple CP-like domains. CPD belongs to the N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs).The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPD is a single-chain protein containing a signal peptide, three tandem repeats of CP-like domains separated by short bridge regions, followed by a transmembrane domain, and a C-terminal cytosolic tail. The first two CP-like domains of CPD contain all of the essential active site and substrate-binding residues, the third CP-like domain lacks critical residues necessary for enzymatic activity and is inactive towards standard CP substrates. Domain I is optimally active at pH 6.3-7.5 and prefers substrates with C-terminal Arg, whereas domain II is active at pH 5.0-6.5 and prefers substrates with C-terminal Lys. This Domain I family contains two contiguous surface cysteines that may become palmitoylated and target the enzyme to membranes, thus regulating intracellular trafficking. CPD functions in the processing of proteins that transit the secretory pathway, and is present in all vertebrates as well as Drosophila. It is broadly distributed in all tissue types. Within cells, CPD is present in the trans Golgi network and immature secretory vesicles, but is excluded from mature vesicles. It is thought to play a role in the processing of proteins that are initially processed by furin or related endopeptidases present in the trans Golgi network, such as growth factors and receptors. CPD is implicated in the pathogenesis of lupus erythematosus (LE), it is regulated by TGF-beta in various cell types of murine and human origin and is significantly down-regulated in CD14 positive cells isolated from patients with LE. As down-regulation of CPD leads to down-modulation of TGF-beta, CPD may have a role in a positive feedback loop. In D. melanogaster, the CPD variant 1B short (DmCPD1Bs) is necessary and sufficient for viability of the fruit fly. Length = 293
>gnl|CDD|199842 cd03858, M14_CP_N-E_like, Peptidase M14 carboxypeptidase subfamily N/E-like Back     alignment and domain information
>gnl|CDD|199848 cd03866, M14_CPM, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase M subgroup Back     alignment and domain information
>gnl|CDD|199845 cd03863, M14_CPD_II, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain II subgroup Back     alignment and domain information
>gnl|CDD|215816 pfam00246, Peptidase_M14, Zinc carboxypeptidase Back     alignment and domain information
>gnl|CDD|199846 cd03864, M14_CPN, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase N subgroup Back     alignment and domain information
>gnl|CDD|214748 smart00631, Zn_pept, Zn_pept domain Back     alignment and domain information
>gnl|CDD|199847 cd03865, M14_CPE, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase E subgroup Back     alignment and domain information
>gnl|CDD|199849 cd03867, M14_CPZ, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase Z subgroup Back     alignment and domain information
>gnl|CDD|199867 cd06245, M14_CPD_III, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain III subgroup Back     alignment and domain information
>gnl|CDD|199851 cd03869, M14_CPX_like, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase X subgroup Back     alignment and domain information
>gnl|CDD|199850 cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain I subgroup Back     alignment and domain information
>gnl|CDD|199842 cd03858, M14_CP_N-E_like, Peptidase M14 carboxypeptidase subfamily N/E-like Back     alignment and domain information
>gnl|CDD|214748 smart00631, Zn_pept, Zn_pept domain Back     alignment and domain information
>gnl|CDD|215816 pfam00246, Peptidase_M14, Zinc carboxypeptidase Back     alignment and domain information
>gnl|CDD|199848 cd03866, M14_CPM, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase M subgroup Back     alignment and domain information
>gnl|CDD|199839 cd00596, Peptidase_M14_like, M14 family of metallocarboxypeptidases and related proteins Back     alignment and domain information
>gnl|CDD|199843 cd03859, M14_CPT, Peptidase M14 Carboxypeptidase T subfamily Back     alignment and domain information
>gnl|CDD|199845 cd03863, M14_CPD_II, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain II subgroup Back     alignment and domain information
>gnl|CDD|199867 cd06245, M14_CPD_III, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain III subgroup Back     alignment and domain information
>gnl|CDD|200604 cd11308, Peptidase_M14NE-CP-C_like, Peptidase associated domain: C-terminal domain of M14 N/E carboxypeptidase; putative folding, regulation, or interaction domain Back     alignment and domain information
>gnl|CDD|200604 cd11308, Peptidase_M14NE-CP-C_like, Peptidase associated domain: C-terminal domain of M14 N/E carboxypeptidase; putative folding, regulation, or interaction domain Back     alignment and domain information
>gnl|CDD|199844 cd03860, M14_CP_A-B_like, Peptidase M14 carboxypeptidase subfamily A/B-like Back     alignment and domain information
>gnl|CDD|199842 cd03858, M14_CP_N-E_like, Peptidase M14 carboxypeptidase subfamily N/E-like Back     alignment and domain information
>gnl|CDD|199849 cd03867, M14_CPZ, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase Z subgroup Back     alignment and domain information
>gnl|CDD|199843 cd03859, M14_CPT, Peptidase M14 Carboxypeptidase T subfamily Back     alignment and domain information
>gnl|CDD|199846 cd03864, M14_CPN, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase N subgroup Back     alignment and domain information
>gnl|CDD|199850 cd03868, M14_CPD_I, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain I subgroup Back     alignment and domain information
>gnl|CDD|199875 cd06905, M14-like_8, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|199875 cd06905, M14-like_8, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|199847 cd03865, M14_CPE, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase E subgroup Back     alignment and domain information
>gnl|CDD|199851 cd03869, M14_CPX_like, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase X subgroup Back     alignment and domain information
>gnl|CDD|133069 cd03857, M14-like_1, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|133114 cd06904, M14_MpaA_like, Peptidase M14-like domain of Escherichia coli Murein Peptide Amidase A and related proteins Back     alignment and domain information
>gnl|CDD|199844 cd03860, M14_CP_A-B_like, Peptidase M14 carboxypeptidase subfamily A/B-like Back     alignment and domain information
>gnl|CDD|199846 cd03864, M14_CPN, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase N subgroup Back     alignment and domain information
>gnl|CDD|199869 cd06248, M14_CP_A-B_like_1, Peptidase M14 carboxypeptidase subfamily A/B-like; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|133084 cd06226, M14_CPT_like, Peptidase M14 Carboxypeptidase T-like subfamily Back     alignment and domain information
>gnl|CDD|222268 pfam13620, CarboxypepD_reg, Carboxypeptidase regulatory-like domain Back     alignment and domain information
>gnl|CDD|222268 pfam13620, CarboxypepD_reg, Carboxypeptidase regulatory-like domain Back     alignment and domain information
>gnl|CDD|199855 cd06229, M14_Endopeptidase_I, Peptidase M14 carboxypeptidase family-like domain of Endopeptidase I Back     alignment and domain information
>gnl|CDD|199848 cd03866, M14_CPM, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase M subgroup Back     alignment and domain information
>gnl|CDD|199847 cd03865, M14_CPE, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase E subgroup Back     alignment and domain information
>gnl|CDD|199845 cd03863, M14_CPD_II, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain II subgroup Back     alignment and domain information
>gnl|CDD|133069 cd03857, M14-like_1, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|199849 cd03867, M14_CPZ, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase Z subgroup Back     alignment and domain information
>gnl|CDD|199851 cd03869, M14_CPX_like, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase X subgroup Back     alignment and domain information
>gnl|CDD|199863 cd06239, M14-like_1_2, Peptidase M14-like domain; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|199854 cd06227, M14-like_2, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|199869 cd06248, M14_CP_A-B_like_1, Peptidase M14 carboxypeptidase subfamily A/B-like; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|133081 cd03870, M14_CPA, Peptidase M14 carboxypeptidase subfamily A/B-like; Carboxypeptidase A subgroup Back     alignment and domain information
>gnl|CDD|199839 cd00596, Peptidase_M14_like, M14 family of metallocarboxypeptidases and related proteins Back     alignment and domain information
>gnl|CDD|199868 cd06246, M14_CPB2, Peptidase M14 carboxypeptidase subfamily A/B-like; Carboxypeptidase B2 subgroup Back     alignment and domain information
>gnl|CDD|225421 COG2866, COG2866, Predicted carboxypeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|133073 cd03862, M14-like_7, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|133101 cd06243, M14-like_1_6, Peptidase M14-like domain; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|199867 cd06245, M14_CPD_III, Peptidase M14 carboxypeptidase subfamily N/E-like; Carboxypeptidase D, domain III subgroup Back     alignment and domain information
>gnl|CDD|199861 cd06237, M14_Nna1_like_3, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases; uncharacterized bacterial subgroup Back     alignment and domain information
>gnl|CDD|199852 cd03871, M14_CPB, Peptidase M14 carboxypeptidase subfamily A/B-like; Carboxypeptidase B subgroup Back     alignment and domain information
>gnl|CDD|133101 cd06243, M14-like_1_6, Peptidase M14-like domain; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|133084 cd06226, M14_CPT_like, Peptidase M14 Carboxypeptidase T-like subfamily Back     alignment and domain information
>gnl|CDD|199858 cd06234, M14_Nna1_like_1, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases; uncharacterized bacterial subgroup Back     alignment and domain information
>gnl|CDD|133081 cd03870, M14_CPA, Peptidase M14 carboxypeptidase subfamily A/B-like; Carboxypeptidase A subgroup Back     alignment and domain information
>gnl|CDD|199863 cd06239, M14-like_1_2, Peptidase M14-like domain; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|199853 cd03872, M14_CPA6, Peptidase M14 carboxypeptidase subfamily A/B-like; Carboxypeptidase A6 subgroup Back     alignment and domain information
>gnl|CDD|182582 PRK10602, PRK10602, murein peptide amidase A; Provisional Back     alignment and domain information
>gnl|CDD|133100 cd06242, M14-like_1_5, Peptidase M14-like domain; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|199868 cd06246, M14_CPB2, Peptidase M14 carboxypeptidase subfamily A/B-like; Carboxypeptidase B2 subgroup Back     alignment and domain information
>gnl|CDD|133105 cd06247, M14_CPO, Peptidase M14 carboxypeptidase subfamily A/B-like; Carboxypeptidase O subgroup Back     alignment and domain information
>gnl|CDD|199858 cd06234, M14_Nna1_like_1, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases; uncharacterized bacterial subgroup Back     alignment and domain information
>gnl|CDD|199852 cd03871, M14_CPB, Peptidase M14 carboxypeptidase subfamily A/B-like; Carboxypeptidase B subgroup Back     alignment and domain information
>gnl|CDD|199870 cd06250, M14_PaAOTO_like, Peptidase M14 Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA)-like subfamily; subgroup includes Pseudomonas aeruginosa AotO Back     alignment and domain information
>gnl|CDD|199866 cd06244, M14-like_1_7, Peptidase M14-like domain; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|199841 cd03856, M14_Nna1_like, Peptidase M14-like domain of ATP/GTP binding proteins, cytosolic carboxypeptidases and related proteins Back     alignment and domain information
>gnl|CDD|215816 pfam00246, Peptidase_M14, Zinc carboxypeptidase Back     alignment and domain information
>gnl|CDD|133118 cd06908, M14_AGBL4_like, Peptidase M14-like domain of ATP/GTP binding protein AGBL-4 and related proteins Back     alignment and domain information
>gnl|CDD|199865 cd06241, M14-like_1_4, Peptidase M14-like domain; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|133100 cd06242, M14-like_1_5, Peptidase M14-like domain; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|199862 cd06238, M14-like_1_1, Peptidase M14-like domain; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|199862 cd06238, M14-like_1_1, Peptidase M14-like domain; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|199859 cd06235, M14_Nna1_like_2, Peptidase M14-like domain of human Nna1/AGTPBP-1, AGBL2 -5, and related proteins Back     alignment and domain information
>gnl|CDD|226135 COG3608, COG3608, Predicted deacylase [General function prediction only] Back     alignment and domain information
>gnl|CDD|199853 cd03872, M14_CPA6, Peptidase M14 carboxypeptidase subfamily A/B-like; Carboxypeptidase A6 subgroup Back     alignment and domain information
>gnl|CDD|222338 pfam13715, Cna_B_2, Cna protein B-type domain Back     alignment and domain information
>gnl|CDD|222338 pfam13715, Cna_B_2, Cna protein B-type domain Back     alignment and domain information
>gnl|CDD|199855 cd06229, M14_Endopeptidase_I, Peptidase M14 carboxypeptidase family-like domain of Endopeptidase I Back     alignment and domain information
>gnl|CDD|133117 cd06907, M14_AGBL2-3_like, Peptidase M14-like domain of ATP/GTP binding protein AGBL-2 and AGBL-3, and related proteins Back     alignment and domain information
>gnl|CDD|225421 COG2866, COG2866, Predicted carboxypeptidase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 710
cd03863375 M14_CPD_II The second carboxypeptidase (CP)-like d 100.0
cd03869405 M14_CPX_like Peptidase M14-like domain of carboxyp 100.0
cd03865402 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (C 100.0
cd03864392 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, als 100.0
KOG2649|consensus500 100.0
cd06245363 M14_CPD_III The third carboxypeptidase (CP)-like d 100.0
cd03866376 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM 100.0
cd03868372 M14_CPD_I The first carboxypeptidase (CP)-like dom 100.0
cd03867395 M14_CPZ Peptidase M14-like domain of carboxypeptid 100.0
cd03858374 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like sub 100.0
cd03869405 M14_CPX_like Peptidase M14-like domain of carboxyp 100.0
KOG2649|consensus500 100.0
cd03865402 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (C 100.0
cd03863375 M14_CPD_II The second carboxypeptidase (CP)-like d 100.0
cd06245363 M14_CPD_III The third carboxypeptidase (CP)-like d 100.0
cd03864392 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, als 100.0
cd03866376 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM 100.0
KOG2650|consensus418 100.0
cd03868372 M14_CPD_I The first carboxypeptidase (CP)-like dom 100.0
cd03867395 M14_CPZ Peptidase M14-like domain of carboxypeptid 100.0
cd03870301 M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA 100.0
cd03871300 M14_CPB Peptidase M14 Carboxypeptidase B (CPB) bel 100.0
cd06247298 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO 100.0
cd06246300 M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (C 100.0
cd03859295 M14_CPT Peptidase M14-like domain of carboxypeptid 100.0
cd06248304 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/ 100.0
cd03872300 M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also know 100.0
cd06226293 M14_CPT_like Peptidase M14-like domain of an uncha 100.0
cd03860294 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase 100.0
cd03858374 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like sub 100.0
smart00631277 Zn_pept Zn_pept. 100.0
cd06905360 Peptidase_M14-like_8 A functionally uncharacterize 100.0
PF00246279 Peptidase_M14: Zinc carboxypeptidase This is famil 100.0
cd06227272 Peptidase_M14-like_2 A functionally uncharacterize 100.0
cd06228332 Peptidase_M14-like_3 A functionally uncharacterize 100.0
cd06229255 M14_Endopeptidase_I Peptidase M14-like domain of G 100.0
cd06237244 M14_Nna1_like_3 A bacterial subgroup of the Peptid 100.0
KOG2650|consensus418 100.0
cd06234263 M14_Nna1_like_1 A bacterial subgroup of the Peptid 100.0
cd03856269 M14_Nna1_like Peptidase M14-like domain of Nna-1 ( 100.0
cd06908261 M14_AGBL4_like Peptidase M14-like domain of ATP/GT 100.0
cd03862273 Peptidase_M14-like_7 A functionally uncharacterize 100.0
cd06242268 Peptidase_M14-like_1_5 Peptidase M14-like domain o 99.97
PRK10602237 murein peptide amidase A; Provisional 99.97
cd03871300 M14_CPB Peptidase M14 Carboxypeptidase B (CPB) bel 99.97
cd06247298 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO 99.97
cd06235258 M14_Nna1_like_2 Subgroup of the Peptidase M14-like 99.97
cd03872300 M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also know 99.97
cd03870301 M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA 99.97
cd06246300 M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (C 99.96
cd06238271 Peptidase_M14-like_1_1 Peptidase M14-like domain o 99.96
cd00596196 Peptidase_M14_like The M14 family of metallocarbox 99.96
cd06239231 Peptidase_M14-like_1_2 Peptidase M14-like domain o 99.96
cd06905360 Peptidase_M14-like_8 A functionally uncharacterize 99.96
cd06248304 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/ 99.95
cd06241266 Peptidase_M14-like_1_4 Peptidase M14-like domain o 99.95
cd06243236 Peptidase_M14-like_1_6 Peptidase M14-like domain o 99.95
cd03859295 M14_CPT Peptidase M14-like domain of carboxypeptid 99.95
cd06244268 Peptidase_M14-like_1_7 Peptidase M14-like domain o 99.95
cd06236304 M14_AGBL5_like Peptidase M14-like domain of ATP/GT 99.95
cd06907261 M14_AGBL2-3_like Peptidase M14-like domain of ATP/ 99.95
cd06904178 M14_MpaA_like Peptidase M14-like domain of Escheri 99.94
cd06227272 Peptidase_M14-like_2 A functionally uncharacterize 99.93
smart00631277 Zn_pept Zn_pept. 99.93
cd03860294 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase 99.93
cd03857226 Peptidase_M14-like_1 Peptidase M14-like domain of 99.92
cd06240273 Peptidase_M14-like_1_3 Peptidase M14-like domain o 99.92
cd06906278 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervo 99.91
PF00246279 Peptidase_M14: Zinc carboxypeptidase This is famil 99.9
cd06226293 M14_CPT_like Peptidase M14-like domain of an uncha 99.9
cd06231236 Peptidase_M14-like_4 A functionally uncharacterize 99.88
cd06242268 Peptidase_M14-like_1_5 Peptidase M14-like domain o 99.87
cd06228332 Peptidase_M14-like_3 A functionally uncharacterize 99.85
cd06232240 Peptidase_M14-like_5 Peptidase M14-like domain of 99.84
cd06234263 M14_Nna1_like_1 A bacterial subgroup of the Peptid 99.84
cd06237244 M14_Nna1_like_3 A bacterial subgroup of the Peptid 99.83
cd06908261 M14_AGBL4_like Peptidase M14-like domain of ATP/GT 99.82
cd06229255 M14_Endopeptidase_I Peptidase M14-like domain of G 99.8
cd06239231 Peptidase_M14-like_1_2 Peptidase M14-like domain o 99.78
cd06241266 Peptidase_M14-like_1_4 Peptidase M14-like domain o 99.76
cd03856269 M14_Nna1_like Peptidase M14-like domain of Nna-1 ( 99.76
cd06243236 Peptidase_M14-like_1_6 Peptidase M14-like domain o 99.74
cd06240273 Peptidase_M14-like_1_3 Peptidase M14-like domain o 99.73
cd06235258 M14_Nna1_like_2 Subgroup of the Peptidase M14-like 99.71
cd06244268 Peptidase_M14-like_1_7 Peptidase M14-like domain o 99.69
cd06236304 M14_AGBL5_like Peptidase M14-like domain of ATP/GT 99.68
cd06907261 M14_AGBL2-3_like Peptidase M14-like domain of ATP/ 99.66
cd03862273 Peptidase_M14-like_7 A functionally uncharacterize 99.65
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 99.65
cd03857226 Peptidase_M14-like_1 Peptidase M14-like domain of 99.64
cd06238271 Peptidase_M14-like_1_1 Peptidase M14-like domain o 99.64
PRK10602237 murein peptide amidase A; Provisional 99.61
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 99.59
KOG3641|consensus650 99.58
cd06232240 Peptidase_M14-like_5 Peptidase M14-like domain of 99.54
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 99.53
cd06906278 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervo 99.52
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 99.52
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 99.51
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 99.48
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterize 99.47
cd06233283 Peptidase_M14-like_6 Peptidase M14-like domain of 99.44
PF04952292 AstE_AspA: Succinylglutamate desuccinylase / Aspar 99.38
cd06231236 Peptidase_M14-like_4 A functionally uncharacterize 99.37
cd00596196 Peptidase_M14_like The M14 family of metallocarbox 99.36
cd06230252 M14_ASTE_ASPA_like The Peptidase M14 Succinylgluta 99.35
PF1371588 DUF4480: Domain of unknown function (DUF4480) 99.32
PF1362082 CarboxypepD_reg: Carboxypeptidase regulatory-like 99.26
COG3608331 Predicted deacylase [General function prediction o 99.25
COG2866374 Predicted carboxypeptidase [Amino acid transport a 99.21
cd06904178 M14_MpaA_like Peptidase M14-like domain of Escheri 99.21
PF10994341 DUF2817: Protein of unknown function (DUF2817); In 99.2
PF1362082 CarboxypepD_reg: Carboxypeptidase regulatory-like 99.18
PF1371588 DUF4480: Domain of unknown function (DUF4480) 99.12
PRK02259288 aspartoacylase; Provisional 99.04
cd06256327 M14_ASTE_ASPA_like_6 A functionally uncharacterize 99.04
cd06909282 M14_ASPA Aspartoacylase (ASPA) belongs to the Succ 99.01
cd03855322 M14_ASTE Peptidase M14 Succinylglutamate desucciny 98.98
PRK05324329 succinylglutamate desuccinylase; Provisional 98.96
cd06910272 M14_ASTE_ASPA_like_7 A functionally uncharacterize 98.94
TIGR03242319 arg_catab_astE succinylglutamate desuccinylase. Me 98.9
COG2866374 Predicted carboxypeptidase [Amino acid transport a 98.64
cd06233283 Peptidase_M14-like_6 Peptidase M14-like domain of 98.41
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the 98.38
KOG3641|consensus650 98.36
COG2988324 Succinylglutamate desuccinylase [Amino acid transp 98.3
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterize 97.94
cd06251287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 97.93
cd06230252 M14_ASTE_ASPA_like The Peptidase M14 Succinylgluta 97.85
cd06254288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 97.81
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 97.77
PF08400134 phage_tail_N: Prophage tail fibre N-terminal; Inte 97.76
TIGR02994325 ectoine_eutE ectoine utilization protein EutE. Mem 97.65
PF08400134 phage_tail_N: Prophage tail fibre N-terminal; Inte 97.59
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 97.51
PF04952292 AstE_AspA: Succinylglutamate desuccinylase / Aspar 97.43
PF0830871 PEGA: PEGA domain; InterPro: IPR013229 This domain 97.38
PF0830871 PEGA: PEGA domain; InterPro: IPR013229 This domain 97.22
PF09892193 DUF2119: Uncharacterized protein conserved in arch 96.98
PRK05324329 succinylglutamate desuccinylase; Provisional 96.93
cd03855322 M14_ASTE Peptidase M14 Succinylglutamate desucciny 96.92
COG3608331 Predicted deacylase [General function prediction o 96.92
TIGR03242319 arg_catab_astE succinylglutamate desuccinylase. Me 96.85
cd00421146 intradiol_dioxygenase Intradiol dioxygenases catal 96.81
PRK02259288 aspartoacylase; Provisional 96.77
PRK15036137 hydroxyisourate hydrolase; Provisional 96.67
COG4073198 Uncharacterized protein conserved in archaea [Func 96.65
PRK15036137 hydroxyisourate hydrolase; Provisional 96.63
cd06909282 M14_ASPA Aspartoacylase (ASPA) belongs to the Succ 96.55
PF0721085 DUF1416: Protein of unknown function (DUF1416); In 96.49
PF1468695 fn3_3: Polysaccharide lyase family 4, domain II; P 96.26
cd00421146 intradiol_dioxygenase Intradiol dioxygenases catal 96.24
PF0721085 DUF1416: Protein of unknown function (DUF1416); In 96.23
cd06256327 M14_ASTE_ASPA_like_6 A functionally uncharacterize 96.18
PF0573870 Cna_B: Cna protein B-type domain; InterPro: IPR008 95.83
cd03458256 Catechol_intradiol_dioxygenases Catechol intradiol 95.83
cd03462247 1,2-CCD chlorocatechol 1,2-dioxygenases (1,2-CCDs) 95.68
TIGR02465246 chlorocat_1_2 chlorocatechol 1,2-dioxygenase. Memb 95.66
cd06910272 M14_ASTE_ASPA_like_7 A functionally uncharacterize 95.64
PF1468695 fn3_3: Polysaccharide lyase family 4, domain II; P 95.5
TIGR02439285 catechol_proteo catechol 1,2-dioxygenase, proteoba 95.48
PF00775183 Dioxygenase_C: Dioxygenase; InterPro: IPR000627 Th 95.31
cd03459158 3,4-PCD Protocatechuate 3,4-dioxygenase (3,4-PCD) 95.31
cd03460282 1,2-CTD Catechol 1,2 dioxygenase (1,2-CTD) catalyz 95.24
cd03463185 3,4-PCD_alpha Protocatechuate 3,4-dioxygenase (3,4 95.07
PF0224474 Propep_M14: Carboxypeptidase activation peptide; I 94.93
cd03458256 Catechol_intradiol_dioxygenases Catechol intradiol 94.92
cd03461277 1,2-HQD Hydroxyquinol 1,2-dioxygenase (1,2-HQD) ca 94.88
TIGR02438281 catachol_actin catechol 1,2-dioxygenase, Actinobac 94.69
PF02369100 Big_1: Bacterial Ig-like domain (group 1); InterPr 94.65
TIGR02423193 protocat_alph protocatechuate 3,4-dioxygenase, alp 94.65
TIGR02465246 chlorocat_1_2 chlorocatechol 1,2-dioxygenase. Memb 94.47
TIGR02422220 protocat_beta protocatechuate 3,4-dioxygenase, bet 94.4
PF0573870 Cna_B: Cna protein B-type domain; InterPro: IPR008 94.38
cd03462247 1,2-CCD chlorocatechol 1,2-dioxygenases (1,2-CCDs) 94.35
PF09430123 DUF2012: Protein of unknown function (DUF2012); In 94.27
cd03464220 3,4-PCD_beta Protocatechuate 3,4-dioxygenase (3,4- 94.19
TIGR02439285 catechol_proteo catechol 1,2-dioxygenase, proteoba 94.15
cd03463185 3,4-PCD_alpha Protocatechuate 3,4-dioxygenase (3,4 94.1
PF00775183 Dioxygenase_C: Dioxygenase; InterPro: IPR000627 Th 94.02
cd03459158 3,4-PCD Protocatechuate 3,4-dioxygenase (3,4-PCD) 93.95
cd03460282 1,2-CTD Catechol 1,2 dioxygenase (1,2-CTD) catalyz 93.86
cd03461277 1,2-HQD Hydroxyquinol 1,2-dioxygenase (1,2-HQD) ca 93.75
PF10994341 DUF2817: Protein of unknown function (DUF2817); In 93.7
smart0063492 BID_1 Bacterial Ig-like domain (group 1). 93.64
TIGR02438281 catachol_actin catechol 1,2-dioxygenase, Actinobac 93.5
TIGR02423193 protocat_alph protocatechuate 3,4-dioxygenase, alp 93.24
KOG1948|consensus 1165 93.18
COG3485226 PcaH Protocatechuate 3,4-dioxygenase beta subunit 92.72
PF02369100 Big_1: Bacterial Ig-like domain (group 1); InterPr 92.21
cd03464220 3,4-PCD_beta Protocatechuate 3,4-dioxygenase (3,4- 91.97
TIGR02422220 protocat_beta protocatechuate 3,4-dioxygenase, bet 91.23
smart0063492 BID_1 Bacterial Ig-like domain (group 1). 91.22
COG3485226 PcaH Protocatechuate 3,4-dioxygenase beta subunit 91.0
PF12866222 DUF3823: Protein of unknown function (DUF3823); In 89.99
PF12985104 DUF3869: Domain of unknown function (DUF3869); Int 89.66
PF12985104 DUF3869: Domain of unknown function (DUF3869); Int 89.4
TIGR02962112 hdxy_isourate hydroxyisourate hydrolase. Members o 89.25
PF06488301 L_lac_phage_MSP: Lactococcus lactis bacteriophage 89.2
PF09430123 DUF2012: Protein of unknown function (DUF2012); In 88.83
KOG1948|consensus 1165 88.64
COG2988324 Succinylglutamate desuccinylase [Amino acid transp 88.56
PF10670215 DUF4198: Domain of unknown function (DUF4198) 88.2
PF10794131 DUF2606: Protein of unknown function (DUF2606); In 88.0
COG5266264 CbiK ABC-type Co2+ transport system, periplasmic c 87.67
TIGR02962112 hdxy_isourate hydroxyisourate hydrolase. Members o 87.11
PF12866 222 DUF3823: Protein of unknown function (DUF3823); In 86.01
COG5266264 CbiK ABC-type Co2+ transport system, periplasmic c 85.54
PF06488301 L_lac_phage_MSP: Lactococcus lactis bacteriophage 85.47
PF10794131 DUF2606: Protein of unknown function (DUF2606); In 83.61
PF10670215 DUF4198: Domain of unknown function (DUF4198) 82.71
PF00576112 Transthyretin: HIUase/Transthyretin family; InterP 81.82
PF09892193 DUF2119: Uncharacterized protein conserved in arch 80.06
>cd03863 M14_CPD_II The second carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information 
Probab=100.00  E-value=2.3e-81  Score=670.04  Aligned_cols=337  Identities=46%  Similarity=0.823  Sum_probs=314.5

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCcEEEEEcccccCCceEEEEEEeccCCCCCCCCCCcceEEEeeccccCccchHHHHHHHH
Q psy11074        359 RYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKYVANMHGDETVGYALMVFLI  438 (710)
Q Consensus       359 ~y~ty~e~~~~l~~l~~~~p~~~~~~~iG~S~eGr~i~~l~is~~~~~~~~~~~~kp~v~i~~~~Hg~E~~g~~~~l~l~  438 (710)
                      +||+|+||.++|++|+++||+++++.+||+|+|||+|++++||   ++++.+.++||.|+++|+||||||+|++++++|+
T Consensus         5 ~~h~y~ei~~~l~~l~~~~P~i~~l~~IG~S~eGR~I~~l~Is---~~~~~~~~~kp~v~~~g~iHg~E~ig~~~~l~li   81 (375)
T cd03863           5 RHHHFSDMEIFLRRYANEYPSITRLYSVGKSVELRELYVMEIS---DNPGIHEPGEPEFKYIGNMHGNEVVGRELLLNLI   81 (375)
T ss_pred             ccCCHHHHHHHHHHHHHHCCCcEEEEEcccCCccceEEEEEEe---cCCCcccCCCCeEEEEccccCCcHHHHHHHHHHH
Confidence            6899999999999999999999999999999999999999999   6666666789999999999999999999999999


Q ss_pred             HHHHHhcCCCHHHHHHhhcccEEEEEeeCcccchhcccCCCCCCCCCCCCCCCCcccCCCCCCCCCcccCCCCChHHHHH
Q psy11074        439 QYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQA  518 (710)
Q Consensus       439 ~~l~~~y~~~~~~~~ll~~~~i~ivP~~NPDG~~~~~~~~~~~~~~~~~R~n~~GvDlNRnf~~~~~~~~~~~sepEt~a  518 (710)
                      ++||++|++|+++++||++++|+|||++|||||+++++++|.   |+++|.|++|||||||||+.|.. .+.++||||+|
T Consensus        82 ~~L~~~y~~d~~v~~ll~~~~i~IvP~~NPDG~e~~~~~~~~---~~~~R~n~~GVDLNRNfp~~~~~-~~~~~EpEt~A  157 (375)
T cd03863          82 EYLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRG---GTVGRNNSNNYDLNRNFPDQFFQ-VTDPPQPETLA  157 (375)
T ss_pred             HHHHHhccCCHHHHHHHhCCEEEEEeccCCchHHheecCCcc---cccccccCCCcccccCCcccccc-CCCCCcHHHHH
Confidence            999999999999999999999999999999999999999999   99999999999999999999987 45578999999


Q ss_pred             HHHHHHhCCceEEEEecCCcccccccc----------------------------cCCCCCCCCccc-----cCCccccc
Q psy11074        519 IMNFIYSNPFVLSGNLHGGAVARDYAS----------------------------RNPMMAPGHACG-----FDFKDGIT  565 (710)
Q Consensus       519 l~~~~~~~~~~~~~~lH~~~~~~~y~~----------------------------~~~~~~~~~~~~-----~~~~~g~~  565 (710)
                      |++|+++++|+++++||||++...|+.                            +++.|..+.+|.     +.|..|++
T Consensus       158 v~~~~~~~~f~l~~~lHsg~~~~~yPy~~~~~~~~~~~~~pd~~~~~~la~~~a~a~~~m~~~~~c~~~~~~~~~~~Gi~  237 (375)
T cd03863         158 VMSWLKSYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAVFQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGIT  237 (375)
T ss_pred             HHHHHhhCCceEEEEecCCCEEEEccCcCCCcccccCCCCCCHHHHHHHHHHHHHHHHHHhcCCCCccccccccCCCCcc
Confidence            999999999999999999988433321                            223455566675     24788999


Q ss_pred             ccceEEeecCchhhhccccCCeEEEEEEecCCCCCCchhhHHHHHHhhhhhhhhhhccccceEEEEEcC-CCCCCCCeEE
Q psy11074        566 NGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDT-YGNPLPSAII  644 (710)
Q Consensus       566 ~~~~~y~~~G~~~D~~y~~~~~~~~T~Elg~~~~p~~~~l~~~w~~n~~~ll~~i~q~~~gI~G~V~d~-~g~pi~~A~v  644 (710)
                      ||+.||+++|||+||+|..++|+++|+||+|||||++++|+.+|++||++|+.+|++++.||+|+|+|. +|+||++|+|
T Consensus       238 nga~wY~~~GgmqDw~y~~~~~~e~T~El~~~k~p~~~~l~~~w~~n~~all~~~~~~~~gI~G~V~D~~~g~pl~~AtV  317 (375)
T cd03863         238 NGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPKEEELPKYWEQNRRSLLQFMKQVHRGVRGFVLDATDGRGILNATI  317 (375)
T ss_pred             CCceEEecCCChhhhhhhhcCeEEEEEecCcccCCCHHHHHHHHHHHHHHHHHHHHHhcCeEEEEEEeCCCCCCCCCeEE
Confidence            999999999999999999999999999999999999999999999999999999999999999999995 7999999999


Q ss_pred             EEeecccceeeCCCeEEEeeccCceEEEEEEecCceeeeeeceEecCCCcEEEEEEEec
Q psy11074        645 TVRWNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVPDTESVRLDFMLGK  703 (710)
Q Consensus       645 ~v~~~~~~~~t~~~G~f~~~l~~G~y~l~vs~~Gy~~~~~~~v~v~~~~~~~~~~~L~~  703 (710)
                      .|.|++++++||.+|+|++.|+||+|+|+|++.||++++++ |.|..++.+.++|.|++
T Consensus       318 ~V~g~~~~~~Td~~G~f~~~l~pG~ytl~vs~~GY~~~~~~-v~V~~~~~~~~~~~L~~  375 (375)
T cd03863         318 SVADINHPVTTYKDGDYWRLLVPGTYKVTASARGYDPVTKT-VEVDSKGAVQVNFTLSR  375 (375)
T ss_pred             EEecCcCceEECCCccEEEccCCeeEEEEEEEcCcccEEEE-EEEcCCCcEEEEEEecC
Confidence            99999999999999999999999999999999999999998 99999999999999974

4.17.22), domain II. CPD differs from all other metallocarboxypeptidases in that it contains multiple CP-like domains. CPD belongs to the N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs).The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPD is a single-chain protein containing a signal peptide, three tandem repeats of CP-like domains separated by short bridge regions, followed by a transmembrane domain, and a C-terminal cytosolic tail. The first two CP-like domains of CPD contain all of the essential active site and substrate-binding residues, while the third CP-like domain lacks critical residues necessary for enzymatic activity and is inactive towards standard CP substrates. Domain I is optimally ac
>cd03869 M14_CPX_like Peptidase M14-like domain of carboxypeptidase (CP)-like protein X (CPX), CPX forms a distinct subgroup of the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03865 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, also known as carboxypeptidase H, and enkephalin convertase; EC 3 Back     alignment and domain information
>cd03864 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also known as kininase I, creatine kinase conversion factor, plasma carboxypeptidase B, arginine carboxypeptidase, and protaminase; EC 3 Back     alignment and domain information
>KOG2649|consensus Back     alignment and domain information
>cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03866 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03868 M14_CPD_I The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03867 M14_CPZ Peptidase M14-like domain of carboxypeptidase (CP) Z (CPZ), CPZ belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03869 M14_CPX_like Peptidase M14-like domain of carboxypeptidase (CP)-like protein X (CPX), CPX forms a distinct subgroup of the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>KOG2649|consensus Back     alignment and domain information
>cd03865 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, also known as carboxypeptidase H, and enkephalin convertase; EC 3 Back     alignment and domain information
>cd03863 M14_CPD_II The second carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03864 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also known as kininase I, creatine kinase conversion factor, plasma carboxypeptidase B, arginine carboxypeptidase, and protaminase; EC 3 Back     alignment and domain information
>cd03866 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>KOG2650|consensus Back     alignment and domain information
>cd03868 M14_CPD_I The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03867 M14_CPZ Peptidase M14-like domain of carboxypeptidase (CP) Z (CPZ), CPZ belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03870 M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA) belongs to the A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03871 M14_CPB Peptidase M14 Carboxypeptidase B (CPB) belongs to the carboxypeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06247 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO, also known as metallocarboxypeptidase C; EC 3 Back     alignment and domain information
>cd06246 M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (CPB2, also known as plasma carboxypeptidase B, carboxypeptidase U, and CPU), belongs to the carboxpeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03859 M14_CPT Peptidase M14-like domain of carboxypeptidase (CP) T (CPT), CPT belongs to the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06248 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/B-like subfamily: This is one of two main M14 carboxypeptidase subfamilies, defined by sequence and structural homology, the other being N/E Back     alignment and domain information
>cd03872 M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also known as CPAH; EC 3 Back     alignment and domain information
>cd06226 M14_CPT_like Peptidase M14-like domain of an uncharacterized group of Peptidase M14 Carboxypeptidase (CP) T (CPT)-like proteins Back     alignment and domain information
>cd03860 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase (CP) A/B subfamily is one of two main M14 CP subfamilies defined by sequence and structural homology, the other being the N/E subfamily Back     alignment and domain information
>cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>smart00631 Zn_pept Zn_pept Back     alignment and domain information
>cd06905 Peptidase_M14-like_8 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>PF00246 Peptidase_M14: Zinc carboxypeptidase This is family M14 in the peptidase classification Back     alignment and domain information
>cd06227 Peptidase_M14-like_2 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06228 Peptidase_M14-like_3 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06229 M14_Endopeptidase_I Peptidase M14-like domain of Gamma-D-glutamyl-L-diamino acid endopeptidase 1 (also known as Gamma-D-glutamyl-meso-diaminopimelate peptidase I, and Endopeptidase I (ENP1); EC 3 Back     alignment and domain information
>cd06237 M14_Nna1_like_3 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP),-like proteins Back     alignment and domain information
>KOG2650|consensus Back     alignment and domain information
>cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins Back     alignment and domain information
>cd03856 M14_Nna1_like Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06908 M14_AGBL4_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-4, and related proteins Back     alignment and domain information
>cd03862 Peptidase_M14-like_7 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06242 Peptidase_M14-like_1_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>PRK10602 murein peptide amidase A; Provisional Back     alignment and domain information
>cd03871 M14_CPB Peptidase M14 Carboxypeptidase B (CPB) belongs to the carboxypeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06247 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO, also known as metallocarboxypeptidase C; EC 3 Back     alignment and domain information
>cd06235 M14_Nna1_like_2 Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd03872 M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also known as CPAH; EC 3 Back     alignment and domain information
>cd03870 M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA) belongs to the A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06246 M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (CPB2, also known as plasma carboxypeptidase B, carboxypeptidase U, and CPU), belongs to the carboxpeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06238 Peptidase_M14-like_1_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd00596 Peptidase_M14_like The M14 family of metallocarboxypeptidases (MCPs) are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity Back     alignment and domain information
>cd06239 Peptidase_M14-like_1_2 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06905 Peptidase_M14-like_8 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06248 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/B-like subfamily: This is one of two main M14 carboxypeptidase subfamilies, defined by sequence and structural homology, the other being N/E Back     alignment and domain information
>cd06241 Peptidase_M14-like_1_4 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06243 Peptidase_M14-like_1_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03859 M14_CPT Peptidase M14-like domain of carboxypeptidase (CP) T (CPT), CPT belongs to the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06244 Peptidase_M14-like_1_7 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins Back     alignment and domain information
>cd06907 M14_AGBL2-3_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins Back     alignment and domain information
>cd06904 M14_MpaA_like Peptidase M14-like domain of Escherichia coli Murein Peptide Amidase A (MpaA) and related proteins Back     alignment and domain information
>cd06227 Peptidase_M14-like_2 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>smart00631 Zn_pept Zn_pept Back     alignment and domain information
>cd03860 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase (CP) A/B subfamily is one of two main M14 CP subfamilies defined by sequence and structural homology, the other being the N/E subfamily Back     alignment and domain information
>cd03857 Peptidase_M14-like_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06240 Peptidase_M14-like_1_3 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06906 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>PF00246 Peptidase_M14: Zinc carboxypeptidase This is family M14 in the peptidase classification Back     alignment and domain information
>cd06226 M14_CPT_like Peptidase M14-like domain of an uncharacterized group of Peptidase M14 Carboxypeptidase (CP) T (CPT)-like proteins Back     alignment and domain information
>cd06231 Peptidase_M14-like_4 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06242 Peptidase_M14-like_1_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06228 Peptidase_M14-like_3 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06232 Peptidase_M14-like_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins Back     alignment and domain information
>cd06237 M14_Nna1_like_3 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP),-like proteins Back     alignment and domain information
>cd06908 M14_AGBL4_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-4, and related proteins Back     alignment and domain information
>cd06229 M14_Endopeptidase_I Peptidase M14-like domain of Gamma-D-glutamyl-L-diamino acid endopeptidase 1 (also known as Gamma-D-glutamyl-meso-diaminopimelate peptidase I, and Endopeptidase I (ENP1); EC 3 Back     alignment and domain information
>cd06239 Peptidase_M14-like_1_2 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06241 Peptidase_M14-like_1_4 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03856 M14_Nna1_like Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06243 Peptidase_M14-like_1_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06240 Peptidase_M14-like_1_3 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06235 M14_Nna1_like_2 Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06244 Peptidase_M14-like_1_7 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins Back     alignment and domain information
>cd06907 M14_AGBL2-3_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins Back     alignment and domain information
>cd03862 Peptidase_M14-like_7 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd03857 Peptidase_M14-like_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06238 Peptidase_M14-like_1_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>PRK10602 murein peptide amidase A; Provisional Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>KOG3641|consensus Back     alignment and domain information
>cd06232 Peptidase_M14-like_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>cd06906 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06233 Peptidase_M14-like_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 Back     alignment and domain information
>cd06231 Peptidase_M14-like_4 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd00596 Peptidase_M14_like The M14 family of metallocarboxypeptidases (MCPs) are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity Back     alignment and domain information
>cd06230 M14_ASTE_ASPA_like The Peptidase M14 Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily belongs to the M14 family of metallocarboxypeptidases (MCPs), and includes ASTE, which catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3 Back     alignment and domain information
>PF13715 DUF4480: Domain of unknown function (DUF4480) Back     alignment and domain information
>PF13620 CarboxypepD_reg: Carboxypeptidase regulatory-like domain; PDB: 3MN8_D 3P0D_I 3KCP_A 2B59_B 1UWY_A 1H8L_A 1QMU_A 2NSM_A Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>COG2866 Predicted carboxypeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06904 M14_MpaA_like Peptidase M14-like domain of Escherichia coli Murein Peptide Amidase A (MpaA) and related proteins Back     alignment and domain information
>PF10994 DUF2817: Protein of unknown function (DUF2817); InterPro: IPR021259 This family of proteins has no known function Back     alignment and domain information
>PF13620 CarboxypepD_reg: Carboxypeptidase regulatory-like domain; PDB: 3MN8_D 3P0D_I 3KCP_A 2B59_B 1UWY_A 1H8L_A 1QMU_A 2NSM_A Back     alignment and domain information
>PF13715 DUF4480: Domain of unknown function (DUF4480) Back     alignment and domain information
>PRK02259 aspartoacylase; Provisional Back     alignment and domain information
>cd06256 M14_ASTE_ASPA_like_6 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06909 M14_ASPA Aspartoacylase (ASPA) belongs to the Succinylglutamate desuccinylase/aspartoacylase subfamily of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd03855 M14_ASTE Peptidase M14 Succinylglutamate desuccinylase (ASTE, also known as N-succinyl-L-glutamate amidohydrolase, N2-succinylglutamate desuccinylase, and SGDS; EC 3 Back     alignment and domain information
>PRK05324 succinylglutamate desuccinylase; Provisional Back     alignment and domain information
>cd06910 M14_ASTE_ASPA_like_7 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>TIGR03242 arg_catab_astE succinylglutamate desuccinylase Back     alignment and domain information
>COG2866 Predicted carboxypeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06233 Peptidase_M14-like_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>KOG3641|consensus Back     alignment and domain information
>COG2988 Succinylglutamate desuccinylase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06230 M14_ASTE_ASPA_like The Peptidase M14 Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily belongs to the M14 family of metallocarboxypeptidases (MCPs), and includes ASTE, which catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3 Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF08400 phage_tail_N: Prophage tail fibre N-terminal; InterPro: IPR013609 This entry represents the N terminus of phage 933W tail fibre protein Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>PF08400 phage_tail_N: Prophage tail fibre N-terminal; InterPro: IPR013609 This entry represents the N terminus of phage 933W tail fibre protein Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 Back     alignment and domain information
>PF08308 PEGA: PEGA domain; InterPro: IPR013229 This domain is found in both archaea and bacteria and has similarity to S-layer (surface layer) proteins Back     alignment and domain information
>PF08308 PEGA: PEGA domain; InterPro: IPR013229 This domain is found in both archaea and bacteria and has similarity to S-layer (surface layer) proteins Back     alignment and domain information
>PF09892 DUF2119: Uncharacterized protein conserved in archaea (DUF2119); InterPro: IPR019218 This entry represents a family of hypothetical archaeal proteins of unknown function Back     alignment and domain information
>PRK05324 succinylglutamate desuccinylase; Provisional Back     alignment and domain information
>cd03855 M14_ASTE Peptidase M14 Succinylglutamate desuccinylase (ASTE, also known as N-succinyl-L-glutamate amidohydrolase, N2-succinylglutamate desuccinylase, and SGDS; EC 3 Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>TIGR03242 arg_catab_astE succinylglutamate desuccinylase Back     alignment and domain information
>cd00421 intradiol_dioxygenase Intradiol dioxygenases catalyze the critical ring-cleavage step in the conversion of catecholate derivatives to citric acid cycle intermediates Back     alignment and domain information
>PRK02259 aspartoacylase; Provisional Back     alignment and domain information
>PRK15036 hydroxyisourate hydrolase; Provisional Back     alignment and domain information
>COG4073 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK15036 hydroxyisourate hydrolase; Provisional Back     alignment and domain information
>cd06909 M14_ASPA Aspartoacylase (ASPA) belongs to the Succinylglutamate desuccinylase/aspartoacylase subfamily of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF07210 DUF1416: Protein of unknown function (DUF1416); InterPro: IPR010814 This family consists of several hypothetical bacterial proteins of around 100 residues in length Back     alignment and domain information
>PF14686 fn3_3: Polysaccharide lyase family 4, domain II; PDB: 1NKG_A 2XHN_B 3NJX_A 3NJV_A Back     alignment and domain information
>cd00421 intradiol_dioxygenase Intradiol dioxygenases catalyze the critical ring-cleavage step in the conversion of catecholate derivatives to citric acid cycle intermediates Back     alignment and domain information
>PF07210 DUF1416: Protein of unknown function (DUF1416); InterPro: IPR010814 This family consists of several hypothetical bacterial proteins of around 100 residues in length Back     alignment and domain information
>cd06256 M14_ASTE_ASPA_like_6 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF05738 Cna_B: Cna protein B-type domain; InterPro: IPR008454 This entry represents a repeated B region domain found in the collagen-binding surface protein Cna in Staphylococcus aureus, as well as other related domains Back     alignment and domain information
>cd03458 Catechol_intradiol_dioxygenases Catechol intradiol dioxygenases can be divided into several subgroups according to their substrate specificity for catechol, chlorocatechols and hydroxyquinols Back     alignment and domain information
>cd03462 1,2-CCD chlorocatechol 1,2-dioxygenases (1,2-CCDs) (type II enzymes) are homodimeric intradiol dioxygenases that degrade chlorocatechols via the addition of molecular oxygen and the subsequent cleavage between two adjacent hydroxyl groups Back     alignment and domain information
>TIGR02465 chlorocat_1_2 chlorocatechol 1,2-dioxygenase Back     alignment and domain information
>cd06910 M14_ASTE_ASPA_like_7 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF14686 fn3_3: Polysaccharide lyase family 4, domain II; PDB: 1NKG_A 2XHN_B 3NJX_A 3NJV_A Back     alignment and domain information
>TIGR02439 catechol_proteo catechol 1,2-dioxygenase, proteobacterial Back     alignment and domain information
>PF00775 Dioxygenase_C: Dioxygenase; InterPro: IPR000627 This entry represents the C-terminal domain common to several intradiol ring-cleavage dioxygenases Back     alignment and domain information
>cd03459 3,4-PCD Protocatechuate 3,4-dioxygenase (3,4-PCD) catalyzes the oxidative ring cleavage of 3,4-dihydroxybenzoate to produce beta-carboxy-cis,cis-muconate Back     alignment and domain information
>cd03460 1,2-CTD Catechol 1,2 dioxygenase (1,2-CTD) catalyzes an intradiol cleavage reaction of catechol to form cis,cis-muconate Back     alignment and domain information
>cd03463 3,4-PCD_alpha Protocatechuate 3,4-dioxygenase (3,4-PCD) , alpha subunit Back     alignment and domain information
>PF02244 Propep_M14: Carboxypeptidase activation peptide; InterPro: IPR003146 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>cd03458 Catechol_intradiol_dioxygenases Catechol intradiol dioxygenases can be divided into several subgroups according to their substrate specificity for catechol, chlorocatechols and hydroxyquinols Back     alignment and domain information
>cd03461 1,2-HQD Hydroxyquinol 1,2-dioxygenase (1,2-HQD) catalyzes the ring cleavage of hydroxyquinol (1,2,4-trihydroxybenzene), a intermediate in the degradation of a large variety of aromatic compounds including some polychloro- and nitroaromatic pollutants, to form 3-hydroxy-cis,cis-muconates Back     alignment and domain information
>TIGR02438 catachol_actin catechol 1,2-dioxygenase, Actinobacterial Back     alignment and domain information
>PF02369 Big_1: Bacterial Ig-like domain (group 1); InterPro: IPR003344 Proteins that contain this domain are found in a variety of bacterial and phage surface proteins such as intimins Back     alignment and domain information
>TIGR02423 protocat_alph protocatechuate 3,4-dioxygenase, alpha subunit Back     alignment and domain information
>TIGR02465 chlorocat_1_2 chlorocatechol 1,2-dioxygenase Back     alignment and domain information
>TIGR02422 protocat_beta protocatechuate 3,4-dioxygenase, beta subunit Back     alignment and domain information
>PF05738 Cna_B: Cna protein B-type domain; InterPro: IPR008454 This entry represents a repeated B region domain found in the collagen-binding surface protein Cna in Staphylococcus aureus, as well as other related domains Back     alignment and domain information
>cd03462 1,2-CCD chlorocatechol 1,2-dioxygenases (1,2-CCDs) (type II enzymes) are homodimeric intradiol dioxygenases that degrade chlorocatechols via the addition of molecular oxygen and the subsequent cleavage between two adjacent hydroxyl groups Back     alignment and domain information
>PF09430 DUF2012: Protein of unknown function (DUF2012); InterPro: IPR019008 This domain is found in different proteins, including uncharacterised protein family UPF0480 and nodal modulators Back     alignment and domain information
>cd03464 3,4-PCD_beta Protocatechuate 3,4-dioxygenase (3,4-PCD) , beta subunit Back     alignment and domain information
>TIGR02439 catechol_proteo catechol 1,2-dioxygenase, proteobacterial Back     alignment and domain information
>cd03463 3,4-PCD_alpha Protocatechuate 3,4-dioxygenase (3,4-PCD) , alpha subunit Back     alignment and domain information
>PF00775 Dioxygenase_C: Dioxygenase; InterPro: IPR000627 This entry represents the C-terminal domain common to several intradiol ring-cleavage dioxygenases Back     alignment and domain information
>cd03459 3,4-PCD Protocatechuate 3,4-dioxygenase (3,4-PCD) catalyzes the oxidative ring cleavage of 3,4-dihydroxybenzoate to produce beta-carboxy-cis,cis-muconate Back     alignment and domain information
>cd03460 1,2-CTD Catechol 1,2 dioxygenase (1,2-CTD) catalyzes an intradiol cleavage reaction of catechol to form cis,cis-muconate Back     alignment and domain information
>cd03461 1,2-HQD Hydroxyquinol 1,2-dioxygenase (1,2-HQD) catalyzes the ring cleavage of hydroxyquinol (1,2,4-trihydroxybenzene), a intermediate in the degradation of a large variety of aromatic compounds including some polychloro- and nitroaromatic pollutants, to form 3-hydroxy-cis,cis-muconates Back     alignment and domain information
>PF10994 DUF2817: Protein of unknown function (DUF2817); InterPro: IPR021259 This family of proteins has no known function Back     alignment and domain information
>smart00634 BID_1 Bacterial Ig-like domain (group 1) Back     alignment and domain information
>TIGR02438 catachol_actin catechol 1,2-dioxygenase, Actinobacterial Back     alignment and domain information
>TIGR02423 protocat_alph protocatechuate 3,4-dioxygenase, alpha subunit Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>COG3485 PcaH Protocatechuate 3,4-dioxygenase beta subunit [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF02369 Big_1: Bacterial Ig-like domain (group 1); InterPro: IPR003344 Proteins that contain this domain are found in a variety of bacterial and phage surface proteins such as intimins Back     alignment and domain information
>cd03464 3,4-PCD_beta Protocatechuate 3,4-dioxygenase (3,4-PCD) , beta subunit Back     alignment and domain information
>TIGR02422 protocat_beta protocatechuate 3,4-dioxygenase, beta subunit Back     alignment and domain information
>smart00634 BID_1 Bacterial Ig-like domain (group 1) Back     alignment and domain information
>COG3485 PcaH Protocatechuate 3,4-dioxygenase beta subunit [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF12866 DUF3823: Protein of unknown function (DUF3823); InterPro: IPR024278 This is a family of uncharacterised proteins from Bacteroidetes Back     alignment and domain information
>PF12985 DUF3869: Domain of unknown function (DUF3869); InterPro: IPR024620 This functionally uncharacterised domain is found in bacterial sequences, including the N-terminal region of a putative pore-forming toxin (YP_001301288 Back     alignment and domain information
>PF12985 DUF3869: Domain of unknown function (DUF3869); InterPro: IPR024620 This functionally uncharacterised domain is found in bacterial sequences, including the N-terminal region of a putative pore-forming toxin (YP_001301288 Back     alignment and domain information
>TIGR02962 hdxy_isourate hydroxyisourate hydrolase Back     alignment and domain information
>PF06488 L_lac_phage_MSP: Lactococcus lactis bacteriophage major structural protein; InterPro: IPR010517 This family consists of several Lactococcus lactis bacteriophage F4-1 major structural proteins [] Back     alignment and domain information
>PF09430 DUF2012: Protein of unknown function (DUF2012); InterPro: IPR019008 This domain is found in different proteins, including uncharacterised protein family UPF0480 and nodal modulators Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>COG2988 Succinylglutamate desuccinylase [Amino acid transport and metabolism] Back     alignment and domain information
>PF10670 DUF4198: Domain of unknown function (DUF4198) Back     alignment and domain information
>PF10794 DUF2606: Protein of unknown function (DUF2606); InterPro: IPR019730 This entry represents bacterial proteins with unknown function Back     alignment and domain information
>COG5266 CbiK ABC-type Co2+ transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02962 hdxy_isourate hydroxyisourate hydrolase Back     alignment and domain information
>PF12866 DUF3823: Protein of unknown function (DUF3823); InterPro: IPR024278 This is a family of uncharacterised proteins from Bacteroidetes Back     alignment and domain information
>COG5266 CbiK ABC-type Co2+ transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06488 L_lac_phage_MSP: Lactococcus lactis bacteriophage major structural protein; InterPro: IPR010517 This family consists of several Lactococcus lactis bacteriophage F4-1 major structural proteins [] Back     alignment and domain information
>PF10794 DUF2606: Protein of unknown function (DUF2606); InterPro: IPR019730 This entry represents bacterial proteins with unknown function Back     alignment and domain information
>PF10670 DUF4198: Domain of unknown function (DUF4198) Back     alignment and domain information
>PF00576 Transthyretin: HIUase/Transthyretin family; InterPro: IPR023416 This family includes transthyretin that is a thyroid hormone-binding protein that transports thyroxine from the bloodstream to the brain Back     alignment and domain information
>PF09892 DUF2119: Uncharacterized protein conserved in archaea (DUF2119); InterPro: IPR019218 This entry represents a family of hypothetical archaeal proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
3mn8_A435 Structure Of Drosophila Melanogaster Carboxypeptida 1e-87
1uwy_A426 Crystal Structure Of Human Carboxypeptidase M Lengt 1e-78
1qmu_A380 Duck Carboxypeptidase D Domain Ii Length = 380 4e-77
2nsm_A439 Crystal Structure Of The Human Carboxypeptidase N ( 4e-70
3v38_A326 Carboxypeptidase T Mutant L254n Length = 326 5e-14
3prt_A323 Mutant Of The Carboxypeptidase T Length = 323 5e-14
1obr_A326 Carboxypeptidase T Length = 326 5e-14
3qnv_A323 Carboxypeptidase T Length = 323 5e-14
1jqg_A433 Crystal Structure Of The Carboxypeptidase A From He 8e-09
1aye_A401 Human Procarboxypeptidase A2 Length = 401 1e-08
1z5r_A306 Crystal Structure Of Activated Porcine Pancreatic C 1e-07
1zli_A309 Crystal Structure Of The Tick Carboxypeptidase Inhi 3e-07
3glj_A401 A Polymorph Of Carboxypeptidase B Zymogen Structure 3e-07
3d4u_A309 Bovine Thrombin-Activatable Fibrinolysis Inhibitor 5e-07
3dgv_A401 Crystal Structure Of Thrombin Activatable Fibrinoly 8e-07
1dtd_A303 Crystal Structure Of The Complex Between The Leech 1e-06
1dtd_A303 Crystal Structure Of The Complex Between The Leech 3e-06
2boa_A404 Human Procarboxypeptidase A4. Length = 404 1e-06
2boa_A404 Human Procarboxypeptidase A4. Length = 404 2e-06
4a94_A310 Structure Of The Carboxypeptidase Inhibitor From Ne 2e-06
4a94_A310 Structure Of The Carboxypeptidase Inhibitor From Ne 7e-06
1kwm_A402 Human Procarboxypeptidase B: Three-Dimensional Stru 2e-06
2bo9_A308 Human Carboxypeptidase A4 In Complex With Human Lat 2e-06
2bo9_A308 Human Carboxypeptidase A4 In Complex With Human Lat 8e-06
2pcu_A305 Human Carboxypeptidase A4 In Complex With A Cleaved 2e-06
2pcu_A305 Human Carboxypeptidase A4 In Complex With A Cleaved 7e-06
1pyt_B309 Ternary Complex Of Procarboxypeptidase A, Proprotei 9e-06
3fx6_A307 X-Ray Crystallographic Studies On The Complex Of Ca 9e-06
1hdq_A307 Crystal Structure Of Bovine Pancreatic Carboxypepti 9e-06
4a37_A388 Metallo-Carboxypeptidase From Pseudomonas Aeruginos 9e-06
1cpx_A307 Beta Form Of Carboxypeptidase A (Residues 3-307) Fr 9e-06
1ee3_P309 Cadmium-Substituted Bovine Pancreatic Carboxypeptid 1e-05
1pca_A403 Three Dimensional Structure Of Porcine Pancreatic P 1e-05
1nsa_A395 Three-Dimensional Structure Of Porcine Procarboxype 1e-05
3fju_A307 Ascaris Suum Carboxypeptidase Inhibitor In Complex 5e-05
3fju_A307 Ascaris Suum Carboxypeptidase Inhibitor In Complex 8e-05
2v77_A309 Crystal Structure Of Human Carboxypeptidase A1 Leng 5e-05
2v77_A309 Crystal Structure Of Human Carboxypeptidase A1 Leng 8e-05
1cbx_A307 Crystal Structure Of The Complex Between Carboxypep 8e-05
1hdu_A307 Crystal Structure Of Bovine Pancreatic Carboxypepti 1e-04
1bav_A309 Carboxypeptidase A Complexed With 2-Benzyl-3-Iodo-P 1e-04
3lms_A309 Structure Of Human Activated Thrombin-Activatable F 1e-04
3d66_A424 Crystal Structure Of Thrombin-Activatable Fibrinoly 1e-04
3d68_A424 Crystal Structure Of A T325i/t329i/h333y/h335q Muta 1e-04
3l2n_A395 Crystal Structure Of Putative Carboxypeptidase A (y 4e-04
>pdb|3MN8|A Chain A, Structure Of Drosophila Melanogaster Carboxypeptidase D Isoform 1b Short Length = 435 Back     alignment and structure 
Iteration: 1

 Score =  321 bits (822), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 174/423 (41%), Positives = 242/423 (57%), Gaps = 45/423 (10%)
Query: 319 VPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTE-LDAFILKTVKSY 377
           +P+L LL   + ++  A          G    +      Q +Y S E L+       K+Y
Sbjct: 1   MPTLGLLFASIGIAVLA---MGVPHCRGYTIKEDESFLQQPHYASQEQLEDLFAGLEKAY 57
Query: 378 PHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKYVANMHGDETVGYALMVFL 437
           P+  +   +G+S++GRNL A++I+    N   R L+ P  KY+ANMHGDETVG  L+V++
Sbjct: 58  PNQAKVHFLGRSLEGRNLLALQISR---NTRSRNLLTPPVKYIANMHGDETVGRQLLVYM 114
Query: 438 IQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLN 497
            QYL+    +   + QL+NSTDIY+VP++NPDG+A ++EG C+SL  YVGR NA  +DLN
Sbjct: 115 AQYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLN 174
Query: 498 RNFPDQFEYE-----AKKVYEPETQAIMNFIYSNPFVLSGNLHGGAV------------- 539
           R+FPD+ E         +  +PET A++N+I S PFVLS N HGGAV             
Sbjct: 175 RDFPDRLEQSHVHQLRAQSRQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHN 234
Query: 540 -----------------ARDYASRNPMMAPGHACGFDFKDGITNGNYWYKVTGGMQDFNY 582
                            A  Y+  +P+M  G+ C   F  GITNG +WY+++GGMQDFNY
Sbjct: 235 ECCEESLTPDDRVFKQLAHTYSDNHPIMRKGNNCNDSFSGGITNGAHWYELSGGMQDFNY 294
Query: 583 VHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSA 642
             SNCFE+T+ELSCCKYP AS L   W  NK SL++L+   H G+ G+VTD  G P+  A
Sbjct: 295 AFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVTDASGFPIADA 354
Query: 643 IITVR-WNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVP--DTESVRLDF 699
            + V    +K +  + RGEYWRLL  G Y V ASA GY+    + + V   + E++RLDF
Sbjct: 355 NVYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQEALRLDF 414
Query: 700 MLG 702
            L 
Sbjct: 415 KLA 417
>pdb|1UWY|A Chain A, Crystal Structure Of Human Carboxypeptidase M Length = 426 Back     alignment and structure
>pdb|1QMU|A Chain A, Duck Carboxypeptidase D Domain Ii Length = 380 Back     alignment and structure
>pdb|2NSM|A Chain A, Crystal Structure Of The Human Carboxypeptidase N (kininase I) Catalytic Domain Length = 439 Back     alignment and structure
>pdb|3V38|A Chain A, Carboxypeptidase T Mutant L254n Length = 326 Back     alignment and structure
>pdb|3PRT|A Chain A, Mutant Of The Carboxypeptidase T Length = 323 Back     alignment and structure
>pdb|1OBR|A Chain A, Carboxypeptidase T Length = 326 Back     alignment and structure
>pdb|3QNV|A Chain A, Carboxypeptidase T Length = 323 Back     alignment and structure
>pdb|1JQG|A Chain A, Crystal Structure Of The Carboxypeptidase A From Helicoverpa Armigera Length = 433 Back     alignment and structure
>pdb|1AYE|A Chain A, Human Procarboxypeptidase A2 Length = 401 Back     alignment and structure
>pdb|1Z5R|A Chain A, Crystal Structure Of Activated Porcine Pancreatic Carboxypeptidase B Length = 306 Back     alignment and structure
>pdb|1ZLI|A Chain A, Crystal Structure Of The Tick Carboxypeptidase Inhibitor In Complex With Human Carboxypeptidase B Length = 309 Back     alignment and structure
>pdb|3D4U|A Chain A, Bovine Thrombin-Activatable Fibrinolysis Inhibitor (Tafia) In Complex With Tick-Derived Carboxypeptidase Inhibitor Length = 309 Back     alignment and structure
>pdb|3DGV|A Chain A, Crystal Structure Of Thrombin Activatable Fibrinolysis Inhibitor (Tafi) Length = 401 Back     alignment and structure
>pdb|1DTD|A Chain A, Crystal Structure Of The Complex Between The Leech Carboxypeptidase Inhibitor And The Human Carboxypeptidase A2 (Lci-Cpa2) Length = 303 Back     alignment and structure
>pdb|1DTD|A Chain A, Crystal Structure Of The Complex Between The Leech Carboxypeptidase Inhibitor And The Human Carboxypeptidase A2 (Lci-Cpa2) Length = 303 Back     alignment and structure
>pdb|2BOA|A Chain A, Human Procarboxypeptidase A4. Length = 404 Back     alignment and structure
>pdb|2BOA|A Chain A, Human Procarboxypeptidase A4. Length = 404 Back     alignment and structure
>pdb|4A94|A Chain A, Structure Of The Carboxypeptidase Inhibitor From Nerita Versicolor In Complex With Human Cpa4 Length = 310 Back     alignment and structure
>pdb|4A94|A Chain A, Structure Of The Carboxypeptidase Inhibitor From Nerita Versicolor In Complex With Human Cpa4 Length = 310 Back     alignment and structure
>pdb|1KWM|A Chain A, Human Procarboxypeptidase B: Three-Dimensional Structure And Implications For Thrombin-Activatable Fibrinolysis Inhibitor (Tafi) Length = 402 Back     alignment and structure
>pdb|2BO9|A Chain A, Human Carboxypeptidase A4 In Complex With Human Latexin. Length = 308 Back     alignment and structure
>pdb|2BO9|A Chain A, Human Carboxypeptidase A4 In Complex With Human Latexin. Length = 308 Back     alignment and structure
>pdb|2PCU|A Chain A, Human Carboxypeptidase A4 In Complex With A Cleaved Hexapeptide Length = 305 Back     alignment and structure
>pdb|2PCU|A Chain A, Human Carboxypeptidase A4 In Complex With A Cleaved Hexapeptide Length = 305 Back     alignment and structure
>pdb|1PYT|B Chain B, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 309 Back     alignment and structure
>pdb|3FX6|A Chain A, X-Ray Crystallographic Studies On The Complex Of Carboxypeptidase A With The Inhibitor Using Alpha-Nitro Ketone As The Zinc-Binding Group Length = 307 Back     alignment and structure
>pdb|1HDQ|A Chain A, Crystal Structure Of Bovine Pancreatic Carboxypeptidase A Complexed With D-N-Hydroxyaminocarbonyl Phenylalanine At 2.3 A Length = 307 Back     alignment and structure
>pdb|4A37|A Chain A, Metallo-Carboxypeptidase From Pseudomonas Aeruginosa Length = 388 Back     alignment and structure
>pdb|1CPX|A Chain A, Beta Form Of Carboxypeptidase A (Residues 3-307) From Bovine Pancreas In An Orthorhombic Crystal Form With Two Zinc Ions In The Active Site. Length = 307 Back     alignment and structure
>pdb|1EE3|P Chain P, Cadmium-Substituted Bovine Pancreatic Carboxypeptidase A (Alfa-Form) At Ph 7.5 And 2 Mm Chloride In Monoclinic Crystal Form Length = 309 Back     alignment and structure
>pdb|1PCA|A Chain A, Three Dimensional Structure Of Porcine Pancreatic Procarboxypeptidase A. A Comparison Of The A And B Zymogens And Their Determinants For Inhibition And Activation Length = 403 Back     alignment and structure
>pdb|1NSA|A Chain A, Three-Dimensional Structure Of Porcine Procarboxypeptidase B: A Structural Basis Of Its Inactivity Length = 395 Back     alignment and structure
>pdb|3FJU|A Chain A, Ascaris Suum Carboxypeptidase Inhibitor In Complex With Human Carboxypeptidase A1 Length = 307 Back     alignment and structure
>pdb|3FJU|A Chain A, Ascaris Suum Carboxypeptidase Inhibitor In Complex With Human Carboxypeptidase A1 Length = 307 Back     alignment and structure
>pdb|2V77|A Chain A, Crystal Structure Of Human Carboxypeptidase A1 Length = 309 Back     alignment and structure
>pdb|2V77|A Chain A, Crystal Structure Of Human Carboxypeptidase A1 Length = 309 Back     alignment and structure
>pdb|1CBX|A Chain A, Crystal Structure Of The Complex Between Carboxypeptidase A And The Biproduct Analog Inhibitor L-Benzylsuccinate At 2.0 Angstroms Resolution Length = 307 Back     alignment and structure
>pdb|1HDU|A Chain A, Crystal Structure Of Bovine Pancreatic Carboxypeptidase A Complexed With Aminocarbonylphenylalanine At 1.75 A Length = 307 Back     alignment and structure
>pdb|1BAV|A Chain A, Carboxypeptidase A Complexed With 2-Benzyl-3-Iodo-Propanoic Acid (Bip) Length = 309 Back     alignment and structure
>pdb|3LMS|A Chain A, Structure Of Human Activated Thrombin-Activatable Fibrinolys Inhibitor, Tafia, In Complex With Tick-Derived Funnelin Inh Tci Length = 309 Back     alignment and structure
>pdb|3D66|A Chain A, Crystal Structure Of Thrombin-Activatable Fibrinolysis Inhibitor (Tafi) Length = 424 Back     alignment and structure
>pdb|3D68|A Chain A, Crystal Structure Of A T325i/t329i/h333y/h335q Mutant Of Thrombin- Activatable Fibrinolysis Inhibitor (tafi-iiyq) Length = 424 Back     alignment and structure
>pdb|3L2N|A Chain A, Crystal Structure Of Putative Carboxypeptidase A (yp_562911.1) From Shewanella Denitrificans Os-217 At 2.39 A Resolution Length = 395 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
3mn8_A435 LP15968P; catalytic domain of alpha/beta-hydrolase 1e-127
3mn8_A435 LP15968P; catalytic domain of alpha/beta-hydrolase 4e-40
3mn8_A435 LP15968P; catalytic domain of alpha/beta-hydrolase 2e-39
1h8l_A380 Carboxypeptidase GP180 residues 503-882; hydrolase 1e-121
1h8l_A380 Carboxypeptidase GP180 residues 503-882; hydrolase 2e-40
1h8l_A380 Carboxypeptidase GP180 residues 503-882; hydrolase 5e-38
2nsm_A439 Carboxypeptidase N catalytic chain; caroxypeptidas 1e-119
2nsm_A439 Carboxypeptidase N catalytic chain; caroxypeptidas 4e-38
2nsm_A439 Carboxypeptidase N catalytic chain; caroxypeptidas 1e-35
1uwy_A426 Carboxypeptidase M; metallopeptidase, GPI-anchor, 1e-114
1uwy_A426 Carboxypeptidase M; metallopeptidase, GPI-anchor, 5e-37
1uwy_A426 Carboxypeptidase M; metallopeptidase, GPI-anchor, 2e-34
3prt_A323 Carboxypeptidase T; hydrolase; 1.66A {Thermoactino 1e-61
3prt_A323 Carboxypeptidase T; hydrolase; 1.66A {Thermoactino 1e-30
3prt_A323 Carboxypeptidase T; hydrolase; 1.66A {Thermoactino 2e-05
4a37_A388 Metallo-carboxypeptidase; metallo-protease, hydrol 3e-37
4a37_A388 Metallo-carboxypeptidase; metallo-protease, hydrol 8e-13
4a37_A388 Metallo-carboxypeptidase; metallo-protease, hydrol 4e-04
3k2k_A403 Putative carboxypeptidase; structural genomics, jo 5e-35
3k2k_A403 Putative carboxypeptidase; structural genomics, jo 4e-13
3k2k_A403 Putative carboxypeptidase; structural genomics, jo 8e-04
1dtd_A303 Carboxypeptidase A2; carboxypeptidase A2, leech ca 4e-28
1dtd_A303 Carboxypeptidase A2; carboxypeptidase A2, leech ca 6e-21
1jqg_A433 Carboxypeptidase A; Pro-protein, hydrolase; 2.50A 5e-28
1jqg_A433 Carboxypeptidase A; Pro-protein, hydrolase; 2.50A 9e-20
2bo9_A308 Carboxypeptidase A4; metallocarboxypeptidase, X-RA 7e-28
2bo9_A308 Carboxypeptidase A4; metallocarboxypeptidase, X-RA 4e-22
1aye_A401 PCPA2, procarboxypeptidase A2; serine protease, zy 1e-27
1aye_A401 PCPA2, procarboxypeptidase A2; serine protease, zy 2e-20
1z5r_A306 Procarboxypeptidase B; exopeptidase, hydrolase; 1. 1e-27
1z5r_A306 Procarboxypeptidase B; exopeptidase, hydrolase; 1. 1e-21
3d4u_A309 Tafia, carboxypeptidase B2; protease-inhibitor com 2e-27
3d4u_A309 Tafia, carboxypeptidase B2; protease-inhibitor com 1e-21
1m4l_A307 Carboxypeptidase A; metalloproteinase, metalloexop 4e-27
1m4l_A307 Carboxypeptidase A; metalloproteinase, metalloexop 4e-21
3b2y_A275 Metallopeptidase containing CO-catalytic metalloa 7e-27
3b2y_A275 Metallopeptidase containing CO-catalytic metalloa 7e-09
2c1c_A312 Carboxypeptidase B; insect, metalloprotease, insen 8e-27
2c1c_A312 Carboxypeptidase B; insect, metalloprotease, insen 2e-19
1kwm_A402 Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A 3e-26
1kwm_A402 Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A 8e-20
2qvp_A275 Uncharacterized protein; putative metallopeptidase 9e-26
2qvp_A275 Uncharacterized protein; putative metallopeptidase 1e-08
2qvp_A275 Uncharacterized protein; putative metallopeptidase 2e-05
3l2n_A395 Peptidase M14, carboxypeptidase A; putative carbox 1e-25
3l2n_A395 Peptidase M14, carboxypeptidase A; putative carbox 2e-11
2boa_A404 Carboxypeptidase A4; metalloprocarboxypeptidase, X 2e-25
2boa_A404 Carboxypeptidase A4; metalloprocarboxypeptidase, X 1e-20
1pca_A403 Procarboxypeptidase A PCPA; hydrolase(C-terminal p 4e-25
1pca_A403 Procarboxypeptidase A PCPA; hydrolase(C-terminal p 1e-19
3dgv_A401 TAFI, carboxypeptidase B2; blood coagulation, fibr 6e-25
3dgv_A401 TAFI, carboxypeptidase B2; blood coagulation, fibr 8e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 1e-05
>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Length = 435 Back     alignment and structure
 Score =  384 bits (987), Expect = e-127
 Identities = 172/421 (40%), Positives = 244/421 (57%), Gaps = 43/421 (10%)

Query: 319 VPSLSLLLCHVTLSTAADYYFDFDDLTGLEDADSAGIDLQRYYNSTELDAFILKTVKSYP 378
           +P+L LL   + ++  A         T  ED     +    Y +  +L+       K+YP
Sbjct: 1   MPTLGLLFASIGIAVLAMGVPHCRGYTIKEDESF--LQQPHYASQEQLEDLFAGLEKAYP 58

Query: 379 HLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKYVANMHGDETVGYALMVFLI 438
           +  +   +G+S++GRNL A++I+    N   R L+ P  KY+ANMHGDETVG  L+V++ 
Sbjct: 59  NQAKVHFLGRSLEGRNLLALQIS---RNTRSRNLLTPPVKYIANMHGDETVGRQLLVYMA 115

Query: 439 QYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNR 498
           QYL+    +   + QL+NSTDIY+VP++NPDG+A ++EG C+SL  YVGR NA  +DLNR
Sbjct: 116 QYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNR 175

Query: 499 NFPDQFE----YEAKKVY-EPETQAIMNFIYSNPFVLSGNLHGGA--------------- 538
           +FPD+ E    ++ +    +PET A++N+I S PFVLS N HGGA               
Sbjct: 176 DFPDRLEQSHVHQLRAQSRQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNE 235

Query: 539 ---------------VARDYASRNPMMAPGHACGFDFKDGITNGNYWYKVTGGMQDFNYV 583
                          +A  Y+  +P+M  G+ C   F  GITNG +WY+++GGMQDFNY 
Sbjct: 236 CCEESLTPDDRVFKQLAHTYSDNHPIMRKGNNCNDSFSGGITNGAHWYELSGGMQDFNYA 295

Query: 584 HSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVTDTYGNPLPSAI 643
            SNCFE+T+ELSCCKYP AS L   W  NK SL++L+   H G+ G+VTD  G P+  A 
Sbjct: 296 FSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVTDASGFPIADAN 355

Query: 644 ITVR-WNDKAVTVTNRGEYWRLLARGKYVVTASAPGYEPVTTEPLDVP--DTESVRLDFM 700
           + V    +K +  + RGEYWRLL  G Y V ASA GY+    + + V   + E++RLDF 
Sbjct: 356 VYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQEALRLDFK 415

Query: 701 L 701
           L
Sbjct: 416 L 416
>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Length = 435 Back     alignment and structure
>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Length = 435 Back     alignment and structure
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Length = 380 Back     alignment and structure
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Length = 380 Back     alignment and structure
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Length = 380 Back     alignment and structure
>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Length = 439 Back     alignment and structure
>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Length = 439 Back     alignment and structure
>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Length = 439 Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Length = 426 Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Length = 426 Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Length = 426 Back     alignment and structure
>3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Length = 323 Back     alignment and structure
>3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Length = 323 Back     alignment and structure
>3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Length = 323 Back     alignment and structure
>4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Length = 388 Back     alignment and structure
>4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Length = 388 Back     alignment and structure
>4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Length = 388 Back     alignment and structure
>3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Length = 403 Back     alignment and structure
>3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Length = 403 Back     alignment and structure
>3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Length = 403 Back     alignment and structure
>1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Length = 303 Back     alignment and structure
>1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Length = 303 Back     alignment and structure
>1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Length = 433 Back     alignment and structure
>1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Length = 433 Back     alignment and structure
>2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* Length = 308 Back     alignment and structure
>2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* Length = 308 Back     alignment and structure
>1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Length = 401 Back     alignment and structure
>1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Length = 401 Back     alignment and structure
>1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... Length = 306 Back     alignment and structure
>1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... Length = 306 Back     alignment and structure
>3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A Length = 309 Back     alignment and structure
>3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A Length = 309 Back     alignment and structure
>1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... Length = 307 Back     alignment and structure
>1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... Length = 307 Back     alignment and structure
>3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* Length = 275 Back     alignment and structure
>3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* Length = 275 Back     alignment and structure
>2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 Length = 312 Back     alignment and structure
>2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 Length = 312 Back     alignment and structure
>1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A Length = 402 Back     alignment and structure
>1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A Length = 402 Back     alignment and structure
>2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} Length = 275 Back     alignment and structure
>2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} Length = 275 Back     alignment and structure
>2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} Length = 275 Back     alignment and structure
>3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} Length = 395 Back     alignment and structure
>3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} Length = 395 Back     alignment and structure
>2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 Length = 404 Back     alignment and structure
>2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 Length = 404 Back     alignment and structure
>1pca_A Procarboxypeptidase A PCPA; hydrolase(C-terminal peptidase); HET: CIT; 2.00A {Sus scrofa} SCOP: d.58.3.1 PDB: 1pyt_A Length = 403 Back     alignment and structure
>1pca_A Procarboxypeptidase A PCPA; hydrolase(C-terminal peptidase); HET: CIT; 2.00A {Sus scrofa} SCOP: d.58.3.1 PDB: 1pyt_A Length = 403 Back     alignment and structure
>3dgv_A TAFI, carboxypeptidase B2; blood coagulation, fibrinolysis, protein S glycoprotein, hydrolase, metal-binding, metalloprotease, PR secreted, zymogen; HET: NAG NDG FUL BMA; 2.50A {Bos taurus} PDB: 3osl_A 3d68_A* 3d66_A* 3d67_A* Length = 401 Back     alignment and structure
>3dgv_A TAFI, carboxypeptidase B2; blood coagulation, fibrinolysis, protein S glycoprotein, hydrolase, metal-binding, metalloprotease, PR secreted, zymogen; HET: NAG NDG FUL BMA; 2.50A {Bos taurus} PDB: 3osl_A 3d68_A* 3d66_A* 3d67_A* Length = 401 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query710
3mn8_A435 LP15968P; catalytic domain of alpha/beta-hydrolase 100.0
1h8l_A380 Carboxypeptidase GP180 residues 503-882; hydrolase 100.0
1uwy_A426 Carboxypeptidase M; metallopeptidase, GPI-anchor, 100.0
2nsm_A439 Carboxypeptidase N catalytic chain; caroxypeptidas 100.0
3dgv_A401 TAFI, carboxypeptidase B2; blood coagulation, fibr 100.0
3mn8_A435 LP15968P; catalytic domain of alpha/beta-hydrolase 100.0
3v38_A326 Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Th 100.0
3prt_A323 Carboxypeptidase T; hydrolase; 1.66A {Thermoactino 100.0
1kwm_A402 Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A 100.0
1aye_A401 PCPA2, procarboxypeptidase A2; serine protease, zy 100.0
1jqg_A433 Carboxypeptidase A; Pro-protein, hydrolase; 2.50A 100.0
1dtd_A303 Carboxypeptidase A2; carboxypeptidase A2, leech ca 100.0
1z5r_A306 Procarboxypeptidase B; exopeptidase, hydrolase; 1. 100.0
2boa_A404 Carboxypeptidase A4; metalloprocarboxypeptidase, X 100.0
1m4l_A307 Carboxypeptidase A; metalloproteinase, metalloexop 100.0
1h8l_A380 Carboxypeptidase GP180 residues 503-882; hydrolase 100.0
3d4u_A309 Tafia, carboxypeptidase B2; protease-inhibitor com 100.0
2c1c_A312 Carboxypeptidase B; insect, metalloprotease, insen 100.0
2bo9_A308 Carboxypeptidase A4; metallocarboxypeptidase, X-RA 100.0
1uwy_A426 Carboxypeptidase M; metallopeptidase, GPI-anchor, 100.0
1pca_A403 Procarboxypeptidase A PCPA; hydrolase(C-terminal p 100.0
2nsm_A439 Carboxypeptidase N catalytic chain; caroxypeptidas 100.0
2qvp_A275 Uncharacterized protein; putative metallopeptidase 100.0
3dgv_A401 TAFI, carboxypeptidase B2; blood coagulation, fibr 100.0
3k2k_A403 Putative carboxypeptidase; structural genomics, jo 100.0
3l2n_A395 Peptidase M14, carboxypeptidase A; putative carbox 100.0
1kwm_A402 Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A 100.0
1aye_A401 PCPA2, procarboxypeptidase A2; serine protease, zy 100.0
4a37_A388 Metallo-carboxypeptidase; metallo-protease, hydrol 100.0
2boa_A404 Carboxypeptidase A4; metalloprocarboxypeptidase, X 99.98
1pca_A403 Procarboxypeptidase A PCPA; hydrolase(C-terminal p 99.97
1jqg_A433 Carboxypeptidase A; Pro-protein, hydrolase; 2.50A 99.97
3b2y_A275 Metallopeptidase containing CO-catalytic metalloa 99.97
3prt_A323 Carboxypeptidase T; hydrolase; 1.66A {Thermoactino 99.97
4axv_A243 MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} 99.97
1z5r_A306 Procarboxypeptidase B; exopeptidase, hydrolase; 1. 99.97
3v38_A326 Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Th 99.96
1m4l_A307 Carboxypeptidase A; metalloproteinase, metalloexop 99.96
2bo9_A308 Carboxypeptidase A4; metallocarboxypeptidase, X-RA 99.96
1dtd_A303 Carboxypeptidase A2; carboxypeptidase A2, leech ca 99.96
3d4u_A309 Tafia, carboxypeptidase B2; protease-inhibitor com 99.95
2c1c_A312 Carboxypeptidase B; insect, metalloprotease, insen 99.95
2qvp_A275 Uncharacterized protein; putative metallopeptidase 99.87
3k2k_A403 Putative carboxypeptidase; structural genomics, jo 99.85
3l2n_A395 Peptidase M14, carboxypeptidase A; putative carbox 99.83
4a37_A388 Metallo-carboxypeptidase; metallo-protease, hydrol 99.82
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 99.8
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 99.74
2qj8_A332 MLR6093 protein; structural genomics, joint center 99.73
3b2y_A275 Metallopeptidase containing CO-catalytic metalloa 99.71
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 99.63
4axv_A243 MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} 99.61
1yw6_A335 Succinylglutamate desuccinylase; alpha-beta protei 99.55
2bco_A350 Succinylglutamate desuccinylase; NESG, VPR14, stru 99.47
1yw4_A341 Succinylglutamate desuccinylase; alpha-beta protei 99.38
2gu2_A312 ASPA protein; aspartoacylase family, aminoacylase- 99.37
3nh4_A327 Aspartoacylase-2; mercapturates, hydrolase; 2.00A 99.09
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 98.69
2qj8_A332 MLR6093 protein; structural genomics, joint center 98.49
1yw6_A335 Succinylglutamate desuccinylase; alpha-beta protei 98.4
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 98.36
2bco_A350 Succinylglutamate desuccinylase; NESG, VPR14, stru 98.24
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 98.24
1yw4_A341 Succinylglutamate desuccinylase; alpha-beta protei 97.83
1nkg_A 508 Rhamnogalacturonase B; polysaccharide lyase, carbo 97.63
2gu2_A312 ASPA protein; aspartoacylase family, aminoacylase- 97.5
1nkg_A508 Rhamnogalacturonase B; polysaccharide lyase, carbo 97.48
3nh4_A327 Aspartoacylase-2; mercapturates, hydrolase; 2.00A 96.99
2xsu_A312 Catechol 1,2 dioxygenase; oxidoreductase; HET: PIE 96.55
2boy_A254 3-chlorocatechol 1,2-dioxygenase; beta barrel, oxi 96.04
2xsu_A312 Catechol 1,2 dioxygenase; oxidoreductase; HET: PIE 95.94
2azq_A311 Catechol 1,2-dioxygenase; CTD, lipid, isozyme, int 95.91
3th1_A260 Chlorocatechol 1,2-dioxygenase; catechol 1,2-dioxy 95.41
1dmh_A311 1,2-CTD, catechol 1,2-dioxygenase; aromatic hydroc 95.25
3e8v_A82 Possible transglutaminase-family protein; structur 95.22
2boy_A254 3-chlorocatechol 1,2-dioxygenase; beta barrel, oxi 95.09
1tmx_A293 Hydroxyquinol 1,2-dioxygenase; beta barrel, oxidor 95.08
2azq_A311 Catechol 1,2-dioxygenase; CTD, lipid, isozyme, int 94.95
3e8v_A82 Possible transglutaminase-family protein; structur 94.9
3hhy_A280 1,2-CTD, catechol 1,2-dioxygenase; beta-sandwich, 94.8
3o5u_A257 Chlorocatechol 1,2-dioxygenase; beta barrel,oxidor 94.64
3n9t_A290 PNPC; phospholipid binds, N-terminal helix tunnel, 94.62
3kcp_A321 Cellulosomal-scaffolding protein A; dockerin, X-mo 94.58
1vjq_A79 Designed protein; structural genomics, engineered 94.44
2bum_B241 Protocatechuate 3,4-dioxygenase beta chain; oxidor 94.43
3kcp_A321 Cellulosomal-scaffolding protein A; dockerin, X-mo 94.43
3th1_A260 Chlorocatechol 1,2-dioxygenase; catechol 1,2-dioxy 94.26
2bum_A209 Protocatechuate 3,4-dioxygenase alpha chain; oxido 94.1
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molyb 93.97
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molyb 93.93
3g3l_A327 Putative uncharacterized membrane-associated PROT; 93.92
1dmh_A311 1,2-CTD, catechol 1,2-dioxygenase; aromatic hydroc 93.69
1tmx_A293 Hydroxyquinol 1,2-dioxygenase; beta barrel, oxidor 93.68
3t63_A200 3,4-PCD, protocatechuate 3,4-dioxygenase alpha cha 93.46
3t63_M238 3,4-PCD, protocatechuate 3,4-dioxygenase beta chai 93.37
3n9t_A290 PNPC; phospholipid binds, N-terminal helix tunnel, 93.15
3hhy_A280 1,2-CTD, catechol 1,2-dioxygenase; beta-sandwich, 92.54
3irp_X429 URO-adherence factor A; DEV-IGG fold, cell WALL, h 92.52
2bum_B241 Protocatechuate 3,4-dioxygenase beta chain; oxidor 92.51
2bum_A209 Protocatechuate 3,4-dioxygenase alpha chain; oxido 92.2
3t63_A200 3,4-PCD, protocatechuate 3,4-dioxygenase alpha cha 92.16
3o5u_A257 Chlorocatechol 1,2-dioxygenase; beta barrel,oxidor 91.95
2x5p_A121 FBA2, fibronectin binding protein; protein binding 91.35
2x5p_A121 FBA2, fibronectin binding protein; protein binding 90.37
3irp_X429 URO-adherence factor A; DEV-IGG fold, cell WALL, h 90.06
3g3l_A 327 Putative uncharacterized membrane-associated PROT; 89.88
3t63_M238 3,4-PCD, protocatechuate 3,4-dioxygenase beta chai 88.97
1xpn_A170 Hypothetical protein PA1324; B-barrel, structural 88.2
2gjf_A78 Designed protein; procarboxypeptidase, de novo pro 85.18
2pz4_A239 Protein GBS052; SPAB, GRAM-positive pilins, adhesi 85.05
3qec_A150 Putative carbohydrate binding protein; suramin bin 83.68
3qva_A116 Transthyretin-like protein; transthyretin-related 82.62
2ww8_A 893 RRGA, cell WALL surface anchor family protein; IGG 82.24
4eiu_A 249 Uncharacterized hypothetical protein; PF12866 fami 82.09
2pz4_A239 Protein GBS052; SPAB, GRAM-positive pilins, adhesi 81.36
4eiu_A249 Uncharacterized hypothetical protein; PF12866 fami 80.71
2ww8_A 893 RRGA, cell WALL surface anchor family protein; IGG 80.25
>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=3.5e-75  Score=641.25  Aligned_cols=359  Identities=46%  Similarity=0.830  Sum_probs=321.1

Q ss_pred             ccCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCcEEEEEcccccCCceEEEEEEeccCCCCCCCCCCcceEEEeeccccCc
Q psy11074        348 EDADSAGIDLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKYVANMHGDE  427 (710)
Q Consensus       348 ~~~~~~~~~~~~y~ty~e~~~~l~~l~~~~p~~~~~~~iG~S~eGr~i~~l~is~~~~~~~~~~~~kp~v~i~~~~Hg~E  427 (710)
                      ++++..++.+++||+|+||.++|++|+++||+++++.+||+|++||+|++++|+   ++++.+..+||.|+++||+||||
T Consensus        28 ~~~~~~~~~~~~Y~~~~ei~~~l~~l~~~~p~~~~~~~iG~S~eGR~i~~l~is---~~~~~~~~~kp~v~i~~giHg~E  104 (435)
T 3mn8_A           28 IKEDESFLQQPHYASQEQLEDLFAGLEKAYPNQAKVHFLGRSLEGRNLLALQIS---RNTRSRNLLTPPVKYIANMHGDE  104 (435)
T ss_dssp             -CCCCGGGSSCCCCCHHHHHHHHHHHHHHSTTTEEEEEEEECTTSCEEEEEEEC---SCTTSCCTTCCEEEEECCSSTTC
T ss_pred             CCChhhccCCCCCCCHHHHHHHHHHHHHHCCCcEEEEEeeEccCCCEEEEEEEe---CCCCccccCCCEEEEEecCCCCC
Confidence            445556678889999999999999999999999999999999999999999999   55555556899999999999999


Q ss_pred             cchHHHHHHHHHHHHHhcCCCHHHHHHhhcccEEEEEeeCcccchhcccCCCCCCCCCCCCCCCCcccCCCCCCCCCcc-
Q psy11074        428 TVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEY-  506 (710)
Q Consensus       428 ~~g~~~~l~l~~~l~~~y~~~~~~~~ll~~~~i~ivP~~NPDG~~~~~~~~~~~~~~~~~R~n~~GvDlNRnf~~~~~~-  506 (710)
                      |+|++++++++++||.+|++|+++++||++++|+|||++||||++++++++|.+++|+.+|.||.|||||||||+.|.. 
T Consensus       105 ~~g~~~~l~l~~~L~~~y~~d~~~~~ll~~~~i~ivP~~NPDG~~~~~~~~r~~~~~~~~R~n~~GvDLNRnf~~~w~~~  184 (435)
T 3mn8_A          105 TVGRQLLVYMAQYLLGNHERISDLGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNRDFPDRLEQS  184 (435)
T ss_dssp             CHHHHHHHHHHHHHHHHTTTCHHHHHHHHHCEEEEESCSCHHHHHTSCTTCSSCCGGGTTTSCTTCCCGGGCSCCTTC--
T ss_pred             hhHHHHHHHHHHHHHHhccCCHHHHHhhhCeEEEEEeCcCCChhhhhccCccccCCCCCCCccccCCCcccCCCcccCcc
Confidence            9999999999999999999999999999999999999999999999999999965556689999999999999999986 


Q ss_pred             ----cCCCCChHHHHHHHHHHHhCCceEEEEecCCcccc--ccc----------------------------ccCCCCCC
Q psy11074        507 ----EAKKVYEPETQAIMNFIYSNPFVLSGNLHGGAVAR--DYA----------------------------SRNPMMAP  552 (710)
Q Consensus       507 ----~~~~~sepEt~al~~~~~~~~~~~~~~lH~~~~~~--~y~----------------------------~~~~~~~~  552 (710)
                          +..+++||||+|+++|+++++|++++|+|++++..  +|+                            ..++.|+.
T Consensus       185 ~~~~g~~~~sepEt~al~~~~~~~~~~~~idlHs~~~~~~yPy~~~~~~~~~~~~~~~pd~~~~~~la~~~a~~~~~m~~  264 (435)
T 3mn8_A          185 HVHQLRAQSRQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIMRK  264 (435)
T ss_dssp             ------CCCSCHHHHHHHHHHTTSCCCEEEEEECSSCEEEESCSCCSSCCSBSCCCCCTTHHHHHHHHHHHHHTSTTTTT
T ss_pred             cccCCCCccchHHHHHHHHHHhhcCCEEEEEEeCCCeEEEcCCCCCcccccccccCCCCCHHHHHHHHHHHHHhhHHhhc
Confidence                23568999999999999999999999999999822  222                            22345666


Q ss_pred             CCccccCCcccccccceEEeecCchhhhccccCCeEEEEEEecCCCCCCchhhHHHHHHhhhhhhhhhhccccceEEEEE
Q psy11074        553 GHACGFDFKDGITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVHRGVYGIVT  632 (710)
Q Consensus       553 ~~~~~~~~~~g~~~~~~~y~~~G~~~D~~y~~~~~~~~T~Elg~~~~p~~~~l~~~w~~n~~~ll~~i~q~~~gI~G~V~  632 (710)
                      +..|.+.|..|+++|+.||+++|+|+||+|.+++|++||+||+|++||++++|+.+|+.|+++++.++++++.||+|+|+
T Consensus       265 ~~~c~~~f~~G~~nga~~Y~~~G~~~D~~Y~~~~~~~~T~EL~~~k~p~~~~l~~~w~~n~~~ll~~~~~~~~gv~G~V~  344 (435)
T 3mn8_A          265 GNNCNDSFSGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVT  344 (435)
T ss_dssp             SCGGGCCCGGGEEEHHHHBCCSSCHHHHHHHHSSCEEEEEECCSSSSCCGGGHHHHHHHHHHHHHHHHHGGGSSEEEEEE
T ss_pred             CCCccccCCCCcccCceEeecCCchhhhhhhcCCceEEEEEeccccCCccccceeEEeechhhhccccccccceeEEEEE
Confidence            77788889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCCeEEEEeec-ccceeeCCCeEEEeeccCceEEEEEEecCc-eeeeeeceEecCCC--cEEEEEEEecCcCcc
Q psy11074        633 DTYGNPLPSAIITVRWN-DKAVTVTNRGEYWRLLARGKYVVTASAPGY-EPVTTEPLDVPDTE--SVRLDFMLGKKNAFV  708 (710)
Q Consensus       633 d~~g~pi~~A~v~v~~~-~~~~~t~~~G~f~~~l~~G~y~l~vs~~Gy-~~~~~~~v~v~~~~--~~~~~~~L~~~~~~L  708 (710)
                      |.+|+||++|+|.|.+. +++++||.+|.|++.|+||+|+|+|++.|| ++++++ |.|..++  .+.+||+|+++..+|
T Consensus       345 D~~G~pi~gA~V~v~g~~~~~~~Td~~G~y~~~l~pG~Y~l~vs~~Gy~~~~~~~-v~v~~~~~~~~~~~~~L~~~~~~L  423 (435)
T 3mn8_A          345 DASGFPIADANVYVAGLEEKPMRTSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQ-VRVTNDNQEALRLDFKLAPVETNF  423 (435)
T ss_dssp             CSSSCBCTTCEEEETTCTTSCEECCTTCEEEECCCSEEEEEEEEBTTBCCCCCEE-EEECCCSSSCEECCEECCBC----
T ss_pred             CCCCCccCceEEEEecccccceEeCCCCeEEEecCCCcEEEEEEEcccccceEEE-EEEecCCcceeEEEEEEeecCCCC
Confidence            99999999999999996 899999999999888999999999999999 667777 9998876  558999999999998


Q ss_pred             CC
Q psy11074        709 TP  710 (710)
Q Consensus       709 ~e  710 (710)
                      +|
T Consensus       424 ~~  425 (435)
T 3mn8_A          424 DG  425 (435)
T ss_dssp             --
T ss_pred             Ce
Confidence            76
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Back     alignment and structure
>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3dgv_A TAFI, carboxypeptidase B2; blood coagulation, fibrinolysis, protein S glycoprotein, hydrolase, metal-binding, metalloprotease, PR secreted, zymogen; HET: NAG NDG FUL BMA; 2.50A {Bos taurus} PDB: 3osl_A 3d68_A* 3d66_A* 3d67_A* Back     alignment and structure
>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3v38_A Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A 3prt_A Back     alignment and structure
>3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Back     alignment and structure
>1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A Back     alignment and structure
>1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Back     alignment and structure
>1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Back     alignment and structure
>1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Back     alignment and structure
>1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... Back     alignment and structure
>2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 Back     alignment and structure
>1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... Back     alignment and structure
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Back     alignment and structure
>3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A Back     alignment and structure
>2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 Back     alignment and structure
>2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Back     alignment and structure
>1pca_A Procarboxypeptidase A PCPA; hydrolase(C-terminal peptidase); HET: CIT; 2.00A {Sus scrofa} SCOP: d.58.3.1 PDB: 1pyt_A Back     alignment and structure
>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} Back     alignment and structure
>3dgv_A TAFI, carboxypeptidase B2; blood coagulation, fibrinolysis, protein S glycoprotein, hydrolase, metal-binding, metalloprotease, PR secreted, zymogen; HET: NAG NDG FUL BMA; 2.50A {Bos taurus} PDB: 3osl_A 3d68_A* 3d66_A* 3d67_A* Back     alignment and structure
>3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Back     alignment and structure
>3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} Back     alignment and structure
>1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A Back     alignment and structure
>1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Back     alignment and structure
>4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Back     alignment and structure
>2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 Back     alignment and structure
>1pca_A Procarboxypeptidase A PCPA; hydrolase(C-terminal peptidase); HET: CIT; 2.00A {Sus scrofa} SCOP: d.58.3.1 PDB: 1pyt_A Back     alignment and structure
>1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Back     alignment and structure
>3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* Back     alignment and structure
>3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Back     alignment and structure
>4axv_A MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} Back     alignment and structure
>1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... Back     alignment and structure
>3v38_A Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A 3prt_A Back     alignment and structure
>1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... Back     alignment and structure
>2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* Back     alignment and structure
>1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Back     alignment and structure
>3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A Back     alignment and structure
>2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 Back     alignment and structure
>2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} Back     alignment and structure
>3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Back     alignment and structure
>3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} Back     alignment and structure
>4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>4axv_A MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} Back     alignment and structure
>1yw6_A Succinylglutamate desuccinylase; alpha-beta protein., structural genomics, PSI, protein structure initiative; 3.10A {Escherichia coli} SCOP: c.56.5.7 Back     alignment and structure
>2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A Back     alignment and structure
>1yw4_A Succinylglutamate desuccinylase; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.00A {Chromobacterium violaceum} SCOP: c.56.5.7 Back     alignment and structure
>2gu2_A ASPA protein; aspartoacylase family, aminoacylase-2, ACY-2, ACY2_RAT, STRU genomics, PSI, protein structure initiative; HET: MSE; 1.80A {Rattus norvegicus} SCOP: c.56.5.7 PDB: 2q4z_A 2i3c_A 2q51_A 2o4h_A* 2o53_A Back     alignment and structure
>3nh4_A Aspartoacylase-2; mercapturates, hydrolase; 2.00A {Mus musculus} SCOP: c.56.5.0 PDB: 3nh5_A 3nfz_A 3nh8_A* Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>1yw6_A Succinylglutamate desuccinylase; alpha-beta protein., structural genomics, PSI, protein structure initiative; 3.10A {Escherichia coli} SCOP: c.56.5.7 Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>1yw4_A Succinylglutamate desuccinylase; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.00A {Chromobacterium violaceum} SCOP: c.56.5.7 Back     alignment and structure
>1nkg_A Rhamnogalacturonase B; polysaccharide lyase, carbohydrate active enzyme, pectin, LY; 1.50A {Aspergillus aculeatus} SCOP: b.3.1.2 b.18.1.25 b.30.5.10 PDB: 2xhn_A* 3njv_A* 3njx_A Back     alignment and structure
>2gu2_A ASPA protein; aspartoacylase family, aminoacylase-2, ACY-2, ACY2_RAT, STRU genomics, PSI, protein structure initiative; HET: MSE; 1.80A {Rattus norvegicus} SCOP: c.56.5.7 PDB: 2q4z_A 2i3c_A 2q51_A 2o4h_A* 2o53_A Back     alignment and structure
>1nkg_A Rhamnogalacturonase B; polysaccharide lyase, carbohydrate active enzyme, pectin, LY; 1.50A {Aspergillus aculeatus} SCOP: b.3.1.2 b.18.1.25 b.30.5.10 PDB: 2xhn_A* 3njv_A* 3njx_A Back     alignment and structure
>3nh4_A Aspartoacylase-2; mercapturates, hydrolase; 2.00A {Mus musculus} SCOP: c.56.5.0 PDB: 3nh5_A 3nfz_A 3nh8_A* Back     alignment and structure
>2xsu_A Catechol 1,2 dioxygenase; oxidoreductase; HET: PIE; 1.60A {Acinetobacter radioresistens} PDB: 2xsr_A* 2xsv_A* Back     alignment and structure
>2boy_A 3-chlorocatechol 1,2-dioxygenase; beta barrel, oxidoreductase; HET: BHO LPP; 1.9A {Rhodococcus opacus} Back     alignment and structure
>2xsu_A Catechol 1,2 dioxygenase; oxidoreductase; HET: PIE; 1.60A {Acinetobacter radioresistens} PDB: 2xsr_A* 2xsv_A* Back     alignment and structure
>2azq_A Catechol 1,2-dioxygenase; CTD, lipid, isozyme, intradiol, oxido; HET: PCF; 2.65A {Pseudomonas putida} Back     alignment and structure
>3th1_A Chlorocatechol 1,2-dioxygenase; catechol 1,2-dioxygenase family, oxidoreductase, iron bindin; HET: 3PH GOL; 3.40A {Pseudomonas putida} Back     alignment and structure
>1dmh_A 1,2-CTD, catechol 1,2-dioxygenase; aromatic hydrocarbon degradation, alpha/beta FO metalloenzyme, substrate, oxidoreductase; HET: LIO; 1.70A {Acinetobacter SP} SCOP: b.3.6.1 PDB: 1dlq_A* 1dlm_A* 1dlt_A* Back     alignment and structure
>3e8v_A Possible transglutaminase-family protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.40A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2boy_A 3-chlorocatechol 1,2-dioxygenase; beta barrel, oxidoreductase; HET: BHO LPP; 1.9A {Rhodococcus opacus} Back     alignment and structure
>1tmx_A Hydroxyquinol 1,2-dioxygenase; beta barrel, oxidoreductase; HET: HGX; 1.75A {Pimelobacter simplex} Back     alignment and structure
>2azq_A Catechol 1,2-dioxygenase; CTD, lipid, isozyme, intradiol, oxido; HET: PCF; 2.65A {Pseudomonas putida} Back     alignment and structure
>3e8v_A Possible transglutaminase-family protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.40A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3hhy_A 1,2-CTD, catechol 1,2-dioxygenase; beta-sandwich, aromatic hydrocarbons catabolism, dioxygenase metal-binding, oxidoreductase; HET: 6PL; 1.55A {Rhodococcus opacus} PDB: 3hhx_A* 3hgi_A* 3hj8_A* 3hjq_A* 3hjs_A* 3i4v_A* 3hkp_A* 3i51_A* 3i4y_A* Back     alignment and structure
>3o5u_A Chlorocatechol 1,2-dioxygenase; beta barrel,oxidoreductase, oxidoreductase; HET: MYY DHB; 2.35A {Rhodococcus opacus} PDB: 3o32_A* 1s9a_A* 3o6j_A* 3o6r_A* Back     alignment and structure
>3n9t_A PNPC; phospholipid binds, N-terminal helix tunnel, oxidoreductase; HET: HGX FLC; 2.00A {Pseudomonas putida} Back     alignment and structure
>3kcp_A Cellulosomal-scaffolding protein A; dockerin, X-module, carbohydrate metabolism, cell WALL biogenesis/degradation; 1.94A {Clostridium thermocellum atcc 27405} PDB: 3p0d_C 4fl4_C 2b59_B Back     alignment and structure
>1vjq_A Designed protein; structural genomics, engineered protein, PSI, protein struct initiative, structural genomics of pathogenic protozoa CONS SGPP; 2.10A {} SCOP: k.43.1.1 Back     alignment and structure
>2bum_B Protocatechuate 3,4-dioxygenase beta chain; oxidoreductase, aromatic degradation, non-heme iron, beta-SA mixed alpha/beta structure; 1.80A {Acinetobacter SP} SCOP: b.3.6.1 PDB: 1eo2_B 1eoa_B 1eob_B* 1eoc_B* 1eo9_B 2buq_B 2bur_B* 2bux_B 2buy_B 2buz_B* 2bv0_B* 2buu_B* 2but_B* 2buv_B* 2buw_B* Back     alignment and structure
>3kcp_A Cellulosomal-scaffolding protein A; dockerin, X-module, carbohydrate metabolism, cell WALL biogenesis/degradation; 1.94A {Clostridium thermocellum atcc 27405} PDB: 3p0d_C 4fl4_C 2b59_B Back     alignment and structure
>3th1_A Chlorocatechol 1,2-dioxygenase; catechol 1,2-dioxygenase family, oxidoreductase, iron bindin; HET: 3PH GOL; 3.40A {Pseudomonas putida} Back     alignment and structure
>2bum_A Protocatechuate 3,4-dioxygenase alpha chain; oxidoreductase, aromatic degradation, non-heme iron, beta-SA mixed alpha/beta structure; 1.80A {Acinetobacter SP} SCOP: b.3.6.1 PDB: 1eo2_A 1eob_A* 1eoc_A* 1eoa_A 2buq_A 2bur_A* 2but_A 2buu_A* 2buv_A* 2buw_A* 1eo9_A 2bux_A 2buy_A 2buz_A* 2bv0_A* Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>3g3l_A Putative uncharacterized membrane-associated PROT; YP_211325.1, putative membrane-associated protein of unknown function; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1dmh_A 1,2-CTD, catechol 1,2-dioxygenase; aromatic hydrocarbon degradation, alpha/beta FO metalloenzyme, substrate, oxidoreductase; HET: LIO; 1.70A {Acinetobacter SP} SCOP: b.3.6.1 PDB: 1dlq_A* 1dlm_A* 1dlt_A* Back     alignment and structure
>1tmx_A Hydroxyquinol 1,2-dioxygenase; beta barrel, oxidoreductase; HET: HGX; 1.75A {Pimelobacter simplex} Back     alignment and structure
>3t63_A 3,4-PCD, protocatechuate 3,4-dioxygenase alpha chain; iron III dependent non-heme intradiol dioxygenase, oxidoredu; HET: GOL; 1.54A {Pseudomonas putida} PDB: 1ykl_A* 1ykm_A* 1ykn_A* 1yko_A* 1ykp_A* 2pcd_A 1ykk_A* 3lmx_A* 3lxv_A* 3mfl_A* 3mi1_A* 3mi5_A* 3lkt_A* 3mv6_A* 3pca_A* 3pcb_A* 3pcc_A* 3pcd_A 3pce_A* 3pcf_A* ... Back     alignment and structure
>3t63_M 3,4-PCD, protocatechuate 3,4-dioxygenase beta chain; iron III dependent non-heme intradiol dioxygenase, oxidoredu; HET: GOL; 1.54A {Pseudomonas putida} PDB: 3mi1_M* 3mv4_M* 3mi5_M* 3mfl_M* 3mv6_M* 3t67_M 3pca_M* 3pcb_M* 2pcd_M* 3pce_M* 3pcf_M* 3pcc_M* 3pch_M* 3pci_M* 3pcj_M* 3pck_M* 3pcl_M* 3pcm_M* 3pcn_M* 3pcg_M ... Back     alignment and structure
>3n9t_A PNPC; phospholipid binds, N-terminal helix tunnel, oxidoreductase; HET: HGX FLC; 2.00A {Pseudomonas putida} Back     alignment and structure
>3hhy_A 1,2-CTD, catechol 1,2-dioxygenase; beta-sandwich, aromatic hydrocarbons catabolism, dioxygenase metal-binding, oxidoreductase; HET: 6PL; 1.55A {Rhodococcus opacus} PDB: 3hhx_A* 3hgi_A* 3hj8_A* 3hjq_A* 3hjs_A* 3i4v_A* 3hkp_A* 3i51_A* 3i4y_A* Back     alignment and structure
>3irp_X URO-adherence factor A; DEV-IGG fold, cell WALL, hemagglutinin, peptidoglycan-anchor secreted, virulence, cell adhesion; 1.50A {Staphylococcus saprophyticus subsp} PDB: 3irz_A 3is0_X 3is1_X Back     alignment and structure
>2bum_B Protocatechuate 3,4-dioxygenase beta chain; oxidoreductase, aromatic degradation, non-heme iron, beta-SA mixed alpha/beta structure; 1.80A {Acinetobacter SP} SCOP: b.3.6.1 PDB: 1eo2_B 1eoa_B 1eob_B* 1eoc_B* 1eo9_B 2buq_B 2bur_B* 2bux_B 2buy_B 2buz_B* 2bv0_B* 2buu_B* 2but_B* 2buv_B* 2buw_B* Back     alignment and structure
>2bum_A Protocatechuate 3,4-dioxygenase alpha chain; oxidoreductase, aromatic degradation, non-heme iron, beta-SA mixed alpha/beta structure; 1.80A {Acinetobacter SP} SCOP: b.3.6.1 PDB: 1eo2_A 1eob_A* 1eoc_A* 1eoa_A 2buq_A 2bur_A* 2but_A 2buu_A* 2buv_A* 2buw_A* 1eo9_A 2bux_A 2buy_A 2buz_A* 2bv0_A* Back     alignment and structure
>3t63_A 3,4-PCD, protocatechuate 3,4-dioxygenase alpha chain; iron III dependent non-heme intradiol dioxygenase, oxidoredu; HET: GOL; 1.54A {Pseudomonas putida} PDB: 1ykl_A* 1ykm_A* 1ykn_A* 1yko_A* 1ykp_A* 2pcd_A 1ykk_A* 3lmx_A* 3lxv_A* 3mfl_A* 3mi1_A* 3mi5_A* 3lkt_A* 3mv6_A* 3pca_A* 3pcb_A* 3pcc_A* 3pcd_A 3pce_A* 3pcf_A* ... Back     alignment and structure
>3o5u_A Chlorocatechol 1,2-dioxygenase; beta barrel,oxidoreductase, oxidoreductase; HET: MYY DHB; 2.35A {Rhodococcus opacus} PDB: 3o32_A* 1s9a_A* 3o6j_A* 3o6r_A* Back     alignment and structure
>2x5p_A FBA2, fibronectin binding protein; protein binding; 1.60A {Streptococcus pyogenes} Back     alignment and structure
>2x5p_A FBA2, fibronectin binding protein; protein binding; 1.60A {Streptococcus pyogenes} Back     alignment and structure
>3irp_X URO-adherence factor A; DEV-IGG fold, cell WALL, hemagglutinin, peptidoglycan-anchor secreted, virulence, cell adhesion; 1.50A {Staphylococcus saprophyticus subsp} PDB: 3irz_A 3is0_X 3is1_X Back     alignment and structure
>3g3l_A Putative uncharacterized membrane-associated PROT; YP_211325.1, putative membrane-associated protein of unknown function; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3t63_M 3,4-PCD, protocatechuate 3,4-dioxygenase beta chain; iron III dependent non-heme intradiol dioxygenase, oxidoredu; HET: GOL; 1.54A {Pseudomonas putida} PDB: 3mi1_M* 3mv4_M* 3mi5_M* 3mfl_M* 3mv6_M* 3t67_M 3pca_M* 3pcb_M* 2pcd_M* 3pce_M* 3pcf_M* 3pcc_M* 3pch_M* 3pci_M* 3pcj_M* 3pck_M* 3pcl_M* 3pcm_M* 3pcn_M* 3pcg_M ... Back     alignment and structure
>1xpn_A Hypothetical protein PA1324; B-barrel, structural genomics, northeast structural genomics consortium, NESG, protein structure initiative; NMR {Pseudomonas aeruginosa} SCOP: b.3.7.1 Back     alignment and structure
>2gjf_A Designed protein; procarboxypeptidase, de novo protein; NMR {} Back     alignment and structure
>3qec_A Putative carbohydrate binding protein; suramin binding, heparin binding, possible carbohydrate TRAN biofilm formation; HET: PGE; 2.61A {Pseudomonas aeruginosa} Back     alignment and structure
>3qva_A Transthyretin-like protein; transthyretin-related protein, 5-hydroxyisourate hydrolase,; HET: PO4; 1.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>4eiu_A Uncharacterized hypothetical protein; PF12866 family protein, DUF3823, structural genomics, joint for structural genomics, JCSG; HET: PGE; 1.90A {Bacteroides uniformis} Back     alignment and structure
>4eiu_A Uncharacterized hypothetical protein; PF12866 family protein, DUF3823, structural genomics, joint for structural genomics, JCSG; HET: PGE; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 710
d1uwya2296 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic d 7e-69
d1uwya2296 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic d 2e-22
d1uwya2296 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic d 2e-17
d1h8la2301 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic d 3e-62
d1h8la2301 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic d 5e-23
d1h8la2301 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic d 4e-16
d1obra_323 c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyce 1e-46
d1obra_323 c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyce 3e-22
d1obra_323 c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyce 5e-09
d1m4la_307 c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) 1e-42
d1m4la_307 c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) 6e-21
d1m4la_307 c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) 1e-04
d1ayea1307 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo 4e-42
d1ayea1307 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo 3e-21
d1ayea1307 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo 7e-04
d2bo9a1305 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo 1e-40
d2bo9a1305 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo 1e-20
d1jqga1317 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton boll 5e-36
d1jqga1317 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton boll 3e-22
d2c1ca1312 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earwor 1e-33
d2c1ca1312 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earwor 4e-20
d1z5ra1304 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus sc 4e-33
d1z5ra1304 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus sc 3e-18
d1h8la179 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal 1e-07
d1h8la179 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal 1e-07
d1uwya1107 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal 2e-06
d1uwya1107 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal 2e-06
d1yw4a1331 c.56.5.7 (A:2-332) Succinylglutamate desuccinylase 0.004
>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 296 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Zn-dependent exopeptidases
family: Pancreatic carboxypeptidases
domain: Carboxypeptidase M, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  225 bits (575), Expect = 7e-69
 Identities = 133/299 (44%), Positives = 172/299 (57%), Gaps = 40/299 (13%)

Query: 359 RYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFK 418
            Y+    ++AF+    ++Y  +    +IGKSV+GRNLW + +      P    +  P FK
Sbjct: 4   NYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVG---RFPKEHRIGIPEFK 60

Query: 419 YVANMHGDETVGYALMVFLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGK 478
           YVANMHGDETVG  L++ LI YLV  DGKD  IT L+NST I+I+PS+NPDGF A K+  
Sbjct: 61  YVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPD 120

Query: 479 CDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPETQAIMNFIYSNPFVLSGNLHGGA 538
           C    G    +N +  DLNRNFPD FEY      +PET A+M ++ +  FVLS NLHGGA
Sbjct: 121 CYYSIGR---ENYNQYDLNRNFPDAFEYNNVSR-QPETVAVMKWLKTETFVLSANLHGGA 176

Query: 539 -------------------------------VARDYASRNPMMAPGHAC--GFDFKDGIT 565
                                          +A  YASRNP M  G  C    +F +G+T
Sbjct: 177 LVASYPFDNGVQATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGDECKNKMNFPNGVT 236

Query: 566 NGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVH 624
           NG  WY + GGMQD+NY+ + CFEIT+ELSCCKYP+   L  +W  NK SLI+ I+ VH
Sbjct: 237 NGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNNKASLIEYIKQVH 295
>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 296 Back     information, alignment and structure
>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 296 Back     information, alignment and structure
>d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Length = 301 Back     information, alignment and structure
>d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Length = 301 Back     information, alignment and structure
>d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Length = 301 Back     information, alignment and structure
>d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Length = 323 Back     information, alignment and structure
>d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Length = 323 Back     information, alignment and structure
>d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Length = 323 Back     information, alignment and structure
>d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} Length = 307 Back     information, alignment and structure
>d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} Length = 307 Back     information, alignment and structure
>d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} Length = 307 Back     information, alignment and structure
>d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Length = 317 Back     information, alignment and structure
>d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Length = 317 Back     information, alignment and structure
>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Length = 312 Back     information, alignment and structure
>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Length = 312 Back     information, alignment and structure
>d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} Length = 304 Back     information, alignment and structure
>d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} Length = 304 Back     information, alignment and structure
>d1h8la1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Length = 79 Back     information, alignment and structure
>d1h8la1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Length = 79 Back     information, alignment and structure
>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1yw4a1 c.56.5.7 (A:2-332) Succinylglutamate desuccinylase AstE {Chromobacterium violaceum [TaxId: 536]} Length = 331 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query710
d1uwya2296 Carboxypeptidase M, catalytic domain {Human (Homo 100.0
d1h8la2301 Carboxypeptidase D, catalytic domain {Crested duck 100.0
d1obra_323 Carboxypeptidase T {Thermoactinomyces vulgaris [Ta 100.0
d1m4la_307 Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913] 100.0
d1ayea1307 Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 100.0
d1jqga1317 Carboxypeptidase A {Cotton bollworm (Helicoverpa a 100.0
d1z5ra1304 Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823] 100.0
d2c1ca1312 Carboxypeptidase B {Corn earworm (Helicoverpa zea) 100.0
d2bo9a1305 Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 100.0
d1uwya2296 Carboxypeptidase M, catalytic domain {Human (Homo 100.0
d1h8la2301 Carboxypeptidase D, catalytic domain {Crested duck 100.0
d1obra_323 Carboxypeptidase T {Thermoactinomyces vulgaris [Ta 99.97
d1m4la_307 Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913] 99.97
d1ayea1307 Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 99.96
d2bo9a1305 Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 99.96
d1z5ra1304 Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823] 99.96
d1jqga1317 Carboxypeptidase A {Cotton bollworm (Helicoverpa a 99.95
d2c1ca1312 Carboxypeptidase B {Corn earworm (Helicoverpa zea) 99.94
d1h8la179 Carboxypeptidase D C-terminal domain {Crested duck 99.54
d1h8la179 Carboxypeptidase D C-terminal domain {Crested duck 99.54
d1uwya1107 Carboxypeptidase M C-terminal domain {Human (Homo 99.32
d1uwya1107 Carboxypeptidase M C-terminal domain {Human (Homo 99.31
d1nkga187 Rhamnogalacturonase B, RhgB, middle domain {Asperg 99.3
d1nkga187 Rhamnogalacturonase B, RhgB, middle domain {Asperg 99.22
d1yw6a1322 Succinylglutamate desuccinylase AstE {Escherichia 99.19
d1yw4a1331 Succinylglutamate desuccinylase AstE {Chromobacter 99.05
d2bcoa1339 Succinylglutamate desuccinylase AstE {Vibrio parah 98.96
d2g9da1340 Succinylglutamate desuccinylase AstE {Vibrio chole 98.87
d1vlfn179 Transhydroxylase beta subunit, BthL, C-terminal do 98.81
d2gu2a1307 Aspartoacylase AspA {Rat (Rattus norvegicus) [TaxI 98.65
d1vlfn179 Transhydroxylase beta subunit, BthL, C-terminal do 98.64
d1yw6a1322 Succinylglutamate desuccinylase AstE {Escherichia 97.78
d2g9da1340 Succinylglutamate desuccinylase AstE {Vibrio chole 97.04
d1yw4a1331 Succinylglutamate desuccinylase AstE {Chromobacter 96.96
d2bcoa1339 Succinylglutamate desuccinylase AstE {Vibrio parah 96.76
d2gu2a1307 Aspartoacylase AspA {Rat (Rattus norvegicus) [TaxI 96.37
d1dmha_309 Catechol 1,2-dioxygenase {Acinetobacter calcoaceti 95.72
d1s9aa_256 Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus 95.57
d2b59b296 Cellulosomal scaffolding protein A {Clostridium th 95.07
d2burb1238 Protocatechuate-3,4-dioxygenase, beta chain {Acine 94.88
d3pcca_200 Protocatechuate-3,4-dioxygenase, alpha chain {Pseu 94.78
d2boaa294 Procarboxypeptidase A {Human (Homo sapiens) [TaxId 94.72
d1dmha_309 Catechol 1,2-dioxygenase {Acinetobacter calcoaceti 94.5
d1kwma295 Procarboxypeptidase B {Human (Homo sapiens) [TaxId 94.4
d1s9aa_256 Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus 94.4
d2b59b296 Cellulosomal scaffolding protein A {Clostridium th 94.35
d1pcaa194 Procarboxypeptidase A {Pig (Sus scrofa) [TaxId: 98 94.29
d1ayea294 Procarboxypeptidase A {Human (Homo sapiens) [TaxId 94.25
d1jqga292 Procarboxypeptidase A {Cotton bollworm (Helicoverp 94.21
d3pcca_200 Protocatechuate-3,4-dioxygenase, alpha chain {Pseu 93.94
d1cwva194 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 93.94
d2burb1238 Protocatechuate-3,4-dioxygenase, beta chain {Acine 93.57
d2bura1202 Protocatechuate-3,4-dioxygenase, alpha chain {Acin 93.25
d3pccm_236 Protocatechuate-3,4-dioxygenase, beta chain {Pseud 92.98
d2bura1202 Protocatechuate-3,4-dioxygenase, alpha chain {Acin 92.58
d1cwva296 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 91.65
d3pccm_236 Protocatechuate-3,4-dioxygenase, beta chain {Pseud 91.42
d1cwva194 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 90.53
d1cwva296 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 87.46
d1f00i195 Intimin {Escherichia coli [TaxId: 562]} 85.79
d1xpna_170 Hypothetical protein PA1324 {Pseudomonas aeruginos 82.8
d1f00i195 Intimin {Escherichia coli [TaxId: 562]} 81.99
>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Zn-dependent exopeptidases
family: Pancreatic carboxypeptidases
domain: Carboxypeptidase M, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.1e-58  Score=481.52  Aligned_cols=261  Identities=50%  Similarity=0.927  Sum_probs=239.9

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCcEEEEEcccccCCceEEEEEEeccCCCCCCCCCCcceEEEeeccccCccchHHHHH
Q psy11074        356 DLQRYYNSTELDAFILKTVKSYPHLVRAETIGKSVQGRNLWAVEITHDVDNPDGRTLMKPMFKYVANMHGDETVGYALMV  435 (710)
Q Consensus       356 ~~~~y~ty~e~~~~l~~l~~~~p~~~~~~~iG~S~eGr~i~~l~is~~~~~~~~~~~~kp~v~i~~~~Hg~E~~g~~~~l  435 (710)
                      ++ +||||+||.++|++|+++||+++++.+||+|++||+|++++||   ++++.+..+||.|+|+||+|||||+|+++++
T Consensus         2 d~-~Y~ty~ei~~~l~~l~~~~p~~~~~~~iG~S~eGr~i~~l~i~---~~~~~~~~~kp~v~~~~giHa~E~~g~~~~~   77 (296)
T d1uwya2           2 DF-NYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVG---RFPKEHRIGIPEFKYVANMHGDETVGRELLL   77 (296)
T ss_dssp             CS-SCCCHHHHHHHHHHHHHHTTTSEEEEEEEECTTSCEEEEEEES---SSTTSCBTTBCEEEEEECCSTTCCHHHHHHH
T ss_pred             CC-CcCCHHHHHHHHHHHHHHCCCceEEEEeEECCCCCeEEEEEEe---CCCCCccCCCceEEEEeccCCCCccHHHHHH
Confidence            45 4999999999999999999999999999999999999999999   6777777789999999999999999999999


Q ss_pred             HHHHHHHHhcCCCHHHHHHhhcccEEEEEeeCcccchhcccCCCCCCCCCCCCCCCCcccCCCCCCCCCcccCCCCChHH
Q psy11074        436 FLIQYLVLKDGKDDRITQLLNSTDIYIVPSINPDGFAAAKEGKCDSLDGYVGRKNAHGVDLNRNFPDQFEYEAKKVYEPE  515 (710)
Q Consensus       436 ~l~~~l~~~y~~~~~~~~ll~~~~i~ivP~~NPDG~~~~~~~~~~~~~~~~~R~n~~GvDlNRnf~~~~~~~~~~~sepE  515 (710)
                      +++++|+++|++|+.++.||++++|+|||++||||+++++++++.   |+++|.||+|||||||||..|.+ ..++||||
T Consensus        78 ~~~~~L~~~~~~d~~~~~ll~~~~i~ivP~~NPDG~~~~~~~~~~---~~~~r~n~~GvDlNRNf~~~~~g-~~~~sepE  153 (296)
T d1uwya2          78 HLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCY---YSIGRENYNQYDLNRNFPDAFEY-NNVSRQPE  153 (296)
T ss_dssp             HHHHHHHHHTTTSHHHHHHHHHCEEEEESCSCHHHHHHCSSCCSS---CCSCSSCTTSCCTTSCSCCSSSC-CCCCCCHH
T ss_pred             HHHHHHhhccccCHHHHHhhhcceEEEEeeecCchHhhccccccc---ccCccCCCccccCccccccccCC-CccccHHH
Confidence            999999999999999999999999999999999999999999999   99999999999999999999987 77899999


Q ss_pred             HHHHHHHHHhCCceEEEEecCCccccccccc-------------------------------CCCCCCCCccc--cCCcc
Q psy11074        516 TQAIMNFIYSNPFVLSGNLHGGAVARDYASR-------------------------------NPMMAPGHACG--FDFKD  562 (710)
Q Consensus       516 t~al~~~~~~~~~~~~~~lH~~~~~~~y~~~-------------------------------~~~~~~~~~~~--~~~~~  562 (710)
                      |+||++|+++++|++++++|+++....|+..                               ++.|..+..|.  ..|..
T Consensus       154 t~av~~~~~~~~~~~~i~~Hs~~~~i~yP~~~~~~~~~~~~~~~~~pd~~~~~~la~~~~~~~~~~~~~~~~~~~~~~~~  233 (296)
T d1uwya2         154 TVAVMKWLKTETFVLSANLHGGALVASYPFDNGVQATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGDECKNKMNFPN  233 (296)
T ss_dssp             HHHHHHHHHHSCEEECCEEECSEEEEEESCSSCCGGGTGGGTCCCCTTHHHHHHHHHHHHHTCTTTTTSSCCSSSCCCST
T ss_pred             HHHHHHHHHhCCceEEEEecCCCeeEecCCCCCcccccccccccCCCCHHHHHHHHHHHHHhchhhccCCCCCCCCCCCC
Confidence            9999999999999999999999985444322                               22333344443  45778


Q ss_pred             cccccceEEeecCchhhhccccCCeEEEEEEecCCCCCCchhhHHHHHHhhhhhhhhhhccc
Q psy11074        563 GITNGNYWYKVTGGMQDFNYVHSNCFEITMELSCCKYPKASDLKHYWAANKESLIKLIENVH  624 (710)
Q Consensus       563 g~~~~~~~y~~~G~~~D~~y~~~~~~~~T~Elg~~~~p~~~~l~~~w~~n~~~ll~~i~q~~  624 (710)
                      |+++++.||+++|++.||+|...+++++|+|+|||++|+.++|+.+|++|+++|+.+++++|
T Consensus       234 g~~~~~~~Y~~~G~~~Dw~y~~~~~~~~T~El~~~~~P~~~~l~~~W~~n~~all~~l~~~h  295 (296)
T d1uwya2         234 GVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNNKASLIEYIKQVH  295 (296)
T ss_dssp             TEEESTTTCCCSSCHHHHHHHTSCCBCCEEEEESSSSCCGGGHHHHHHTTHHHHHHHHGGGG
T ss_pred             CccccceEeecCCCccccccccCCEEEEEEEecCCCCCCHHHHHHHHHHHHHHHHHHHHHhc
Confidence            88899999999999999999999999999999999999999999999999999999999987
>d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Back     information, alignment and structure
>d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Back     information, alignment and structure
>d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Back     information, alignment and structure
>d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Back     information, alignment and structure
>d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Back     information, alignment and structure
>d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Back     information, alignment and structure
>d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Back     information, alignment and structure
>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Back     information, alignment and structure
>d1h8la1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Back     information, alignment and structure
>d1h8la1 b.3.2.1 (A:305-383) Carboxypeptidase D C-terminal domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Back     information, alignment and structure
>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkga1 b.3.1.2 (A:251-337) Rhamnogalacturonase B, RhgB, middle domain {Aspergillus aculeatus [TaxId: 5053]} Back     information, alignment and structure
>d1nkga1 b.3.1.2 (A:251-337) Rhamnogalacturonase B, RhgB, middle domain {Aspergillus aculeatus [TaxId: 5053]} Back     information, alignment and structure
>d1yw6a1 c.56.5.7 (A:1-322) Succinylglutamate desuccinylase AstE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yw4a1 c.56.5.7 (A:2-332) Succinylglutamate desuccinylase AstE {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2bcoa1 c.56.5.7 (A:4-342) Succinylglutamate desuccinylase AstE {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2g9da1 c.56.5.7 (A:3-342) Succinylglutamate desuccinylase AstE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vlfn1 b.3.5.1 (N:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d2gu2a1 c.56.5.7 (A:4-310) Aspartoacylase AspA {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vlfn1 b.3.5.1 (N:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1yw6a1 c.56.5.7 (A:1-322) Succinylglutamate desuccinylase AstE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g9da1 c.56.5.7 (A:3-342) Succinylglutamate desuccinylase AstE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yw4a1 c.56.5.7 (A:2-332) Succinylglutamate desuccinylase AstE {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2bcoa1 c.56.5.7 (A:4-342) Succinylglutamate desuccinylase AstE {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2gu2a1 c.56.5.7 (A:4-310) Aspartoacylase AspA {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dmha_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1s9aa_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]} Back     information, alignment and structure
>d2b59b2 b.3.2.2 (B:8-103) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2burb1 b.3.6.1 (B:303-540) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]} Back     information, alignment and structure
>d3pcca_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2boaa2 d.58.3.1 (A:4-99) Procarboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dmha_ b.3.6.1 (A:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kwma2 d.58.3.1 (A:1A-95A) Procarboxypeptidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9aa_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]} Back     information, alignment and structure
>d2b59b2 b.3.2.2 (B:8-103) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pcaa1 d.58.3.1 (A:4A-99A) Procarboxypeptidase A {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ayea2 d.58.3.1 (A:4A-99A) Procarboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqga2 d.58.3.1 (A:4P-100P) Procarboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Back     information, alignment and structure
>d3pcca_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cwva1 b.1.14.1 (A:503-596) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2burb1 b.3.6.1 (B:303-540) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]} Back     information, alignment and structure
>d2bura1 b.3.6.1 (A:4-200) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]} Back     information, alignment and structure
>d3pccm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bura1 b.3.6.1 (A:4-200) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]} Back     information, alignment and structure
>d1cwva2 b.1.14.1 (A:597-692) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d3pccm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cwva1 b.1.14.1 (A:503-596) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1cwva2 b.1.14.1 (A:597-692) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1f00i1 b.1.14.1 (I:658-752) Intimin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpna_ b.3.7.1 (A:) Hypothetical protein PA1324 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f00i1 b.1.14.1 (I:658-752) Intimin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure