Psyllid ID: psy11095

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MNLNFLCYLLFTWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQETVLEGEPIGSKVTQVNAIDKDGTFPNNQLLDN
cccccEEEEEccEEEEEEccccccccccEEEEEEEEEEccccccccEEEEEEEEEEccccccccccccEEEEEcccccccEEEEEEEEcccccccccEEEEc
cccccEEEEEcccEEEEEEcccccccccEEEEEEEEEcccccccccEEEEEEEEEEccccccccccccEEEEccccccccEEEEEEEEcccccccccccccc
MNLNFLCYLLFTwadikvnhpldyetiKEYNLTIRVENNGAQQLASEATVHIILEDvndeiplftereqetvlegepigskvtqvnaidkdgtfpnnqlldn
MNLNFLCYLLFTWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQetvlegepigskvtqvnaidkdgtfpnnqlldn
MNLNFLCYLLFTWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQETVLEGEPIGSKVTQVNAIDKDGTFPNNQLLDN
**LNFLCYLLFTWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTE************************************
*NLNFLCYLLFTWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQETVLEGEPIGSKVTQVNAIDKDGTFPNNQLLDN
MNLNFLCYLLFTWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQETVLEGEPIGSKVTQVNAIDKDGTFPNNQLLDN
*NLNFLCYLLFTWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQETVLEGEPIGSKVTQVNAIDKD***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLNFLCYLLFTWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQETVLEGEPIGSKVTQVNAIDKDGTFPNNQLLDN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query102 2.2.26 [Sep-21-2011]
O15943 3097 Neural-cadherin OS=Drosop yes N/A 0.803 0.026 0.943 2e-43
Q24298 1507 DE-cadherin OS=Drosophila no N/A 0.833 0.056 0.461 1e-12
P33450 5147 Cadherin-related tumor su no N/A 0.813 0.016 0.406 9e-10
Q9HCU4 2923 Cadherin EGF LAG seven-pa yes N/A 0.754 0.026 0.417 4e-09
Q9V5N8 3579 Protocadherin-like wing p no N/A 0.764 0.021 0.354 6e-09
Q9NYQ7 3312 Cadherin EGF LAG seven-pa no N/A 0.745 0.022 0.365 2e-08
O35161 3034 Cadherin EGF LAG seven-pa no N/A 0.892 0.029 0.365 2e-08
Q9NYQ6 3014 Cadherin EGF LAG seven-pa no N/A 0.745 0.025 0.371 7e-08
Q91ZI0 3301 Cadherin EGF LAG seven-pa no N/A 0.745 0.023 0.353 8e-08
Q9R0M0 2920 Cadherin EGF LAG seven-pa yes N/A 0.754 0.026 0.425 1e-07
>sp|O15943|CADN_DROME Neural-cadherin OS=Drosophila melanogaster GN=CadN PE=1 SV=2 Back     alignment and function desciption
 Score =  173 bits (439), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 88/88 (100%)

Query: 12   TWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQET 71
            TWADIKVNHPLDYE+IKEYNLTIRVENNGAQQLASEATV+I+LEDVNDEIPLFTEREQET
Sbjct: 1247 TWADIKVNHPLDYESIKEYNLTIRVENNGAQQLASEATVYIMLEDVNDEIPLFTEREQET 1306

Query: 72   VLEGEPIGSKVTQVNAIDKDGTFPNNQL 99
            VLEGEPIG+KVTQVNAIDKDGTFPNNQ+
Sbjct: 1307 VLEGEPIGTKVTQVNAIDKDGTFPNNQV 1334
Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May associate with arm neural isoform and participate in the transmission of developmental information.
Drosophila melanogaster (taxid: 7227)
>sp|Q24298|CADE_DROME DE-cadherin OS=Drosophila melanogaster GN=shg PE=1 SV=2 Back     alignment and function description
>sp|P33450|FAT_DROME Cadherin-related tumor suppressor OS=Drosophila melanogaster GN=ft PE=1 SV=3 Back     alignment and function description
>sp|Q9HCU4|CELR2_HUMAN Cadherin EGF LAG seven-pass G-type receptor 2 OS=Homo sapiens GN=CELSR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9V5N8|STAN_DROME Protocadherin-like wing polarity protein stan OS=Drosophila melanogaster GN=stan PE=1 SV=4 Back     alignment and function description
>sp|Q9NYQ7|CELR3_HUMAN Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens GN=CELSR3 PE=1 SV=2 Back     alignment and function description
>sp|O35161|CELR1_MOUSE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus GN=Celsr1 PE=2 SV=3 Back     alignment and function description
>sp|Q9NYQ6|CELR1_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens GN=CELSR1 PE=1 SV=1 Back     alignment and function description
>sp|Q91ZI0|CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor 3 OS=Mus musculus GN=Celsr3 PE=2 SV=2 Back     alignment and function description
>sp|Q9R0M0|CELR2_MOUSE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Mus musculus GN=Celsr2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
357610680 925 DN cadherin-like protein [Danaus plexipp 0.784 0.086 0.943 7e-43
270008135 1148 DN cadherin-like protein [Tribolium cast 0.784 0.069 0.955 2e-42
322793230176 hypothetical protein SINV_09319 [Solenop 0.862 0.5 0.943 2e-42
307200811196 Neural-cadherin [Harpegnathos saltator] 0.862 0.448 0.943 2e-42
328714938 2288 PREDICTED: neural-cadherin-like [Acyrtho 0.813 0.036 0.943 2e-42
189237687 3035 PREDICTED: similar to Neural-cadherin pr 0.813 0.027 0.955 2e-42
307173874176 Neural-cadherin [Camponotus floridanus] 0.862 0.5 0.943 3e-42
332029952202 Neural-cadherin [Acromyrmex echinatior] 0.862 0.435 0.943 3e-42
194880377 1514 GG21728 [Drosophila erecta] gi|190657610 0.862 0.058 0.943 4e-42
195065831 243 GH25257 [Drosophila grimshawi] gi|193891 0.862 0.362 0.943 7e-42
>gi|357610680|gb|EHJ67094.1| DN cadherin-like protein [Danaus plexippus] Back     alignment and taxonomy information
 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 89/89 (100%)

Query: 11  FTWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQE 70
           FTWADIKVNHPLDYE+IKEYNLTIRVENNGAQQLASEATV+I+LEDVNDEIPLFTEREQE
Sbjct: 762 FTWADIKVNHPLDYESIKEYNLTIRVENNGAQQLASEATVYIMLEDVNDEIPLFTEREQE 821

Query: 71  TVLEGEPIGSKVTQVNAIDKDGTFPNNQL 99
           TVLEGEPIG+KVTQVNAIDKDGTFPNNQ+
Sbjct: 822 TVLEGEPIGTKVTQVNAIDKDGTFPNNQV 850

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270008135|gb|EFA04583.1| DN cadherin-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322793230|gb|EFZ16887.1| hypothetical protein SINV_09319 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307200811|gb|EFN80864.1| Neural-cadherin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328714938|ref|XP_001945353.2| PREDICTED: neural-cadherin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189237687|ref|XP_969192.2| PREDICTED: similar to Neural-cadherin precursor (Cadherin-N protein) (DN-cadherin) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307173874|gb|EFN64631.1| Neural-cadherin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332029952|gb|EGI69777.1| Neural-cadherin [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|194880377|ref|XP_001974423.1| GG21728 [Drosophila erecta] gi|190657610|gb|EDV54823.1| GG21728 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195065831|ref|XP_001996747.1| GH25257 [Drosophila grimshawi] gi|193891967|gb|EDV90833.1| GH25257 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
FB|FBgn0015609 3097 CadN "Cadherin-N" [Drosophila 0.862 0.028 0.943 3.5e-39
FB|FBgn0003391 1507 shg "shotgun" [Drosophila mela 0.833 0.056 0.461 1.1e-12
ZFIN|ZDB-GENE-030616-78 2699 celsr1a "cadherin EGF LAG seve 0.745 0.028 0.461 4.8e-10
ZFIN|ZDB-GENE-100922-84 2780 si:dkey-22o22.2 "si:dkey-22o22 0.764 0.028 0.468 2.1e-09
FB|FBgn0001075 5147 ft "fat" [Drosophila melanogas 0.813 0.016 0.406 2.5e-09
ZFIN|ZDB-GENE-070122-3 2916 celsr3 "cadherin, EGF LAG seve 0.754 0.026 0.417 4.7e-09
UNIPROTKB|F1NHQ5 2500 LOC427547 "Uncharacterized pro 0.764 0.031 0.455 5.1e-09
UNIPROTKB|F1NHQ1 2501 LOC427547 "Uncharacterized pro 0.764 0.031 0.455 5.1e-09
UNIPROTKB|F1NJK1 2537 LOC427547 "Uncharacterized pro 0.764 0.030 0.455 5.1e-09
UNIPROTKB|F1NBM7 2449 LOC414835 "Uncharacterized pro 0.764 0.031 0.417 1e-08
FB|FBgn0015609 CadN "Cadherin-N" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 436 (158.5 bits), Expect = 3.5e-39, P = 3.5e-39
 Identities = 83/88 (94%), Positives = 88/88 (100%)

Query:    12 TWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQET 71
             TWADIKVNHPLDYE+IKEYNLTIRVENNGAQQLASEATV+I+LEDVNDEIPLFTEREQET
Sbjct:  1247 TWADIKVNHPLDYESIKEYNLTIRVENNGAQQLASEATVYIMLEDVNDEIPLFTEREQET 1306

Query:    72 VLEGEPIGSKVTQVNAIDKDGTFPNNQL 99
             VLEGEPIG+KVTQVNAIDKDGTFPNNQ+
Sbjct:  1307 VLEGEPIGTKVTQVNAIDKDGTFPNNQV 1334
GO:0005911 "cell-cell junction" evidence=IDA
GO:0016021 "integral to membrane" evidence=ISS
GO:0007156 "homophilic cell adhesion" evidence=ISS;IDA
GO:0005886 "plasma membrane" evidence=ISS;IDA;TAS
GO:0016339 "calcium-dependent cell-cell adhesion" evidence=ISS;IPI
GO:0005515 "protein binding" evidence=IPI
GO:0007413 "axonal fasciculation" evidence=TAS
GO:0050839 "cell adhesion molecule binding" evidence=ISS
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0004872 "receptor activity" evidence=ISS
GO:0007155 "cell adhesion" evidence=NAS
GO:0007412 "axon target recognition" evidence=IMP
GO:0008013 "beta-catenin binding" evidence=NAS
GO:0007411 "axon guidance" evidence=IGI;IMP;NAS
GO:0050774 "negative regulation of dendrite morphogenesis" evidence=IMP
GO:0048846 "axon extension involved in axon guidance" evidence=IMP
GO:0016318 "ommatidial rotation" evidence=IMP
GO:0045463 "R8 cell development" evidence=IMP
GO:0044331 "cell-cell adhesion mediated by cadherin" evidence=IDA
GO:0045467 "R7 cell development" evidence=IMP
GO:0031290 "retinal ganglion cell axon guidance" evidence=IMP
GO:0048841 "regulation of axon extension involved in axon guidance" evidence=IMP
GO:0048675 "axon extension" evidence=IMP
GO:0048814 "regulation of dendrite morphogenesis" evidence=IMP
GO:0045296 "cadherin binding" evidence=IPI
GO:0005509 "calcium ion binding" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IPI
FB|FBgn0003391 shg "shotgun" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-78 celsr1a "cadherin EGF LAG seven-pass G-type receptor 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-100922-84 si:dkey-22o22.2 "si:dkey-22o22.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0001075 ft "fat" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070122-3 celsr3 "cadherin, EGF LAG seven-pass G-type receptor 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHQ5 LOC427547 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHQ1 LOC427547 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJK1 LOC427547 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBM7 LOC414835 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O15943CADN_DROMENo assigned EC number0.94310.80390.0264yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
smart0011281 smart00112, CA, Cadherin repeats 1e-13
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 3e-12
pfam0002892 pfam00028, Cadherin, Cadherin domain 2e-08
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information 
 Score = 60.1 bits (146), Expect = 1e-13
 Identities = 21/47 (44%), Positives = 25/47 (53%)

Query: 16 IKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIP 62
          I    PLD E   EY LT+   + G   L+S ATV I + DVND  P
Sbjct: 35 ITTTKPLDREEQPEYTLTVEATDGGGPPLSSTATVTITVLDVNDNAP 81

Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium. Length = 81
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 102
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.81
KOG4289|consensus 2531 99.78
KOG4289|consensus 2531 99.75
KOG1219|consensus 4289 99.73
KOG1219|consensus 4289 99.67
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.57
KOG1834|consensus 952 99.43
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.12
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 98.27
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 97.59
KOG1834|consensus 952 97.41
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 94.3
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 90.37
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 86.2
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information 
Probab=99.81  E-value=2.1e-18  Score=111.36  Aligned_cols=87  Identities=36%  Similarity=0.502  Sum_probs=79.4

Q ss_pred             cEEEC-CceeEEEcCcCCcccCCEEEEEEEEEECCCCCceeeEEEEEEEecCCCCCcEeecCcce-EEeCCCCCCcEEEE
Q psy11095          7 CYLLF-TWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQE-TVLEGEPIGSKVTQ   84 (102)
Q Consensus         7 ~f~~~-~~G~i~~~~~LD~E~~~~~~l~v~a~d~~~~~~~~~~~v~i~v~d~Nd~~P~f~~~~~~-~v~E~~~~g~~v~~   84 (102)
                      .|.++ .+|.|++.++||||....|.|.|.|.|.+.+.++....++|.|.|+||++|.|....|. .+.|+.++|+.+++
T Consensus        44 ~F~i~~~tG~l~~~~~lD~e~~~~~~l~v~a~D~g~~~~~~~~~v~I~V~d~Nd~~P~~~~~~~~~~v~e~~~~~~~i~~  123 (199)
T cd00031          44 LFSIDPNTGVITTTKPLDREEQSEYTLTVVASDGGGPPLSSTATVTVTVLDVNDNPPVFEQSSYEASVPENAPPGTVVGT  123 (199)
T ss_pred             cEEEeCCCCEEEECCCCCCcCCceEEEEEEEEECCcCcceeEEEEEEEEccCCCCCCcccccceEEEEeCCCCCCCEEEE
Confidence            45555 46999999999999999999999999988777778999999999999999999977665 99999999999999


Q ss_pred             EEEEeCCCC
Q psy11095         85 VNAIDKDGT   93 (102)
Q Consensus        85 v~a~D~D~~   93 (102)
                      +.|+|+|.+
T Consensus       124 ~~a~D~D~~  132 (199)
T cd00031         124 VTATDADSG  132 (199)
T ss_pred             EEEEcCCCC
Confidence            999999987

>KOG4289|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
3k5s_A217 Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len 2e-06
3k5r_A218 Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt 3e-06
3lni_A213 Crystal Structure Of E-Cadherin Ec12 E89a Length = 1e-04
3q2l_A213 Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 2e-04
1edh_A226 E-Cadherin Domains 1 And 2 In Complex With Calcium 5e-04
1ff5_A219 Structure Of E-Cadherin Double Domain Length = 219 5e-04
3q2v_A 550 Crystal Structure Of Mouse E-Cadherin Ectodomain Le 6e-04
3lng_A215 Crystal Structure Of E-Cadherin Ec12 Aa Extension L 6e-04
3lne_A213 Crystal Structure Of E-Cadherin Ec12 K14e Length = 6e-04
3qrb_A213 Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt 6e-04
2qvf_B213 Mouse E-cadherin Domains 1,2 Length = 213 6e-04
1q1p_A212 E-Cadherin Activation Length = 212 6e-04
1suh_A146 Amino-Terminal Domain Of Epithelial Cadherin In The 6e-04
3lnh_A213 Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 6e-04
3q2n_A213 Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 6e-04
3lnf_A213 Crystal Structure Of E-Cadherin Ec12 K14ew2a Length 7e-04
>pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 Back     alignment and structure 
Iteration: 1

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
Query: 14  ADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQ-ETV 72
            D+ V  PLD E I  Y L + V +   + +     + I + D ND  P+F E      V
Sbjct: 57  GDVSVTRPLDREAIANYQLEVEVTDLSGKIIDGPVRLDISVIDQNDNRPMFKEGPYVGHV 116
Query: 73  LEGEPIGSKVTQVNAIDKDGTFPNNQLL 100
           +EG P G+ V ++ A D D    +N LL
Sbjct: 117 MEGSPTGTTVMRMTAFDADDPSTDNALL 144
>pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 Back     alignment and structure
>pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 Back     alignment and structure
>pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 Back     alignment and structure
>pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 Back     alignment and structure
>pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 Back     alignment and structure
>pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 Back     alignment and structure
>pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 Back     alignment and structure
>pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 Back     alignment and structure
>pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 Back     alignment and structure
>pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 Back     alignment and structure
>pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 Back     alignment and structure
>pdb|1SUH|A Chain A, Amino-Terminal Domain Of Epithelial Cadherin In The Calcium Bound State, Nmr, 20 Structures Length = 146 Back     alignment and structure
>pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 Back     alignment and structure
>pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 Back     alignment and structure
>pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 8e-21
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 1e-20
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 3e-05
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 2e-20
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 8e-07
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-19
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-17
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 4e-17
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-12
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 5e-07
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 7e-04
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 3e-19
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 9e-07
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 4e-19
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 9e-18
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-14
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-11
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 3e-07
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 9e-19
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 3e-18
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-16
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 6e-12
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 6e-06
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 4e-18
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 8e-18
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 6e-17
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 4e-12
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 5e-18
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 7e-06
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 9e-18
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 7e-08
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 4e-17
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 8e-10
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 6e-17
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 2e-15
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 6e-07
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 8e-17
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 1e-15
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 7e-07
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 4e-15
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-14
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-12
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 6e-05
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 4e-13
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 9e-12
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 6e-10
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 4e-09
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 6e-09
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 2e-05
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 4e-08
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 3e-07
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 3e-07
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 5e-07
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 2e-05
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 2e-05
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 4e-05
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 8e-05
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
 Score = 81.7 bits (202), Expect = 8e-21
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 15  DIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTERE-QETVL 73
            + V   LD ETI  Y L +   +   + L     + +I+ D ND  P+F E      V+
Sbjct: 59  SVSVTRTLDRETIATYQLYVETTDASGKTLEGPVPLEVIVIDQNDNRPIFREGPYIGHVM 118

Query: 74  EGEPIGSKVTQVNAIDKD 91
           EG P G+ V ++ A D D
Sbjct: 119 EGSPTGTTVMRMTAFDAD 136
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.92
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.92
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.92
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.91
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.91
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.9
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.87
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.87
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 99.87
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.86
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.85
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.85
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.84
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 99.84
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.84
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.83
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.81
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.81
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.81
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.79
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.78
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.78
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.76
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.73
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.73
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.6
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.56
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.53
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.42
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.42
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.41
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.41
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.41
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.38
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.37
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.36
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.34
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.29
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.27
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.0
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 98.95
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 98.89
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 98.86
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 98.85
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 98.82
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 98.71
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 96.56
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 96.08
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 96.08
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 95.92
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 95.83
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 95.65
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 94.84
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 91.74
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 87.6
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 80.48
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
Probab=99.92  E-value=1.7e-24  Score=141.47  Aligned_cols=87  Identities=30%  Similarity=0.428  Sum_probs=81.6

Q ss_pred             cEEECC-ceeEEEcCcCCcccCCEEEEEEEEEECCCCCceeeEEEEEEEecCCCCCcEeecCcce-EEeCCCCCCcEEEE
Q psy11095          7 CYLLFT-WADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQE-TVLEGEPIGSKVTQ   84 (102)
Q Consensus         7 ~f~~~~-~G~i~~~~~LD~E~~~~~~l~v~a~d~~~~~~~~~~~v~i~v~d~Nd~~P~f~~~~~~-~v~E~~~~g~~v~~   84 (102)
                      .|.+++ +|.|++.++||||....|.|.|.|.|.+++++++.+.|+|.|.|+|||+|.|....|. .|+|+.++|+.|++
T Consensus        50 ~F~Id~~tG~i~~~~~LDrE~~~~y~l~v~a~D~~~~~~~~~~~v~I~V~DvNDn~P~F~~~~y~~~v~En~~~gt~v~~  129 (213)
T 3qrb_A           50 VFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGEAVEDPMEIVITVTDQNDNRPEFTQEVFEGSVAEGAVPGTSVMK  129 (213)
T ss_dssp             SEEECTTTCEEEECSCCCTTTCSEEEEEEEEEETTSCBCSCCEEEEEEEECCSCCCCEESCSEEEEEEETTCCTTCEEEE
T ss_pred             eEEEECCCCEEEECCccCcccCceEEEEEEEEeCCCCcccceEEEEEEEEEccCCCCccCCCceEEEEECCCCCCcEEEE
Confidence            555654 6999999999999999999999999999988889999999999999999999998886 99999999999999


Q ss_pred             EEEEeCCCC
Q psy11095         85 VNAIDKDGT   93 (102)
Q Consensus        85 v~a~D~D~~   93 (102)
                      +.|+|+|.+
T Consensus       130 v~A~D~D~~  138 (213)
T 3qrb_A          130 VSATDADDD  138 (213)
T ss_dssp             CCEECCSCT
T ss_pred             EEEEeCCCC
Confidence            999999998
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 102
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 6e-05
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 1e-04
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 4e-04
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

 Score = 37.0 bits (84), Expect = 6e-05
 Identities = 11/39 (28%), Positives = 17/39 (43%)

Query: 18  VNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILED 56
           +   LD E   EY LT++  +     L+ E    I + D
Sbjct: 75  IGTGLDREKFPEYTLTVQATDLEGAGLSVEGKAIIQITD 113
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.34
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.29
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.28
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.25
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.06
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.05
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.01
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.0
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.0
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 98.98
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 98.95
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 98.92
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 98.87
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 98.77
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 98.75
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 98.39
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 98.16
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: N-cadherin (neural)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.34  E-value=5.1e-13  Score=80.26  Aligned_cols=76  Identities=12%  Similarity=0.030  Sum_probs=61.6

Q ss_pred             CccEEECCceeEEEcCcCCcccCCEEEEEEEEEECCCCCceeeEEEEEEEecCCCCCcEeecCcc-e-EEeCCCCCCcEE
Q psy11095          5 FLCYLLFTWADIKVNHPLDYETIKEYNLTIRVENNGAQQLASEATVHIILEDVNDEIPLFTEREQ-E-TVLEGEPIGSKV   82 (102)
Q Consensus         5 ~~~f~~~~~G~i~~~~~LD~E~~~~~~l~v~a~d~~~~~~~~~~~v~i~v~d~Nd~~P~f~~~~~-~-~v~E~~~~g~~v   82 (102)
                      ..+|.++.+|.|+++++||||.. .|.|.|.|+|.+.+. ...+.|+|.+.+.|++.|.|....+ . .++|....|..+
T Consensus        53 ~~~F~i~~~G~I~~~~~ld~e~~-~y~l~V~A~D~g~~~-~~~t~V~i~v~d~nd~~p~~~~~~~~~i~~P~~~~~~~~~  130 (136)
T d1op4a_          53 PADFKVDEDGTVYAVRSFPLTAE-QAKFLIYAQDKETQE-KWQVAVNLSREPTLTEEPMKEPHEIEEIVFPRQLAKHSGA  130 (136)
T ss_dssp             SSEEEEETTTEEEEESCCSCSSS-CEEEEEEEEETTTTE-EEEEEEEECCCCCCCCCCSSCCCCSCCCSSCCCCCCCCSC
T ss_pred             ceeeeccccEEEEEecccCcccc-eEEEEEEEEecCCcc-eeeeEEEEEEcccCCCCCcccCCCCceEEccCcCCCCCCc
Confidence            34677888899999999999975 699999999998765 4567899999999999999986654 3 677876666543
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure